HHsearch alignment for GI: 254780163 and conserved domain: KOG0651

>KOG0651 consensus.
Probab=98.40  E-value=1.9e-06  Score=65.42  Aligned_cols=157  Identities=23%  Similarity=0.353  Sum_probs=69.2

Q ss_pred             CHHHHHHHHHHHHHHHHHHCCCCCC-------------EEEECCCCCHHHHHHHHHHHHHHCCCCCHHHHEEEEEEEEHH
Q ss_conf             1122217899999999862267787-------------489667641166899999999854898834520144554046
Q gi|254780163|r  203 VDILVGRHEEINRTIQILCRRSKNN-------------PLYVGDPGVGKTAIAEGFAKQIVDGMVPDILLGARIFSLDMG  269 (798)
Q Consensus       203 LDPVIGRd~EI~riiqIL~RR~KNn-------------~~lvG~~gvGktaive~la~~i~~~~vp~~l~~~~i~~ld~~  269 (798)
T Consensus       131 ~~~~ggl~~qirelre~ielpl~np~lf~rvgIk~Pkg~ll~GppGtGKTlla~~Vaa~m----------g~nfl~v~ss  200 (388)
T KOG0651         131 FENVGGLFYQIRELREVIELPLTNPELFLRVGIKPPKGLLLYGPPGTGKTLLARAVAATM----------GVNFLKVVSS  200 (388)
T ss_pred             HHHHCCHHHHHHHHHHHEEEECCCCHHCCCCCCCCCCEEEEECCCCCCHHHHHHHHHHHC----------CCCEEEEEHH
T ss_conf             877178388889988655740248100234577788256876799986459999999865----------9854774476


Q ss_pred             HHHCCCCCCCHHHHHHHHHHHHHCCCCCEEEEECCHHHHHCCCCCCCCCC---------CHHHHHHHHHCCCCEEEEEEC
Q ss_conf             75306343123789999999872038983999736166301554443447---------778888766302660388730
Q gi|254780163|r  270 NLIAGTRYRGDFEERIKKIVKEIESYANAILYIDEIHTLVGAGSASGISV---------DASNLLKPALSSGAVRCIGST  340 (798)
Q Consensus       270 ~l~ag~~~rg~fe~r~~~~~~~~~~~~~~ilfideih~ligag~~~g~~~---------d~an~lkP~L~rg~~~~Igat  340 (798)
T Consensus       201 ~lv~--kyiGEsaRlIRemf~yA~~~~pciifmdeiDAigGRr~se~Ts~dreiqrTLMeLlnqmdgfd~l~rVk~Imat  278 (388)
T KOG0651         201 ALVD--KYIGESARLIRDMFRYAREVIPCIIFMDEIDAIGGRRFSEGTSSDREIQRTLMELLNQMDGFDTLHRVKTIMAT  278 (388)
T ss_pred             HHHH--HHCCCHHHHHHHHHHHHHHHCCEEEEEHHHHHHCCEEECCCCCHHHHHHHHHHHHHHHHCCCHHCCCCCEEEEC
T ss_conf             6633--00265788999999778652755775101231145773355520599999999998742140120663179853


Q ss_pred             CHHHHHHHHHCCHHHHH--HCE-EEEECCCCHHHHHHHH
Q ss_conf             48999998520111432--001-4430687868999999
Q gi|254780163|r  341 TYSEYRQFFEKDKALVR--RFQ-KIDVSEPSIEDAIEIV  376 (798)
Q Consensus       341 T~~ey~~~~e~d~al~r--rF~-~i~v~ep~~~~~~~iL  376 (798)
T Consensus       279 Nrp-----dtLdpaLlRpGRldrk~~iPlpne~~r~~I~  312 (388)
T KOG0651         279 NRP-----DTLDPALLRPGRLDRKVEIPLPNEQARLGIL  312 (388)
T ss_pred             CCC-----CCCCHHHCCCCCCCCEECCCCCCHHHCEEEE
T ss_conf             886-----6566554287521110026885544240267