HHsearch alignment for GI: 254780163 and conserved domain: KOG0743

>KOG0743 consensus.
Probab=98.07  E-value=7.3e-05  Score=54.12  Aligned_cols=219  Identities=19%  Similarity=0.246  Sum_probs=120.0

Q ss_pred             CCCCCCHHHHHCCHHHHHHHHCCHHHHHHHCHHHHHHHHHHH-HHHHHCCCCCCCCCCCEEEEECCCCHHHHHHHHHHHH
Q ss_conf             024531011100112334210000246653458999999999-8775204456578740688614320038899999873
Q gi|254780163|r  451 MNRSIHTTSFSRDDDSVLSNLEKNLGTVVYGQEEAIKKLSSS-IKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAF  529 (798)
Q Consensus       451 ~~~gip~~~~~~~~~~~l~~l~~~l~~~v~GQ~~ai~~v~~~-i~~~~~gl~~~~rP~g~flf~GptGvGKTelak~la~  529 (798)
T Consensus       188 ~W~~v~f~HpstF~T---laMd~~~K~~I~~Dl~---~F~k~k~~YkrvGka--wK--RGYLLYGPPGTGKSS~IaAmAn  257 (457)
T KOG0743         188 EWRSVGFPHPSTFET---LAMDPDLKERIIDDLD---DFIKGKDFYKRVGKA--WK--RGYLLYGPPGTGKSSFIAAMAN  257 (457)
T ss_pred             CCEECCCCCCCCCCC---CCCCHHHHHHHHHHHH---HHHHCCHHHHHCCCC--CC--CCCEEECCCCCCHHHHHHHHHH
T ss_conf             612568999987442---0148667899999999---997223578864845--00--0412047999988899999972


Q ss_pred             HCCCCEEEEEHHHHHCCCCCCHHCCCCCHHCCCCCCCCCCHHHHHCCCEEEEECCHHHCC----------HHH-------
Q ss_conf             047733772068861246530110478000256444310035551585177740445502----------899-------
Q gi|254780163|r  530 ALGVQLLRFDMSEYMERHAVSRLIGAPPGYVGFGQGGILADSVDQNPYSVVLLDEIEKSH----------PDV-------  592 (798)
Q Consensus       530 ~~~~~lir~dmsey~e~~~vs~LiGappGYvG~~egg~Lte~vr~~P~sVvl~DEiEKAh----------~~v-------  592 (798)
T Consensus       258 ~L~ydIydLeLt~v~~n~dLr~LL~------------------~t~~kSIivIEDIDcs~~l~~~~~~~~~~~~~~~~~V  319 (457)
T KOG0743         258 YLNYDIYDLELTEVKLDSDLRHLLL------------------ATPNKSILLIEDIDCSFDLRERRKKKKENFEGDLSRV  319 (457)
T ss_pred             HCCCCEEEEEECCCCCCHHHHHHHH------------------HCCCCCEEEEEECCCCCCCCCCCCCCCCCCCCCCCEE
T ss_conf             0587367744002368389999997------------------2899718999612432304434555664546776606


Q ss_pred             -HHHHHHHHHHHHCCCCCCCEECC-CCEEEEEECCCCHHHHHHCCCCCCCCCCHHHHHHHHHHHCCHHHH--CCCCEEEE
Q ss_conf             -99999987775021779977612-542999942421455330368988211148899999872887881--77682896
Q gi|254780163|r  593 -LNILLQIMDYGILTDQSGKKISF-RNVILIMTTNAGALEMSKARIGFGSSRNDDADKEALRNFLSPEFL--NRLDSIIP  668 (798)
Q Consensus       593 -~~~llqild~G~ltd~~Gr~vdf-~n~iii~TsN~G~~~~~~~~~g~~~~~~~~~~~~~l~~~f~pefl--nRid~ii~  668 (798)
T Consensus       320 TlSGLLNfiD--------GlwSscg~ERIivFTTNh-------------~------------EkLDPALlRpGRmDmhI~  366 (457)
T KOG0743         320 TLSGLLNFLD--------GLWSSCGDERIIVFTTNH-------------K------------EKLDPALLRPGRMDMHIY  366 (457)
T ss_pred             EHHHHHHHHC--------CCCCCCCCCEEEEEECCC-------------H------------HHCCHHHCCCCCCEEEEE
T ss_conf             6477566413--------430048873499994687-------------1------------006886628875225667


Q ss_pred             CCCCCHHHHHHHHHHHHHH-----HHHHHHHCCCEEEECHH-HHHHHHHCCCCCCCCCHHHHHHHHHH
Q ss_conf             2889999999999999999-----99999866988999889-99999971898101532679999986
Q gi|254780163|r  669 FFPLSSDIIRQVVHKFIMK-----LELQLQEKGISFHFSEE-VINWLVSHGYDVKMGARPLERIIKEH  730 (798)
Q Consensus       669 F~~l~~~~~~~i~~~~l~~-----l~~~l~~~~i~l~~~~~-~~~~l~~~~~~~~~GAR~l~r~i~~~  730 (798)
T Consensus       367 mgyCtf~~fK~La~nYL~~~~~h~L~~eie~l~~~~~~tPA~V~e~lm~~~~dad~~lk~Lv~~l~~~  434 (457)
T KOG0743         367 MGYCTFEAFKTLASNYLGIEEDHRLFDEIERLIEETEVTPAQVAEELMKNKNDADVALKGLVEALESK  434 (457)
T ss_pred             CCCCCHHHHHHHHHHHCCCCCCCHHHHHHHHHHHCCCCCHHHHHHHHHHCCCCHHHHHHHHHHHHHHH
T ss_conf             26698799999999833898873067999987633746899999998635653889999999998763