HHsearch alignment for GI: 254780163 and conserved domain: KOG0991

>KOG0991 consensus.
Probab=97.86  E-value=0.00048  Score=48.19  Aligned_cols=180  Identities=21%  Similarity=0.343  Sum_probs=106.4

Q ss_pred             HHHHHHCCCCHHHHHHHHHHHHHHHHHHCCCCCCEEEECCCCCHHHHHHHHHHHHHHCCCCCHHHHEEEEEEEEHHHHHC
Q ss_conf             58877548611222178999999998622677874896676411668999999998548988345201445540467530
Q gi|254780163|r  194 LTEKVKKGKVDILVGRHEEINRTIQILCRRSKNNPLYVGDPGVGKTAIAEGFAKQIVDGMVPDILLGARIFSLDMGNLIA  273 (798)
Q Consensus       194 LTe~AreGKLDPVIGRd~EI~riiqIL~RR~KNn~~lvG~~gvGktaive~la~~i~~~~vp~~l~~~~i~~ld~~~l~a  273 (798)
T Consensus        17 wVeKYrP~~l~dIVGNe~tv~rl~via~~gnmP~liisGpPG~GKTTsi~~LAr~LLG~~~ke-----~vLELNAS----   87 (333)
T KOG0991          17 WVEKYRPSVLQDIVGNEDTVERLSVIAKEGNMPNLIISGPPGTGKTTSILCLARELLGDSYKE-----AVLELNAS----   87 (333)
T ss_pred             HHHHHCCHHHHHHHCCHHHHHHHHHHHHCCCCCCEEEECCCCCCHHHHHHHHHHHHHCHHHHH-----HHHHCCCC----
T ss_conf             788608529988217798999999999728998667527999861648999999983806665-----76320576----


Q ss_pred             CCCCCCH--HHHHHHHHHHH-HCC-CC-CEEEEECCHHHHHCCCCCCCCCCCHHHHHHHHH--CCCCEEEEEECCHHHHH
Q ss_conf             6343123--78999999987-203-89-839997361663015544434477788887663--02660388730489999
Q gi|254780163|r  274 GTRYRGD--FEERIKKIVKE-IES-YA-NAILYIDEIHTLVGAGSASGISVDASNLLKPAL--SSGAVRCIGSTTYSEYR  346 (798)
Q Consensus       274 g~~~rg~--fe~r~~~~~~~-~~~-~~-~~ilfideih~ligag~~~g~~~d~an~lkP~L--~rg~~~~IgatT~~ey~  346 (798)
T Consensus        88 --deRGIDvVRn~IK~FAQ~kv~lp~grhKIiILDEADSMT-~g--------AQQAlRRtMEiyS~ttRFalaCN~s~--  154 (333)
T KOG0991          88 --DERGIDVVRNKIKMFAQKKVTLPPGRHKIIILDEADSMT-AG--------AQQALRRTMEIYSNTTRFALACNQSE--  154 (333)
T ss_pred             --CCCCCHHHHHHHHHHHHHHCCCCCCCEEEEEEECCCHHH-HH--------HHHHHHHHHHHHCCCCHHHHHHCCHH--
T ss_conf             --554608999999999872034899852489961522020-68--------99999999999706320000015421--


Q ss_pred             HHHHCCH---HHHHHCEEEEECCCCHHHHHHHHHHHHHHHHHHCCCEECCHHHHHHHHHHHH
Q ss_conf             9852011---1432001443068786899999986127665410351211178999998654
Q gi|254780163|r  347 QFFEKDK---ALVRRFQKIDVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVR  405 (798)
Q Consensus       347 ~~~e~d~---al~rrF~~i~v~ep~~~~~~~iL~~~~~~ye~~h~v~~~~~al~~av~ls~r  405 (798)
T Consensus       155 KIiEPIQSRCAiL-Rysk-----lsd~qi---L~Rl~~v-~k~Ekv~yt~dgLeaiifta~G  206 (333)
T KOG0991         155 KIIEPIQSRCAIL-RYSK-----LSDQQI---LKRLLEV-AKAEKVNYTDDGLEAIIFTAQG  206 (333)
T ss_pred             HHHHHHHHHHHHH-HHCC-----CCHHHH---HHHHHHH-HHHHCCCCCCCHHHHHHHHCCC
T ss_conf             3222677345765-3222-----678999---9999999-9870788771147785544166