HHsearch alignment for GI: 254780163 and conserved domain: PRK03992

>PRK03992 proteasome-activating nucleotidase; Provisional.
Probab=99.51  E-value=7.3e-13  Score=111.59  Aligned_cols=197  Identities=23%  Similarity=0.367  Sum_probs=125.7

Q ss_pred             HHCHHHHHHHHHHHHHH--------HHCCCCCCCCCCCEEEEECCCCHHHHHHHHHHHHHCCCCEEEEEHHHHHCCCCCC
Q ss_conf             53458999999999877--------5204456578740688614320038899999873047733772068861246530
Q gi|254780163|r  479 VYGQEEAIKKLSSSIKI--------ARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFALGVQLLRFDMSEYMERHAVS  550 (798)
Q Consensus       479 v~GQ~~ai~~v~~~i~~--------~~~gl~~~~rP~g~flf~GptGvGKTelak~la~~~~~~lir~dmsey~e~~~vs  550 (798)
T Consensus       134 IGGl~~~k~el~E~velPl~~pe~f~~~Gi~pP---kG-vLLyGPPGtGKTllAkAvA~e~~~~fi~v~~s~l~sk----  205 (390)
T PRK03992        134 IGGLDEQIREVREAVELPLKNPELFEEVGIEPP---KG-VLLYGPPGTGKTLLAKAVAHETNATFIRVVGSELVQK----  205 (390)
T ss_pred             HCCHHHHHHHHHHHHHHHHHCHHHHHHCCCCCC---CE-EEEECCCCCCHHHHHHHHHHHHCCCEEEEEHHHHHHC----
T ss_conf             149899999999999998659899997699999---72-7868989997899999999874888799667997524----


Q ss_pred             HHCCCCCHHCCCCCC--CCCCHHHHHCCCEEEEECCHHH-----------CCHHHHHHHHHHHHHHHCCCCCCCEECCCC
Q ss_conf             110478000256444--3100355515851777404455-----------028999999998777502177997761254
Q gi|254780163|r  551 RLIGAPPGYVGFGQG--GILADSVDQNPYSVVLLDEIEK-----------SHPDVLNILLQIMDYGILTDQSGKKISFRN  617 (798)
Q Consensus       551 ~LiGappGYvG~~eg--g~Lte~vr~~P~sVvl~DEiEK-----------Ah~~v~~~llqild~G~ltd~~Gr~vdf~n  617 (798)
T Consensus       206 --------~vGesek~vr~lF~~Ar~~aP~IiFiDEiDai~~~R~~~~~~g~~ev~r~l~qLL~e---mDG~~---~~~~  271 (390)
T PRK03992        206 --------FIGEGARLVRELFELAREKAPSIIFIDEIDAIAAKRTDSGTSGDREVQRTLMQLLAE---MDGFD---PRGN  271 (390)
T ss_pred             --------CCCHHHHHHHHHHHHHHHHCCCEEEHHHHHHHHCCCCCCCCCCCHHHHHHHHHHHHH---CCCCC---CCCC
T ss_conf             --------541799999999999997099089714325663356778886208899999999997---44877---7788


Q ss_pred             EEEEEECCCCHHHHHHCCCCCCCCCCHHHHHHHHHHHCCHHHH--CCCCEEEECCCCCHHHHHHHHHHHHHHHHHHHHHC
Q ss_conf             2999942421455330368988211148899999872887881--77682896288999999999999999999999866
Q gi|254780163|r  618 VILIMTTNAGALEMSKARIGFGSSRNDDADKEALRNFLSPEFL--NRLDSIIPFFPLSSDIIRQVVHKFIMKLELQLQEK  695 (798)
Q Consensus       618 ~iii~TsN~G~~~~~~~~~g~~~~~~~~~~~~~l~~~f~pefl--nRid~ii~F~~l~~~~~~~i~~~~l~~l~~~l~~~  695 (798)
T Consensus       272 V~VIaATNrp-------------------------d~LDpAllRpGRFDr~I~iplPd~~~R~~Ilki~~~~~~------  320 (390)
T PRK03992        272 VKIIAATNRP-------------------------DILDPALLRPGRFDRIIEVPLPDEEGRLEILKIHTRKMN------  320 (390)
T ss_pred             EEEEEECCCC-------------------------HHCCHHHHCCCCCCEEEEECCCCHHHHHHHHHHHHCCCC------
T ss_conf             2799606981-------------------------005977754776523887089499999999999847999------


Q ss_pred             CCEEEECHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHHH
Q ss_conf             988999889999999718981015326799999862359
Q gi|254780163|r  696 GISFHFSEEVINWLVSHGYDVKMGARPLERIIKEHVKVP  734 (798)
Q Consensus       696 ~i~l~~~~~~~~~l~~~~~~~~~GAR~l~r~i~~~i~~~  734 (798)
T Consensus       321 -l~~dvd---l~~lA~~T--~G~SGADI~~lc~EA~m~A  353 (390)
T PRK03992        321 -LADDVD---LEELAELT--EGASGADLKAICTEAGMFA  353 (390)
T ss_pred             -CCCCCC---HHHHHHHC--CCCCHHHHHHHHHHHHHHH
T ss_conf             -998889---99999768--7998999999999999999