HHsearch alignment for GI: 254780163 and conserved domain: KOG0738

>KOG0738 consensus.
Probab=99.20  E-value=3.4e-10  Score=92.46  Aligned_cols=222  Identities=25%  Similarity=0.389  Sum_probs=140.3

Q ss_pred             HCCCCHHHHHHHHHHHHHHH--HH----------HCCCCCCEEEECCCCCHHHHHHHHHHHHHHCCCCCHHHHEEEEEEE
Q ss_conf             54861122217899999999--86----------2267787489667641166899999999854898834520144554
Q gi|254780163|r  199 KKGKVDILVGRHEEINRTIQ--IL----------CRRSKNNPLYVGDPGVGKTAIAEGFAKQIVDGMVPDILLGARIFSL  266 (798)
Q Consensus       199 reGKLDPVIGRd~EI~riiq--IL----------~RR~KNn~~lvG~~gvGktaive~la~~i~~~~vp~~l~~~~i~~l  266 (798)
T Consensus       207 p~ikW~DIagl~~AK~lL~EAVvlPi~mPe~F~GirrPWkgvLm~GPPGTGKTlLAKAvATE----------c~tTFFNV  276 (491)
T KOG0738         207 PNIKWDDIAGLHEAKKLLKEAVVLPIWMPEFFKGIRRPWKGVLMVGPPGTGKTLLAKAVATE----------CGTTFFNV  276 (491)
T ss_pred             CCCCHHHHCCHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCEEEEECCCCCCHHHHHHHHHHH----------HCCEEEEE
T ss_conf             98676763164999999998875444248887424465300055679997478999999886----------16727874


Q ss_pred             EHHHHHCCCCCCCHHHHHHHHHHHHHCCCCCEEEEECCHHHHHCCCCCCCCCCCHHHHHHHHH-----------CC-CCE
Q ss_conf             046753063431237899999998720389839997361663015544434477788887663-----------02-660
Q gi|254780163|r  267 DMGNLIAGTRYRGDFEERIKKIVKEIESYANAILYIDEIHTLVGAGSASGISVDASNLLKPAL-----------SS-GAV  334 (798)
Q Consensus       267 d~~~l~ag~~~rg~fe~r~~~~~~~~~~~~~~ilfideih~ligag~~~g~~~d~an~lkP~L-----------~r-g~~  334 (798)
T Consensus       277 Ssstl--tSKwRGeSEKlvRlLFemARfyAPStIFiDEIDslcs~RG~s~-EHEaSRRvKsELLvQmDG~~~t~e~~k~V  353 (491)
T KOG0738         277 SSSTL--TSKWRGESEKLVRLLFEMARFYAPSTIFIDEIDSLCSQRGGSS-EHEASRRVKSELLVQMDGVQGTLENSKVV  353 (491)
T ss_pred             CHHHH--HHHHCCCHHHHHHHHHHHHHHHCCCEEEHHHHHHHHHCCCCCC-CHHHHHHHHHHHHHHHHCCCCCCCCCEEE
T ss_conf             02456--5553252699999999999874885353356778872579865-03678888889999863344444565169


Q ss_pred             EEEEECCHHHHHHHHHCCHHHHHHCEE-EEECCCCHHHHHHHHH---------------HHHHHHHHHCCCEECCHHHHH
Q ss_conf             388730489999985201114320014-4306878689999998---------------612766541035121117899
Q gi|254780163|r  335 RCIGSTTYSEYRQFFEKDKALVRRFQK-IDVSEPSIEDAIEIVK---------------GIKPYFEEHHQLRYSKEAIRA  398 (798)
Q Consensus       335 ~~IgatT~~ey~~~~e~d~al~rrF~~-i~v~ep~~~~~~~iL~---------------~~~~~ye~~h~v~~~~~al~~  398 (798)
T Consensus       354 mVLAATN~P-----WdiDEAlrRRlEKRIyIPLP~~~~R~~Li~~~l~~~~~~~~~~~~~lae~~eGySGaDI~nvCreA  428 (491)
T KOG0738         354 MVLAATNFP-----WDIDEALRRRLEKRIYIPLPDAEARSALIKILLRSVELDDPVNLEDLAERSEGYSGADITNVCREA  428 (491)
T ss_pred             EEEECCCCC-----CCHHHHHHHHHHHHEEEECCCHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHCCCCHHHHHHHHHHH
T ss_conf             998436898-----205799999876303312878789999999762356688875699999985688737799999999


Q ss_pred             HHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHH
Q ss_conf             9998654201555646798899865333321144322113657899986631
Q gi|254780163|r  399 AVQLSVRHFTSRKLPDKAIDVIDEAGASQILQPLSKRRKFITEKDIKKTIAS  450 (798)
Q Consensus       399 av~ls~ryi~~r~lPdkAidllDea~a~~~~~~~~~~~~~~~~~~i~~~~~~  450 (798)
T Consensus       429 sm~~mRR~i~g~-~~~-ei~~l----------akE~~~~pv~~~Dfe~Al~~  468 (491)
T KOG0738         429 SMMAMRRKIAGL-TPR-EIRQL----------AKEEPKMPVTNEDFEEALRK  468 (491)
T ss_pred             HHHHHHHHHHCC-CCH-HHHHH----------HHHCCCCCCCHHHHHHHHHH
T ss_conf             999999997247-917-76443----------23143456515659999997