HHsearch alignment for GI: 254780163 and conserved domain: PRK00149

>PRK00149 dnaA chromosomal replication initiation protein; Reviewed.
Probab=98.81  E-value=2.9e-07  Score=71.38  Aligned_cols=155  Identities=19%  Similarity=0.343  Sum_probs=102.4

Q ss_pred             CCEEEE-CCCCCHHHHHHHHHHHHHHCCCCCHHHHEEEEEEEEHHHHHC----CCCCCCHHHHHHHHHHHHHCCCCCEEE
Q ss_conf             874896-676411668999999998548988345201445540467530----634312378999999987203898399
Q gi|254780163|r  226 NNPLYV-GDPGVGKTAIAEGFAKQIVDGMVPDILLGARIFSLDMGNLIA----GTRYRGDFEERIKKIVKEIESYANAIL  300 (798)
Q Consensus       226 Nn~~lv-G~~gvGktaive~la~~i~~~~vp~~l~~~~i~~ld~~~l~a----g~~~rg~fe~r~~~~~~~~~~~~~~il  300 (798)
T Consensus       145 yNPLfIyG~~GlGKTHLl~AIgn~~~~~~-p----~~~v~Y~tae~F~~~~v~al~~-~~~----~~Fr~~yr-~~-DvL  212 (447)
T PRK00149        145 YNPLFIYGGVGLGKTHLLHAIGNYILEKN-P----NAKVVYVSSEKFTNDFVKALRN-NAM----EEFKEKYR-SV-DVL  212 (447)
T ss_pred             CCCEEEECCCCCCHHHHHHHHHHHHHHHC-C----CCEEEEEEHHHHHHHHHHHHHC-CCH----HHHHHHHH-CC-CEE
T ss_conf             78558977998878899999999999858-9----9728995499999999999851-869----99999997-28-854


Q ss_pred             EECCHHHHHCCCCCCCCCCCHHHHHHHHHCCCCEEEEEE-CCHHHHHHHHHCCHHHHHHCEE---EEECCCCHHHHHHHH
Q ss_conf             973616630155444344777888876630266038873-0489999985201114320014---430687868999999
Q gi|254780163|r  301 YIDEIHTLVGAGSASGISVDASNLLKPALSSGAVRCIGS-TTYSEYRQFFEKDKALVRRFQK---IDVSEPSIEDAIEIV  376 (798)
Q Consensus       301 fideih~ligag~~~g~~~d~an~lkP~L~rg~~~~Iga-tT~~ey~~~~e~d~al~rrF~~---i~v~ep~~~~~~~iL  376 (798)
T Consensus       213 liDDiqfl~gk~~tqe---eff~~fn~l~~~~kqiv~tsd~~P~~l~~---l~~rL~SRf~~Gl~~~i~~Pd~e~r~~Il  286 (447)
T PRK00149        213 LIDDIQFLAGKEKTQE---EFFHTFNALHENNKQIVITSDRPPKELEG---LEDRLRSRFEWGLTVDIEPPDLETRVAIL  286 (447)
T ss_pred             EECHHHHHHCCHHHHH---HHHHHHHHHHHCCCEEEEECCCCHHHCCC---CCHHHHHHHHCCEEEECCCCCHHHHHHHH
T ss_conf             3214888605577999---99999999998499689957889676565---11778867637626510599999999999


Q ss_pred             HHHHHHHHHHCCCEECCHHHHHHHHH
Q ss_conf             86127665410351211178999998
Q gi|254780163|r  377 KGIKPYFEEHHQLRYSKEAIRAAVQL  402 (798)
Q Consensus       377 ~~~~~~ye~~h~v~~~~~al~~av~l  402 (798)
T Consensus       287 ~~k~~----~~~~~l~~~v~~~iA~~  308 (447)
T PRK00149        287 QKKAE----EEGINLPNEVLEFIAKR  308 (447)
T ss_pred             HHHHH----HCCCCCCHHHHHHHHHH
T ss_conf             99999----72899998999999971