HHsearch alignment for GI: 254780163 and conserved domain: COG0464

>COG0464 SpoVK ATPases of the AAA+ class [Posttranslational modification, protein turnover, chaperones].
Probab=99.39  E-value=5.6e-11  Score=98.07  Aligned_cols=195  Identities=25%  Similarity=0.359  Sum_probs=129.2

Q ss_pred             CEEEECCCCCHHHHHHHHHHHHHHCCCCCHHHHEEEEEEEEHHHHHCCCCCCCHHHHHHHHHHHHHCCCCCEEEEECCHH
Q ss_conf             74896676411668999999998548988345201445540467530634312378999999987203898399973616
Q gi|254780163|r  227 NPLYVGDPGVGKTAIAEGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIESYANAILYIDEIH  306 (798)
Q Consensus       227 n~~lvG~~gvGktaive~la~~i~~~~vp~~l~~~~i~~ld~~~l~ag~~~rg~fe~r~~~~~~~~~~~~~~ilfideih  306 (798)
T Consensus       278 giLl~GpPGtGKT~lAkava~----------~~~~~fi~v~~~~l--~sk~vGesek~ir~~F~~A~~~~p~iifiDEiD  345 (494)
T COG0464         278 GVLLYGPPGTGKTLLAKAVAL----------ESRSRFISVKGSEL--LSKWVGESEKNIRELFEKARKLAPSIIFIDEID  345 (494)
T ss_pred             EEEEECCCCCCHHHHHHHHHH----------HCCCCEEEECCHHH--HHHHHHHHHHHHHHHHHHHHHCCCCEEEHHHHH
T ss_conf             699988999758999999875----------44982488433555--407765999999999999996699889748866


Q ss_pred             HHHCCCCCCCC-CC-CH-HHHHHHH--H-CCCCEEEEEECCHHHHHHHHHCCHHHHH--HCEE-EEECCCCHHHHHHHHH
Q ss_conf             63015544434-47-77-8888766--3-0266038873048999998520111432--0014-4306878689999998
Q gi|254780163|r  307 TLVGAGSASGI-SV-DA-SNLLKPA--L-SSGAVRCIGSTTYSEYRQFFEKDKALVR--RFQK-IDVSEPSIEDAIEIVK  377 (798)
Q Consensus       307 ~ligag~~~g~-~~-d~-an~lkP~--L-~rg~~~~IgatT~~ey~~~~e~d~al~r--rF~~-i~v~ep~~~~~~~iL~  377 (798)
T Consensus       346 s~~~~r~~~~~~~~~rv~~~ll~~~d~~e~~~~v~vi~aTN~p~-----~ld~a~lR~gRfd~~i~v~~pd~~~r~~i~~  420 (494)
T COG0464         346 SLASGRGPSEDGSGRRVVGQLLTELDGIEKAEGVLVIAATNRPD-----DLDPALLRPGRFDRLIYVPLPDLEERLEIFK  420 (494)
T ss_pred             HHHCCCCCCCCCHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCC-----CCCHHHHCCCCCEEEEEECCCCHHHHHHHHH
T ss_conf             67412899876379999999999974754437648996479833-----2687562436630378717989899999999


Q ss_pred             HHHHHHHHHCCCEECCHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHHH-HCCCCHHHHHHHHHH
Q ss_conf             6127665410351211178999998654201555646798899865333321144322-113657899986631
Q gi|254780163|r  378 GIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLPDKAIDVIDEAGASQILQPLSKR-RKFITEKDIKKTIAS  450 (798)
Q Consensus       378 ~~~~~ye~~h~v~~~~~al~~av~ls~ryi~~r~lPdkAidllDea~a~~~~~~~~~~-~~~~~~~~i~~~~~~  450 (798)
T Consensus       421 ~~~~~~~~~---~~~~~~~~~l~~~t-----~~~sgadi~~i~~ea~----~~~~~~~~~~~~~~~~~~~a~~~  482 (494)
T COG0464         421 IHLRDKKPP---LAEDVDLEELAEIT-----EGYSGADIAALVREAA----LEALREARRREVTLDDFLDALKK  482 (494)
T ss_pred             HHHCCCCCC---HHHHHHHHHHHHHH-----CCCCHHHHHHHHHHHH----HHHHHHCCCCCCCHHHHHHHHHH
T ss_conf             985415651---15564199999875-----2778999999999999----98998545776349999999862