HHsearch alignment for GI: 254780163 and conserved domain: COG2804

>COG2804 PulE Type II secretory pathway, ATPase PulE/Tfp pilus assembly pathway, ATPase PilB [Cell motility and secretion / Intracellular trafficking and secretion].
Probab=96.75  E-value=0.0019  Score=43.97  Aligned_cols=96  Identities=25%  Similarity=0.353  Sum_probs=55.4

Q ss_pred             CCCCCEEEEECCCCHHHHHHHHHH-H--HHCCCCEEEE-EHHHHHCCCCCCHHCCCCCHHCCCCCCCCCCHHHHHCCCEE
Q ss_conf             787406886143200388999998-7--3047733772-06886124653011047800025644431003555158517
Q gi|254780163|r  504 NKPIGCYVFSGPTGVGKTEISKQL-A--FALGVQLLRF-DMSEYMERHAVSRLIGAPPGYVGFGQGGILADSVDQNPYSV  579 (798)
Q Consensus       504 ~rP~g~flf~GptGvGKTelak~l-a--~~~~~~lir~-dmsey~e~~~vs~LiGappGYvG~~egg~Lte~vr~~P~sV  579 (798)
T Consensus       255 ~~p~GliLvTGPTGSGKTTTLY~~L~~ln~~~~nI~TiEDPVE~~~~gI~Q~qVN~---k~gltfa~~LRa~LRqDP-Dv  330 (500)
T COG2804         255 NRPQGLILVTGPTGSGKTTTLYAALSELNTPERNIITIEDPVEYQLPGINQVQVNP---KIGLTFARALRAILRQDP-DV  330 (500)
T ss_pred             HCCCEEEEEECCCCCCHHHHHHHHHHHHCCCCCEEEEEECCEEEECCCCCEEECCC---CCCCCHHHHHHHHHCCCC-CE
T ss_conf             28970899968999988999999999862788508984078045159851563140---359978999999866599-85


Q ss_pred             EEECCHHHCCHHHHHHHHHHHHHHHC
Q ss_conf             77404455028999999998777502
Q gi|254780163|r  580 VLLDEIEKSHPDVLNILLQIMDYGIL  605 (798)
Q Consensus       580 vl~DEiEKAh~~v~~~llqild~G~l  605 (798)
T Consensus       331 ImVGEIRD--~ETAeiavqAalTGHL  354 (500)
T COG2804         331 IMVGEIRD--LETAEIAVQAALTGHL  354 (500)
T ss_pred             EEEECCCC--HHHHHHHHHHHHCCCE
T ss_conf             99835577--8899999999842886