HHsearch alignment for GI: 254780163 and conserved domain: PRK05703

>PRK05703 flhF flagellar biosynthesis regulator FlhF; Validated.
Probab=97.52  E-value=0.00023  Score=50.57  Aligned_cols=89  Identities=27%  Similarity=0.411  Sum_probs=51.7

Q ss_pred             CCCCCCEEEEECCCCHHHHHHHHHHH--H----HC-CCCEEEEEHH---HHHCCCCCCHHCCCCCHHCCCCCCCCCCHHH
Q ss_conf             57874068861432003889999987--3----04-7733772068---8612465301104780002564443100355
Q gi|254780163|r  503 PNKPIGCYVFSGPTGVGKTEISKQLA--F----AL-GVQLLRFDMS---EYMERHAVSRLIGAPPGYVGFGQGGILADSV  572 (798)
Q Consensus       503 ~~rP~g~flf~GptGvGKTelak~la--~----~~-~~~lir~dms---ey~e~~~vs~LiGappGYvG~~egg~Lte~v  572 (798)
T Consensus       206 ~~~~~~vvalVGPTGVGKTTTiAKLAA~~~l~~~~~kV~lIT~DtyRigA~eQLk~Ya~ilgvp-~~v~~~-~~~l~~al  283 (412)
T PRK05703        206 ILEQGGVVALVGPTGVGKTTTLAKLAARYALEEGKDKVALITLDTYRIGAVEQLKTYAKIMGIP-VKVAYD-PKELAKAL  283 (412)
T ss_pred             CCCCCCEEEEECCCCCCHHHHHHHHHHHHHHHCCCCEEEEEEECCCCHHHHHHHHHHHHHCCCE-EEEECC-HHHHHHHH
T ss_conf             5456736999888887567699999999999729981799983767777999999999971973-798479-99999999


Q ss_pred             HH-CCCEEEEECCHHHCCHHHH
Q ss_conf             51-5851777404455028999
Q gi|254780163|r  573 DQ-NPYSVVLLDEIEKSHPDVL  593 (798)
Q Consensus       573 r~-~P~sVvl~DEiEKAh~~v~  593 (798)
T Consensus       284 ~~~~~~dlILIDTaG~s~~d~~  305 (412)
T PRK05703        284 EQLANCDLILIDTAGRSQRDPR  305 (412)
T ss_pred             HHHCCCCEEEEECCCCCCCCHH
T ss_conf             8715899799968988978999