HHsearch alignment for GI: 254780163 and conserved domain: KOG0740

>KOG0740 consensus.
Probab=99.18  E-value=3.8e-10  Score=92.08  Aligned_cols=160  Identities=27%  Similarity=0.345  Sum_probs=124.4

Q ss_pred             CEEEECCCCCHHHHHHHHHHHHHHCCCCCHHHHEEEEEEEEHHHHHCCCCCCCHHHHHHHHHHHHHCCCCCEEEEECCHH
Q ss_conf             74896676411668999999998548988345201445540467530634312378999999987203898399973616
Q gi|254780163|r  227 NPLYVGDPGVGKTAIAEGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIESYANAILYIDEIH  306 (798)
Q Consensus       227 n~~lvG~~gvGktaive~la~~i~~~~vp~~l~~~~i~~ld~~~l~ag~~~rg~fe~r~~~~~~~~~~~~~~ilfideih  306 (798)
T Consensus       188 glLLfGPpgtGKtmL~~aiAsE----------~~atff~iSassL--tsK~~Ge~eK~vralf~vAr~~qPsvifidEid  255 (428)
T KOG0740         188 GLLLFGPPGTGKTMLAKAIATE----------SGATFFNISASSL--TSKYVGESEKLVRALFKVARSLQPSVIFIDEID  255 (428)
T ss_pred             HHHEECCCCCCHHHHHHHHHHH----------HCCEEEECCHHHH--HHHCCCHHHHHHHHHHHHHHHCCCEEEEECHHH
T ss_conf             1120058988447999999862----------0665763068886--532467077899999999871397089840256


Q ss_pred             HHHCCCCCCCCCCCHH----------HHHHHHHCCCCEEEEEECCHHHHHHHHHCCHHHHHHCEE-EEECCCCHHHHHHH
Q ss_conf             6301554443447778----------888766302660388730489999985201114320014-43068786899999
Q gi|254780163|r  307 TLVGAGSASGISVDAS----------NLLKPALSSGAVRCIGSTTYSEYRQFFEKDKALVRRFQK-IDVSEPSIEDAIEI  375 (798)
Q Consensus       307 ~ligag~~~g~~~d~a----------n~lkP~L~rg~~~~IgatT~~ey~~~~e~d~al~rrF~~-i~v~ep~~~~~~~i  375 (798)
T Consensus       256 slls~R--s~~e~e~srr~ktefLiq~~~~~s~~~drvlvigaTN~-----P~e~Dea~~Rrf~kr~yiplPd~etr~~~  328 (428)
T KOG0740         256 SLLSKR--SDNEHESSRRLKTEFLLQFDGKNSAPDDRVLVIGATNR-----PWELDEAARRRFVKRLYIPLPDYETRSLL  328 (428)
T ss_pred             HHHHHC--CCCCCCCCHHHHHHHHHHHCCCCCCCCCEEEEEECCCC-----CHHHHHHHHHHHCCEEEECCCCHHHHHHH
T ss_conf             788636--87545445556557776540445788870799815888-----36778888887103155359887899999


Q ss_pred             HHHHHHHHHHHCCCEECCHHHHHHHHHHHHHCCC
Q ss_conf             9861276654103512111789999986542015
Q gi|254780163|r  376 VKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTS  409 (798)
Q Consensus       376 L~~~~~~ye~~h~v~~~~~al~~av~ls~ryi~~  409 (798)
T Consensus       329 ~~~ll~~~----~~~l~~~d~~~l~~~Tegysgs  358 (428)
T KOG0740         329 WKQLLKEQ----PNGLSDLDISLLAKVTEGYSGS  358 (428)
T ss_pred             HHHHHHHC----CCCCCHHHHHHHHHHHCCCCCC
T ss_conf             99999768----7874177899999886175622