HHsearch alignment for GI: 254780163 and conserved domain: KOG2227

>KOG2227 consensus.
Probab=96.92  E-value=0.007  Score=39.87  Aligned_cols=196  Identities=20%  Similarity=0.261  Sum_probs=103.9

Q ss_pred             HHHHHHHHHHHHHHHH----HHCCCCCCEEEECCCCCHHHHHHHHHHHHHHCCCCCHHHHEEEEEEEEHHHH-HCCCCCC
Q ss_conf             1222178999999998----6226778748966764116689999999985489883452014455404675-3063431
Q gi|254780163|r  204 DILVGRHEEINRTIQI----LCRRSKNNPLYVGDPGVGKTAIAEGFAKQIVDGMVPDILLGARIFSLDMGNL-IAGTRYR  278 (798)
Q Consensus       204 DPVIGRd~EI~riiqI----L~RR~KNn~~lvG~~gvGktaive~la~~i~~~~vp~~l~~~~i~~ld~~~l-~ag~~~r  278 (798)
T Consensus       150 ~~l~gRe~e~~~v~~F~~~hle~~t~gSlYVsG~PGtgkt~~l~rvl~~~~~-----~~~~~~~v~inc~sl~~~~aiF~  224 (529)
T KOG2227         150 GTLKGRELEMDIVREFFSLHLELNTSGSLYVSGQPGTGKTALLSRVLDSLSK-----SSKSPVTVYINCTSLTEASAIFK  224 (529)
T ss_pred             CCCCCHHHHHHHHHHHHHHHHHCCCCCCEEEECCCCCCHHHHHHHHHHHHHH-----HCCCCEEEEEEECCCCCHHHHHH
T ss_conf             7765258889999999985431266764575179986548899999874034-----31665169985123542588999


Q ss_pred             CHHHH-------------HHHHHHHHHCCCC-CEEEEECCHHHHHCCCCCCCCCCCHHHHHHHHHCCCCEEEEE-ECCHH
Q ss_conf             23789-------------9999998720389-839997361663015544434477788887663026603887-30489
Q gi|254780163|r  279 GDFEE-------------RIKKIVKEIESYA-NAILYIDEIHTLVGAGSASGISVDASNLLKPALSSGAVRCIG-STTYS  343 (798)
Q Consensus       279 g~fe~-------------r~~~~~~~~~~~~-~~ilfideih~ligag~~~g~~~d~an~lkP~L~rg~~~~Ig-atT~~  343 (798)
T Consensus       225 kI~~~~~q~~~s~~~~~~~~~~~~~h~~q~k~~~llVlDEmD~L~---tr~~~vLy~-lFewp~lp~sr~iLiGiANslD  300 (529)
T KOG2227         225 KIFSSLLQDLVSPGTGMQHLEKFEKHTKQSKFMLLLVLDEMDHLI---TRSQTVLYT-LFEWPKLPNSRIILIGIANSLD  300 (529)
T ss_pred             HHHHHHHHHHCCCCHHHHHHHHHHHHHHCCCCEEEEEECHHHHHH---HCCCCEEEE-EHHCCCCCCCEEEEEEEHHHHH
T ss_conf             998889887428950478999999987525633898721256776---046531432-1001367766056664001355


Q ss_pred             HHHHHHHCCHHHHHH-------CEEEEECCCCHHHHHHHHHHHHHHHHHHCCCEECCHHHHHHHHHHHHHCCCC-CCHHH
Q ss_conf             999985201114320-------0144306878689999998612766541035121117899999865420155-56467
Q gi|254780163|r  344 EYRQFFEKDKALVRR-------FQKIDVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSR-KLPDK  415 (798)
Q Consensus       344 ey~~~~e~d~al~rr-------F~~i~v~ep~~~~~~~iL~~~~~~ye~~h~v~~~~~al~~av~ls~ryi~~r-~lPdk  415 (798)
T Consensus       301 l------TdR~LprL~~~~~~~P~~l~F~PYTk~qI~~Il~~rl~---~~~----t~~~~~~Aie~~ArKvaa~SGDlRk  367 (529)
T KOG2227         301 L------TDRFLPRLNLDLTIKPKLLVFPPYTKDQIVEILQQRLS---EES----TSIFLNAAIELCARKVAAPSGDLRK  367 (529)
T ss_pred             H------HHHHHHHHHHCCCCCCCEEEECCCCHHHHHHHHHHHHH---CCC----CCCCCHHHHHHHHHHHCCCCHHHHH
T ss_conf             7------77776665402578874665568788999999999974---054----4333038999999986257612899


Q ss_pred             HHHHHH
Q ss_conf             988998
Q gi|254780163|r  416 AIDVID  421 (798)
Q Consensus       416 AidllD  421 (798)
T Consensus       368 aLdv~R  373 (529)
T KOG2227         368 ALDVCR  373 (529)
T ss_pred             HHHHHH
T ss_conf             999998