HHsearch alignment for GI: 254780163 and conserved domain: KOG0734

>KOG0734 consensus.
Probab=98.35  E-value=9.8e-07  Score=67.56  Aligned_cols=95  Identities=29%  Similarity=0.467  Sum_probs=65.8

Q ss_pred             HHHHCHHHHHHHHHHHHH-------HHHCCCCCCCCCCCEEEEECCCCHHHHHHHHHHHHHCCCCEEEEEHHHHHCCCCC
Q ss_conf             665345899999999987-------7520445657874068861432003889999987304773377206886124653
Q gi|254780163|r  477 TVVYGQEEAIKKLSSSIK-------IARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFALGVQLLRFDMSEYMERHAV  549 (798)
Q Consensus       477 ~~v~GQ~~ai~~v~~~i~-------~~~~gl~~~~rP~g~flf~GptGvGKTelak~la~~~~~~lir~dmsey~e~~~v  549 (798)
T Consensus       304 ~dVkG~DEAK~ELeEiVefLkdP~kftrLGGK---LPKGV-LLvGPPGTGKTlLARAvAGEA~VPFF~~sGSEFdEm---  376 (752)
T KOG0734         304 EDVKGVDEAKQELEEIVEFLKDPTKFTRLGGK---LPKGV-LLVGPPGTGKTLLARAVAGEAGVPFFYASGSEFDEM---  376 (752)
T ss_pred             CCCCCHHHHHHHHHHHHHHHCCCHHHHHCCCC---CCCCE-EEECCCCCCHHHHHHHHHCCCCCCEEECCCCCHHHH---
T ss_conf             02147278999999999986090876431475---88853-876899975569999860556897474166204454---


Q ss_pred             CHHCCCCCHHCCCCCC--CCCCHHHHHCCCEEEEECCHHH
Q ss_conf             0110478000256444--3100355515851777404455
Q gi|254780163|r  550 SRLIGAPPGYVGFGQG--GILADSVDQNPYSVVLLDEIEK  587 (798)
Q Consensus       550 s~LiGappGYvG~~eg--g~Lte~vr~~P~sVvl~DEiEK  587 (798)
T Consensus       377 ---------~VGvGArRVRdLF~aAk~~APcIIFIDEiDa  407 (752)
T KOG0734         377 ---------FVGVGARRVRDLFAAAKARAPCIIFIDEIDA  407 (752)
T ss_pred             ---------HHCCCHHHHHHHHHHHHHCCCEEEEEECHHH
T ss_conf             ---------2201489999999998734985999720022