HHsearch alignment for GI: 254780163 and conserved domain: PRK04195

>PRK04195 replication factor C large subunit; Provisional.
Probab=99.34  E-value=1.7e-11  Score=101.71  Aligned_cols=180  Identities=20%  Similarity=0.329  Sum_probs=117.5

Q ss_pred             HHHHHCCCCHHHHHHHHHHHHHHHHHHC----C-CCCCEEEECCCCCHHHHHHHHHHHHHHCCCCCHHHHEEEEEEEEHH
Q ss_conf             8877548611222178999999998622----6-7787489667641166899999999854898834520144554046
Q gi|254780163|r  195 TEKVKKGKVDILVGRHEEINRTIQILCR----R-SKNNPLYVGDPGVGKTAIAEGFAKQIVDGMVPDILLGARIFSLDMG  269 (798)
Q Consensus       195 Te~AreGKLDPVIGRd~EI~riiqIL~R----R-~KNn~~lvG~~gvGktaive~la~~i~~~~vp~~l~~~~i~~ld~~  269 (798)
T Consensus         5 veKYRPk~~~divg~~~~v~~l~~Wl~~w~~g~~~~k~lLL~GPpGvGKTT~a~~lAk~~----------g~~viElNAS   74 (403)
T PRK04195          5 VEKYRPKSLSDVVGNEKAKKQLREWIESWLKGKPPKKALLLYGPPGVGKTSLAHALANDY----------GWEVIELNAS   74 (403)
T ss_pred             CCCCCCCCHHHHHCCHHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCHHHHHHHHHHHH----------CCCEEEECCC
T ss_conf             402189989998588999999999999987399657469988939987999999999984----------9985997710


Q ss_pred             HHHCCCCCCCHHHHHHHHHHHHHCC------CCCEEEEECCHHHHHCCCCCCCCCCCHHHHHHHHHCCCCEEEEEECCHH
Q ss_conf             7530634312378999999987203------8983999736166301554443447778888766302660388730489
Q gi|254780163|r  270 NLIAGTRYRGDFEERIKKIVKEIES------YANAILYIDEIHTLVGAGSASGISVDASNLLKPALSSGAVRCIGSTTYS  343 (798)
Q Consensus       270 ~l~ag~~~rg~fe~r~~~~~~~~~~------~~~~ilfideih~ligag~~~g~~~d~an~lkP~L~rg~~~~IgatT~~  343 (798)
T Consensus        75 D----~R~~----~~I~~~i~~~~~~~sl~~~~~KlIIlDEvD~l~~~~d~gg-~~al~~~ik----~s~~PiIli~N-d  140 (403)
T PRK04195         75 D----QRTK----DVIERVAGEASTSGSLFGAKRKLILLDEVDGIHGNADRGG-VRAILEIIK----KAKNPIILTAN-D  140 (403)
T ss_pred             C----CCCH----HHHHHHHHHHHHCCCCCCCCCEEEEEECCCCCCCHHHHHH-HHHHHHHHH----CCCCEEEEEEC-C
T ss_conf             1----1478----9999999987606887788734999634344572444799-999999985----48870899826-8


Q ss_pred             HHHHHHHCCHHHHHHCEEEEECCCCHHHHHHHHHHHHHHHHHHCCCEECCHHHHHHHHHHHH
Q ss_conf             99998520111432001443068786899999986127665410351211178999998654
Q gi|254780163|r  344 EYRQFFEKDKALVRRFQKIDVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVR  405 (798)
Q Consensus       344 ey~~~~e~d~al~rrF~~i~v~ep~~~~~~~iL~~~~~~ye~~h~v~~~~~al~~av~ls~r  405 (798)
T Consensus       141 ~~~~~~---~~lrs~c~~i~F~~~~~~~I~~~L~~I~~----~Egi~i~~~aL~~Ia~~s~G  195 (403)
T PRK04195        141 PYDPSL---RPLRNACLMIEFKRLSKRSIVPVLKRICR----KEGIECEEEALREIAERSGG  195 (403)
T ss_pred             CCCCCH---HHHHHHHHHCCCCCCCHHHHHHHHHHHHH----HCCCCCCHHHHHHHHHHCCC
T ss_conf             455671---77997661221799499999999999999----76999999999999998797