HHsearch alignment for GI: 254780163 and conserved domain: KOG0739

>KOG0739 consensus.
Probab=98.79  E-value=7.8e-08  Score=75.45  Aligned_cols=133  Identities=27%  Similarity=0.479  Sum_probs=100.1

Q ss_pred             CCCEEEECCCCCHHHHHHHHHHHHHHCCCCCHHHHEEEEEEEEHHHHHCCCCCCCHHHHHHHHHHHHHCCCCCEEEEECC
Q ss_conf             78748966764116689999999985489883452014455404675306343123789999999872038983999736
Q gi|254780163|r  225 KNNPLYVGDPGVGKTAIAEGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIESYANAILYIDE  304 (798)
Q Consensus       225 KNn~~lvG~~gvGktaive~la~~i~~~~vp~~l~~~~i~~ld~~~l~ag~~~rg~fe~r~~~~~~~~~~~~~~ilfide  304 (798)
T Consensus       166 wrgiLLyGPPGTGKSYLAKAVATE----------AnSTFFSvSSSDLvS--KWmGESEkLVknLFemARe~kPSIIFiDE  233 (439)
T KOG0739         166 WRGILLYGPPGTGKSYLAKAVATE----------ANSTFFSVSSSDLVS--KWMGESEKLVKNLFEMARENKPSIIFIDE  233 (439)
T ss_pred             CEEEEEECCCCCCHHHHHHHHHHH----------CCCCEEEEEHHHHHH--HHHCCHHHHHHHHHHHHHHCCCCEEEEEH
T ss_conf             425788679997577999998741----------477068730178899--87321799999999998734994798634


Q ss_pred             HHHHHCCCCCCCCCCCHHHHHHHHHC---------CCCEEEEEECCHHHHHHHHHCCHHHHHHCEE-EEECCCCHHHHHH
Q ss_conf             16630155444344777888876630---------2660388730489999985201114320014-4306878689999
Q gi|254780163|r  305 IHTLVGAGSASGISVDASNLLKPALS---------SGAVRCIGSTTYSEYRQFFEKDKALVRRFQK-IDVSEPSIEDAIE  374 (798)
Q Consensus       305 ih~ligag~~~g~~~d~an~lkP~L~---------rg~~~~IgatT~~ey~~~~e~d~al~rrF~~-i~v~ep~~~~~~~  374 (798)
T Consensus       234 iDslcg~r~enE--seasRRIKTEfLVQMqGVG~d~~gvLVLgATNiP-w----~LDsAIRRRFekRIYIPLPe~~AR~~  306 (439)
T KOG0739         234 IDSLCGSRSENE--SEASRRIKTEFLVQMQGVGNDNDGVLVLGATNIP-W----VLDSAIRRRFEKRIYIPLPEAHARAR  306 (439)
T ss_pred             HHHHCCCCCCCC--HHHHHHHHHHHHHHHHCCCCCCCCEEEEECCCCC-H----HHHHHHHHHHHCCEECCCCCHHHHHH
T ss_conf             444326887771--1777777778887640666588864897237884-3----67799998765023010873787655


Q ss_pred             HH
Q ss_conf             99
Q gi|254780163|r  375 IV  376 (798)
Q Consensus       375 iL  376 (798)
T Consensus       307 MF  308 (439)
T KOG0739         307 MF  308 (439)
T ss_pred             HH
T ss_conf             50