HHsearch alignment for GI: 254780163 and conserved domain: PRK06090

>PRK06090 DNA polymerase III subunit delta'; Validated.
Probab=97.21  E-value=0.0016  Score=44.52  Aligned_cols=183  Identities=19%  Similarity=0.273  Sum_probs=103.3

Q ss_pred             CCCHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHCCCCCCEEEECCCCCHHHHHHHHHHHHHHCCCCCHHHHEEEE
Q ss_conf             53035654425887754861122217899999999862267787489667641166899999999854898834520144
Q gi|254780163|r  184 FPALSAYCVDLTEKVKKGKVDILVGRHEEINRTIQILCRRSKNNPLYVGDPGVGKTAIAEGFAKQIVDGMVPDILLGARI  263 (798)
Q Consensus       184 ~~~LdkFg~DLTe~AreGKLDPVIGRd~EI~riiqIL~RR~KNn~~lvG~~gvGktaive~la~~i~~~~vp~~l~~~~i  263 (798)
T Consensus         5 YPWl~~~~~~l~~~~~~~rl~---------------------HA~L~~g~~G~Gk~~la~~la~~LlC~~~~~~~Cg---   60 (319)
T PRK06090          5 YPWLVPVWQNWKSGLDAERIP---------------------GALLLQSDEGLGVESLVELFSHALLCQNYQSEACG---   60 (319)
T ss_pred             CCCCHHHHHHHHHHHHCCCCC---------------------CEEEEECCCCCCHHHHHHHHHHHHHCCCCCCCCCC---
T ss_conf             988379999999999869963---------------------06766799985799999999999808999999887---


Q ss_pred             EEEEHHHHHCCCC---------CCCH--HHHHHHHHHHHHC----CCCCEEEEECCHHHHHCCCCCCCCCCCHHHHHHHH
Q ss_conf             5540467530634---------3123--7899999998720----38983999736166301554443447778888766
Q gi|254780163|r  264 FSLDMGNLIAGTR---------YRGD--FEERIKKIVKEIE----SYANAILYIDEIHTLVGAGSASGISVDASNLLKPA  328 (798)
Q Consensus       264 ~~ld~~~l~ag~~---------~rg~--fe~r~~~~~~~~~----~~~~~ilfideih~ligag~~~g~~~d~an~lkP~  328 (798)
T Consensus        61 ~C~sC~l~~~g~HPD~~~i~pe~~~k~I~vd~IR~l~~~~~~~~~~g~~KV~iI~~ae~m---------~~~AaNALLKt  131 (319)
T PRK06090         61 FCHSCELMKSGNHPDLHVIKPEKEGKSITVEQIRQCNRLAQESSQLGGYRLFVIEPADAM---------NESASNALLKT  131 (319)
T ss_pred             CCHHHHHHHCCCCCCCEEEECCCCCCCCCHHHHHHHHHHHHHCCCCCCCEEEEECCHHHC---------CHHHHHHHHHH
T ss_conf             787799987589998236612335676879999999999754521069369998144434---------99999999998


Q ss_pred             HC--CCCEEEEEECCHHHHHHHHHCCHHHHHHCEEEEECCCCHHHHHHHHHHHHHHHHHHCCCEECCHHHHHHHHHHHHH
Q ss_conf             30--2660388730489999985201114320014430687868999999861276654103512111789999986542
Q gi|254780163|r  329 LS--SGAVRCIGSTTYSEYRQFFEKDKALVRRFQKIDVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRH  406 (798)
Q Consensus       329 L~--rg~~~~IgatT~~ey~~~~e~d~al~rrF~~i~v~ep~~~~~~~iL~~~~~~ye~~h~v~~~~~al~~av~ls~ry  406 (798)
T Consensus       132 LEEPp~~t~fiL~t~~~~--~l---l~TI~SRCq~~~l~~p~~~~~~~WL~~--------q~~~~~----~~aL~l~---  191 (319)
T PRK06090        132 LEEPAPNCLFLLVTHNQK--RL---LPTIVSRCQQWVVTPPSTDQAMQWLKG--------QGISVP----AYALKLN---  191 (319)
T ss_pred             HCCCCCCEEEEEEECCHH--HC---CCCHHHCCCCCCCCCCCHHHHHHHHHH--------HCCCCH----HHHHHHC---
T ss_conf             428998838998768512--08---641876144502899599999999988--------487557----9999884---


Q ss_pred             CCCCCCHHHHHHHHHH
Q ss_conf             0155564679889986
Q gi|254780163|r  407 FTSRKLPDKAIDVIDE  422 (798)
Q Consensus       407 i~~r~lPdkAidllDe  422 (798)
T Consensus       192 -~g--~Pl~a~~~l~~  204 (319)
T PRK06090        192 -MG--SPLKTLAMMKE  204 (319)
T ss_pred             -CC--CCHHHHHHHCC
T ss_conf             -99--94999998638