HHsearch alignment for GI: 254780163 and conserved domain: COG0714

>COG0714 MoxR-like ATPases [General function prediction only].
Probab=98.93  E-value=3.8e-08  Score=77.72  Aligned_cols=151  Identities=26%  Similarity=0.385  Sum_probs=90.3

Q ss_pred             HHHHHHHHHHHHHHHHHCCCCCCEEEECCCCCHHHHHHHHHHHHHHCCCCCHHHHEEEEEEEEHHHHHCCCCCCCHH--H
Q ss_conf             22217899999999862267787489667641166899999999854898834520144554046753063431237--8
Q gi|254780163|r  205 ILVGRHEEINRTIQILCRRSKNNPLYVGDPGVGKTAIAEGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGDF--E  282 (798)
Q Consensus       205 PVIGRd~EI~riiqIL~RR~KNn~~lvG~~gvGktaive~la~~i~~~~vp~~l~~~~i~~ld~~~l~ag~~~rg~f--e  282 (798)
T Consensus        25 ~~~g~~~~~~~~l~a~~~~~--~vll~G~PG~gKT~la~~lA~~l~----------~~~~~i~~t~~l~p~d~~G~~~~~   92 (329)
T COG0714          25 VVVGDEEVIELALLALLAGG--HVLLEGPPGVGKTLLARALARALG----------LPFVRIQCTPDLLPSDLLGTYAYA   92 (329)
T ss_pred             CCCCCHHHHHHHHHHHHCCC--CEEEECCCCCCHHHHHHHHHHHHC----------CCCEEEECCCCCCHHHHCCHHHHH
T ss_conf             55266999999999998599--778779898777999999999838----------981899568998888820568887


Q ss_pred             HHHH--HHHHHHCC--CCC--EEEEECCHHHHHCCCCCCCCCCCHHHHHHHHHCCCCEE--------------EEEECCH
Q ss_conf             9999--99987203--898--39997361663015544434477788887663026603--------------8873048
Q gi|254780163|r  283 ERIK--KIVKEIES--YAN--AILYIDEIHTLVGAGSASGISVDASNLLKPALSSGAVR--------------CIGSTTY  342 (798)
Q Consensus       283 ~r~~--~~~~~~~~--~~~--~ilfideih~ligag~~~g~~~d~an~lkP~L~rg~~~--------------~IgatT~  342 (798)
T Consensus        93 ~~~~~~~~~~~~~gpl~~~~~~ill~DEInra---------~p~~q~aLl~~l~e~~vt~~~~~~~~~~~~f~viaT~Np  163 (329)
T COG0714          93 ALLLEPGEFRFVPGPLFAAVRVILLLDEINRA---------PPEVQNALLEALEERQVTVPGLTTIRLPPPFIVIATQNP  163 (329)
T ss_pred             HHHCCCCEEEEECCCCCCCCCEEEEEECCCCC---------CHHHHHHHHHHHHHCEEEECCCCCCCCCCCCEEEEECCC
T ss_conf             66425771898468733451338998703458---------988999999999726897079665337998789982686


Q ss_pred             HHHHHHHHCCHHHHHHC-EEEEECCCCHHHHHHHH
Q ss_conf             99999852011143200-14430687868999999
Q gi|254780163|r  343 SEYRQFFEKDKALVRRF-QKIDVSEPSIEDAIEIV  376 (798)
Q Consensus       343 ~ey~~~~e~d~al~rrF-~~i~v~ep~~~~~~~iL  376 (798)
T Consensus       164 ~e~~g~~~l~eA~ldRf~~~~~v~yp~~~~e~~~i  198 (329)
T COG0714         164 GEYEGTYPLPEALLDRFLLRIYVDYPDSEEEERII  198 (329)
T ss_pred             CCCCCCCCCCHHHHCCCEEEEECCCCCCHHHHHHH
T ss_conf             76578878998888103887764899738899999