HHsearch alignment for GI: 254780163 and conserved domain: COG1373

>COG1373 Predicted ATPase (AAA+ superfamily) [General function prediction only].
Probab=96.01  E-value=0.15  Score=30.40  Aligned_cols=170  Identities=18%  Similarity=0.201  Sum_probs=97.9

Q ss_pred             HHHHHHHHHHHHHHCCCCCCEEEECCCCCHHHHHHHHHHHHHHCCCCCHHHHEEEEEEEEHHHHHCCCCCCCHHHHHHHH
Q ss_conf             17899999999862267787489667641166899999999854898834520144554046753063431237899999
Q gi|254780163|r  208 GRHEEINRTIQILCRRSKNNPLYVGDPGVGKTAIAEGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGDFEERIKK  287 (798)
Q Consensus       208 GRd~EI~riiqIL~RR~KNn~~lvG~~gvGktaive~la~~i~~~~vp~~l~~~~i~~ld~~~l~ag~~~rg~fe~r~~~  287 (798)
T Consensus        21 ~~~~~~~~l~~~~~~~~~-i~~i~GpR~~GKTtllk~l~~~~~~-----~--~iy~~~~d~~~~--~~----~l~d~~~~   86 (398)
T COG1373          21 ERRKLLPRLIKKLDLRPF-IILILGPRQVGKTTLLKLLIKGLLE-----E--IIYINFDDLRLD--RI----ELLDLLRA   86 (398)
T ss_pred             HHHHHHHHHHHHHCCCCC-EEEEECCCCCCHHHHHHHHHHHCCC-----C--EEEEECCCCCCC--HH----HHHHHHHH
T ss_conf             367677998765035785-4999888647789999999974777-----3--599973620001--35----67789999


Q ss_pred             HHHHHCCCCCEEEEECCHHHHHCCCCCCCCCCCHHHHHHHHHCCCCEEEEEECC-HHHHHHHHHCCHHHHHHCEEEEECC
Q ss_conf             998720389839997361663015544434477788887663026603887304-8999998520111432001443068
Q gi|254780163|r  288 IVKEIESYANAILYIDEIHTLVGAGSASGISVDASNLLKPALSSGAVRCIGSTT-YSEYRQFFEKDKALVRRFQKIDVSE  366 (798)
Q Consensus       288 ~~~~~~~~~~~ilfideih~ligag~~~g~~~d~an~lkP~L~rg~~~~IgatT-~~ey~~~~e~d~al~rrF~~i~v~e  366 (798)
T Consensus        87 ~~~~~~~-~~~yifLDEIq~v~----------~W~~~lk~l~d~~~~~v~itgsss~ll~~--~~s~~L~GR~~~~~l~P  153 (398)
T COG1373          87 YIELKER-EKSYIFLDEIQNVP----------DWERALKYLYDRGNLDVLITGSSSSLLSK--EISESLAGRGKDLELYP  153 (398)
T ss_pred             HHHHHCC-CCCEEEEEEECCCH----------HHHHHHHHHHCCCCCEEEEECCCHHHHCC--CHHHHCCCCEEEEEECC
T ss_conf             9985222-57459998333761----------08999999975677509998371675413--30232499823789848


Q ss_pred             CCHHHHHHHHHHHHHHHHHHCCCEECCHHHHHHHHHHHHHCCCCCCHHHHHH
Q ss_conf             7868999999861276654103512111789999986542015556467988
Q gi|254780163|r  367 PSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLPDKAID  418 (798)
Q Consensus       367 p~~~~~~~iL~~~~~~ye~~h~v~~~~~al~~av~ls~ryi~~r~lPdkAid  418 (798)
T Consensus       154 lSF~Efl~~~~---~------~~~~~----~~-~~~f~~Yl~~GGfP~~v~~  191 (398)
T COG1373         154 LSFREFLKLKG---E------EIEPS----KL-ELLFEKYLETGGFPESVKA  191 (398)
T ss_pred             CCHHHHHHHCC---C------CCCHH----HH-HHHHHHHHHHCCCCHHHHC
T ss_conf             88899864135---2------10025----67-9999998772898566526