HHsearch alignment for GI: 254780163 and conserved domain: KOG0055

>KOG0055 consensus.
Probab=95.80  E-value=0.095  Score=31.73  Aligned_cols=43  Identities=28%  Similarity=0.421  Sum_probs=27.2

Q ss_pred             CEEEECCCCCHHHHHHHHHHHHH--HCCCCCHHHHEEEEEEEEHHHH
Q ss_conf             74896676411668999999998--5489883452014455404675
Q gi|254780163|r  227 NPLYVGDPGVGKTAIAEGFAKQI--VDGMVPDILLGARIFSLDMGNL  271 (798)
Q Consensus       227 n~~lvG~~gvGktaive~la~~i--~~~~vp~~l~~~~i~~ld~~~l  271 (798)
T Consensus       381 ~valVG~SGsGKST~i~LL~RfydP~~G~V--~iDG~di~~~~~~~L  425 (1228)
T KOG0055         381 TVALVGPSGSGKSTLIQLLARFYDPTSGEV--LIDGEDIRNLNLKWL  425 (1228)
T ss_pred             EEEEECCCCCCHHHHHHHHHHHCCCCCCEE--EECCCCCHHCCHHHH
T ss_conf             899988999879999999997268878659--976856012265999