HHsearch alignment for GI: 254780163 and conserved domain: PRK00091

>PRK00091 miaA tRNA delta(2)-isopentenylpyrophosphate transferase; Reviewed.
Probab=96.30  E-value=0.0044  Score=41.30  Aligned_cols=39  Identities=31%  Similarity=0.385  Sum_probs=28.6

Q ss_pred             CCCEEEECCCCCHHHHHHHHHHHHHHCCCCCHHHHEEEEEEEEHHHHHC
Q ss_conf             7874896676411668999999998548988345201445540467530
Q gi|254780163|r  225 KNNPLYVGDPGVGKTAIAEGFAKQIVDGMVPDILLGARIFSLDMGNLIA  273 (798)
Q Consensus       225 KNn~~lvG~~gvGktaive~la~~i~~~~vp~~l~~~~i~~ld~~~l~a  273 (798)
T Consensus         4 ~~ii~i~GpTasGKs~la~~la~~~----------~~eIIsaDS~QvYk   42 (304)
T PRK00091          4 PKLIVLVGPTASGKTALAIELAKRL----------NGEIISVDSMQVYR   42 (304)
T ss_pred             CCEEEEECCCCCCHHHHHHHHHHHC----------CCEEEEECHHHHHC
T ss_conf             9779998988658999999999987----------99899412688749