HHsearch alignment for GI: 254780163 and conserved domain: COG1485

>COG1485 Predicted ATPase [General function prediction only].
Probab=96.72  E-value=0.022  Score=36.31  Aligned_cols=105  Identities=24%  Similarity=0.314  Sum_probs=51.8

Q ss_pred             CCCEEEEECCCCHHHHHHHHHHHHHCCC-CEEEEEHHHHHCC--CCCCHHCCCCCHHCCCCCCCCCCHHHHHCCCEEEEE
Q ss_conf             7406886143200388999998730477-3377206886124--653011047800025644431003555158517774
Q gi|254780163|r  506 PIGCYVFSGPTGVGKTEISKQLAFALGV-QLLRFDMSEYMER--HAVSRLIGAPPGYVGFGQGGILADSVDQNPYSVVLL  582 (798)
Q Consensus       506 P~g~flf~GptGvGKTelak~la~~~~~-~lir~dmsey~e~--~~vs~LiGappGYvG~~egg~Lte~vr~~P~sVvl~  582 (798)
T Consensus        65 ~~G-lYl~GgVGrGKT~LMD~Fy~~lp~~~k~R~HFh~FM~~vH~~l~~l~g~~------dpl~~iA~~~~-~~~~vLCf  136 (367)
T COG1485          65 VRG-LYLWGGVGRGKTMLMDLFYESLPGERKRRLHFHRFMARVHQRLHTLQGQT------DPLPPIADELA-AETRVLCF  136 (367)
T ss_pred             CCE-EEEECCCCCCHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHHHHHHHCCCC------CCCHHHHHHHH-HCCCEEEE
T ss_conf             835-88889978649999999986587645665507799999999999971888------86579999998-41788986


Q ss_pred             CCHHHCCHH---HHHHHH-HHHHHHHCCCCCCCEECCCCEEEEEECCCCHHHHH
Q ss_conf             044550289---999999-98777502177997761254299994242145533
Q gi|254780163|r  583 DEIEKSHPD---VLNILL-QIMDYGILTDQSGKKISFRNVILIMTTNAGALEMS  632 (798)
Q Consensus       583 DEiEKAh~~---v~~~ll-qild~G~ltd~~Gr~vdf~n~iii~TsN~G~~~~~  632 (798)
T Consensus       137 DEF~VtDI~DAMiL~rL~~~Lf~~--------------GV~lvaTSN~~P~~LY  176 (367)
T COG1485         137 DEFEVTDIADAMILGRLLEALFAR--------------GVVLVATSNTAPDNLY  176 (367)
T ss_pred             EEEEECCHHHHHHHHHHHHHHHHC--------------CCEEEEECCCCHHHHC
T ss_conf             303623757889999999999977--------------9689995899967854