HHsearch alignment for GI: 254780163 and conserved domain: COG1219

>COG1219 ClpX ATP-dependent protease Clp, ATPase subunit [Posttranslational modification, protein turnover, chaperones].
Probab=98.33  E-value=1.7e-05  Score=58.65  Aligned_cols=167  Identities=26%  Similarity=0.406  Sum_probs=100.9

Q ss_pred             CCCCEEEECCCCCHHHHHHHHHHHHHHCCCCCHHHHEEEEEEEEHHHHHCCCCCCCH-HHHHHHHHHHHH----CCCCCE
Q ss_conf             778748966764116689999999985489883452014455404675306343123-789999999872----038983
Q gi|254780163|r  224 SKNNPLYVGDPGVGKTAIAEGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGD-FEERIKKIVKEI----ESYANA  298 (798)
Q Consensus       224 ~KNn~~lvG~~gvGktaive~la~~i~~~~vp~~l~~~~i~~ld~~~l~ag~~~rg~-fe~r~~~~~~~~----~~~~~~  298 (798)
T Consensus        96 ~KSNILLiGPTGsGKTlLAqTLAk~L---nVPFaiADATt--------LTEAGYVGEDVENillkLlqaadydV~rAerG  164 (408)
T COG1219          96 SKSNILLIGPTGSGKTLLAQTLAKIL---NVPFAIADATT--------LTEAGYVGEDVENILLKLLQAADYDVERAERG  164 (408)
T ss_pred             EECCEEEECCCCCCHHHHHHHHHHHH---CCCEEECCCCC--------HHHCCCCCHHHHHHHHHHHHHCCCCHHHHHCC
T ss_conf             20317998889975779999999984---89847514441--------21066355008999999998764588888288


Q ss_pred             EEEECCHHHHHCCCCCCCCC----------------------------------------CCHHHHH-----------HH
Q ss_conf             99973616630155444344----------------------------------------7778888-----------76
Q gi|254780163|r  299 ILYIDEIHTLVGAGSASGIS----------------------------------------VDASNLL-----------KP  327 (798)
Q Consensus       299 ilfideih~ligag~~~g~~----------------------------------------~d~an~l-----------kP  327 (798)
T Consensus       165 IIyIDEIDKIa--rkSen~SITRDVSGEGVQQALLKiiEGTvasVPPqGGRKHP~Qe~iqvDT~NILFIcgGAF~Gleki  242 (408)
T COG1219         165 IIYIDEIDKIA--RKSENPSITRDVSGEGVQQALLKIIEGTVASVPPQGGRKHPQQEFIQVDTSNILFICGGAFAGLEKI  242 (408)
T ss_pred             EEEEECHHHHH--CCCCCCCCCCCCCCHHHHHHHHHHHCCCEECCCCCCCCCCCCCCEEEECCCCEEEEECCCCCCHHHH
T ss_conf             59985102542--0578987234367358999999997075102399988879842048873763467824401039999


Q ss_pred             HHCCCCEEEEEEC----------CHHHHHHHHHCCH--------HHHHHCEE-EEECCCCHHHHHHHHH----HHHHHHH
Q ss_conf             6302660388730----------4899999852011--------14320014-4306878689999998----6127665
Q gi|254780163|r  328 ALSSGAVRCIGST----------TYSEYRQFFEKDK--------ALVRRFQK-IDVSEPSIEDAIEIVK----GIKPYFE  384 (798)
Q Consensus       328 ~L~rg~~~~Igat----------T~~ey~~~~e~d~--------al~rrF~~-i~v~ep~~~~~~~iL~----~~~~~ye  384 (798)
T Consensus       243 I~~R~~~~~iGF~a~~~~~~~~~~~~~~l~~vepeDLvkFGLIPEfIGRlPvia~L~~Lde~aLv~ILtePkNAlvKQYq  322 (408)
T COG1219         243 IKKRLGKKGIGFGAEVKSKSKKKEEGELLKQVEPEDLVKFGLIPEFIGRLPVIATLEELDEDALVQILTEPKNALVKQYQ  322 (408)
T ss_pred             HHHHCCCCCCCCCCCCCCHHHHHHHHHHHHHCCHHHHHHCCCCHHHHCCCCEEEEHHHCCHHHHHHHHHCCCHHHHHHHH
T ss_conf             99862687424566445344441288998754868788708838872666326461015999999997265178999999


Q ss_pred             HHC-----CCEECCHHHHHHHHHH
Q ss_conf             410-----3512111789999986
Q gi|254780163|r  385 EHH-----QLRYSKEAIRAAVQLS  403 (798)
Q Consensus       385 ~~h-----~v~~~~~al~~av~ls  403 (798)
T Consensus       323 ~Lf~~d~V~L~F~~~AL~~IA~~A  346 (408)
T COG1219         323 KLFEMDGVELEFTEEALKAIAKKA  346 (408)
T ss_pred             HHHCCCCCEEEECHHHHHHHHHHH
T ss_conf             996446916997489999999999