HHsearch alignment for GI: 254780163 and conserved domain: COG1221

>COG1221 PspF Transcriptional regulators containing an AAA-type ATPase domain and a DNA-binding domain [Transcription / Signal transduction mechanisms].
Probab=99.30  E-value=2.3e-10  Score=93.60  Aligned_cols=224  Identities=21%  Similarity=0.332  Sum_probs=147.5

Q ss_pred             HCCHHHHHHHCHHHHHHHHHHHHHHHHCCCCCCCCCCCEEEEECCCCHHHHHHHHHHHHHC----CCCEEEEEHHHHHCC
Q ss_conf             0000246653458999999999877520445657874068861432003889999987304----773377206886124
Q gi|254780163|r  471 LEKNLGTVVYGQEEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFAL----GVQLLRFDMSEYMER  546 (798)
Q Consensus       471 l~~~l~~~v~GQ~~ai~~v~~~i~~~~~gl~~~~rP~g~flf~GptGvGKTelak~la~~~----~~~lir~dmsey~e~  546 (798)
T Consensus        72 ~~~~~~~~LIG~~~~~~~~~eqik~----~ap~~~~---vLi~GetGtGKel~A~~iH~~s~r~~~~PFI~~NCa~~~en  144 (403)
T COG1221          72 LKSEALDDLIGESPSLQELREQIKA----YAPSGLP---VLIIGETGTGKELFARLIHALSARRAEAPFIAFNCAAYSEN  144 (403)
T ss_pred             CCCHHHHHHHCCCHHHHHHHHHHHH----HCCCCCC---EEEECCCCCCHHHHHHHHHHHHHCCCCCCEEEEEHHHHCCC
T ss_conf             0221566663568889999999986----1899984---79866887538899999998612135898799777773767


Q ss_pred             CCCCHHCCCCCH-HCC--CCCCCCCCHHHHHCCCEEEEECCHHHCCHHHHHHHHHHHHHHHCC---CCCCCEECCCCEEE
Q ss_conf             653011047800-025--644431003555158517774044550289999999987775021---77997761254299
Q gi|254780163|r  547 HAVSRLIGAPPG-YVG--FGQGGILADSVDQNPYSVVLLDEIEKSHPDVLNILLQIMDYGILT---DQSGKKISFRNVIL  620 (798)
Q Consensus       547 ~~vs~LiGappG-YvG--~~egg~Lte~vr~~P~sVvl~DEiEKAh~~v~~~llqild~G~lt---d~~Gr~vdf~n~ii  620 (798)
T Consensus       145 ~~~~eLFG~~kGaftGa~~~k~Glfe~----A~GGtLfLDEI~~LP~~~Q~kLl~~le~g~~~rvG~~~~~~~dVR---l  217 (403)
T COG1221         145 LQEAELFGHEKGAFTGAQGGKAGLFEQ----ANGGTLFLDEIHRLPPEGQEKLLRVLEEGEYRRVGGSQPRPVDVR---L  217 (403)
T ss_pred             HHHHHHHCCCCCEEECCCCCCCCHHEE----CCCCEEEHHHHHHCCHHHHHHHHHHHHCCCEEECCCCCCCCCCCE---E
T ss_conf             777777320000002566786764205----279777656365379858999999987186576688888677740---4


Q ss_pred             EEECCCCHHHHHHCCCCCCCCCCHHHHHHHHHHHCCHHHHC-CCCEEEECCCCCHHHHHHHHHHHHHHHHHHHHHCCCEE
Q ss_conf             99424214553303689882111488999998728878817-76828962889999999999999999999998669889
Q gi|254780163|r  621 IMTTNAGALEMSKARIGFGSSRNDDADKEALRNFLSPEFLN-RLDSIIPFFPLSSDIIRQVVHKFIMKLELQLQEKGISF  699 (798)
Q Consensus       621 i~TsN~G~~~~~~~~~g~~~~~~~~~~~~~l~~~f~pefln-Rid~ii~F~~l~~~~~~~i~~~~l~~l~~~l~~~~i~l  699 (798)
T Consensus       218 i~AT~~~l-------------------~~~~~~g--~dl~~rl~~~~I~LPpLrER-~~Di~~L~e~Fl~~~~~~l~~~~  275 (403)
T COG1221         218 ICATTEDL-------------------EEAVLAG--ADLTRRLNILTITLPPLRER-KEDILLLAEHFLKSEARRLGLPL  275 (403)
T ss_pred             EECCCCCH-------------------HHHHHHH--CCHHHHHCCCEECCCCHHHC-HHHHHHHHHHHHHHHHHHCCCCC
T ss_conf             51356687-------------------9998740--52556416754318972435-55599999999999999739998


Q ss_pred             EECH-HHHHHHHHCCCCCCCCCHHHHHHHHHHHH
Q ss_conf             9988-99999997189810153267999998623
Q gi|254780163|r  700 HFSE-EVINWLVSHGYDVKMGARPLERIIKEHVK  732 (798)
Q Consensus       700 ~~~~-~~~~~l~~~~~~~~~GAR~l~r~i~~~i~  732 (798)
T Consensus       276 ~~~~~~a~~~L~~--y~~pGNirELkN~Ve~~~~  307 (403)
T COG1221         276 SVDSPEALRALLA--YDWPGNIRELKNLVERAVA  307 (403)
T ss_pred             CCCCHHHHHHHHH--CCCCCCHHHHHHHHHHHHH
T ss_conf             8888999999984--8899839999999999999