HHsearch alignment for GI: 254780163 and conserved domain: PRK05707

>PRK05707 DNA polymerase III subunit delta'; Validated.
Probab=96.99  E-value=0.032  Score=35.07  Aligned_cols=111  Identities=22%  Similarity=0.292  Sum_probs=67.4

Q ss_pred             CCCCCEEEEECCCCHHHHHHHHHHHHHC-CCCEEEEEHHHHHCCCCCCHHC--CCCCH-----------HCCCCCCCCCC
Q ss_conf             7874068861432003889999987304-7733772068861246530110--47800-----------02564443100
Q gi|254780163|r  504 NKPIGCYVFSGPTGVGKTEISKQLAFAL-GVQLLRFDMSEYMERHAVSRLI--GAPPG-----------YVGFGQGGILA  569 (798)
Q Consensus       504 ~rP~g~flf~GptGvGKTelak~la~~~-~~~lir~dmsey~e~~~vs~Li--GappG-----------YvG~~egg~Lt  569 (798)
T Consensus        19 ~rl~HA~Lf~G~~G~GK~~lA~~~A~~LlC~~~~~~---~~Cg~C~sC~~~~~~~HPD~~~i~pe~~~~~I~IdqIR~l~   95 (328)
T PRK05707         19 GRHAHAYLLHGPAGIGKRALAERLAAFLLCEAPQGG---GACGSCKGCQLLAAGSHPDNFVLEPEEADKPIKVDQVRELV   95 (328)
T ss_pred             CCCCEEEEEECCCCCCHHHHHHHHHHHHHCCCCCCC---CCCCCCHHHHHHHCCCCCCEEEEECCCCCCCCCHHHHHHHH
T ss_conf             982204644799986799999999999848999998---99988889999875899987998426667769799999999


Q ss_pred             HHHHHCC----CEEEEECCHHHCCHHHHHHHHHHHHHHHCCCCCCCEECCCCEEEEEECCCCH
Q ss_conf             3555158----5177740445502899999999877750217799776125429999424214
Q gi|254780163|r  570 DSVDQNP----YSVVLLDEIEKSHPDVLNILLQIMDYGILTDQSGKKISFRNVILIMTTNAGA  628 (798)
Q Consensus       570 e~vr~~P----~sVvl~DEiEKAh~~v~~~llqild~G~ltd~~Gr~vdf~n~iii~TsN~G~  628 (798)
T Consensus        96 ~~~~~~~~~g~~KV~iI~~Ae~m~~~AaNALLKtLEEP-----------p~~t~fiL~t~~~~  147 (328)
T PRK05707         96 SFVVQTAQLGGRKVVLIEPAEAMNRNAANALLKSLEEP-----------SGQTVLLLISHQPS  147 (328)
T ss_pred             HHHHHCCCCCCCEEEEEEHHHHHCHHHHHHHHHHHHCC-----------CCCEEEEEEECCHH
T ss_conf             99831766789579995028773899999999985078-----------98759998609934