HHsearch alignment for GI: 254780163 and conserved domain: PRK06964

>PRK06964 DNA polymerase III subunit delta'; Validated.
Probab=97.94  E-value=0.00019  Score=51.10  Aligned_cols=140  Identities=17%  Similarity=0.178  Sum_probs=76.0

Q ss_pred             CCCEEEECCCCCHHHHHHHHHHHHHHCCC-CCHH-----------H-H--EEEEEEEEHHHHHCCCCCCCHH--------
Q ss_conf             78748966764116689999999985489-8834-----------5-2--0144554046753063431237--------
Q gi|254780163|r  225 KNNPLYVGDPGVGKTAIAEGFAKQIVDGM-VPDI-----------L-L--GARIFSLDMGNLIAGTRYRGDF--------  281 (798)
Q Consensus       225 KNn~~lvG~~gvGktaive~la~~i~~~~-vp~~-----------l-~--~~~i~~ld~~~l~ag~~~rg~f--------  281 (798)
T Consensus        21 ~HA~Lf~Gp~G~Gk~~lA~~~A~~llC~~~~~~~~~Cg~C~sC~~~~~~~HPD~~~i~Pe~~~~~~~~~~~~~~~~~~~~  100 (342)
T PRK06964         21 PHALLLHGQAGIGKLAFAQHLAQGLLCETPQPNGEPCGTCAACTWFAQGNHPDYRIVRPEALAAEAPGAADDAKAADADE  100 (342)
T ss_pred             HEEEEEECCCCCCHHHHHHHHHHHHHCCCCCCCCCCCCCCHHHHHHHCCCCCCEEEECCCHHCCCCCCCCCHHHHHHHHH
T ss_conf             30576579998679999999999983899998889786777788886279997455340021022333210010111222


Q ss_pred             -------------HHHHHHHHHHHCC----CCCEEEEECCHHHHHCCCCCCCCCCCHHHHHHHHHCC--CCEEEEEECCH
Q ss_conf             -------------8999999987203----8983999736166301554443447778888766302--66038873048
Q gi|254780163|r  282 -------------EERIKKIVKEIES----YANAILYIDEIHTLVGAGSASGISVDASNLLKPALSS--GAVRCIGSTTY  342 (798)
Q Consensus       282 -------------e~r~~~~~~~~~~----~~~~ilfideih~ligag~~~g~~~d~an~lkP~L~r--g~~~~IgatT~  342 (798)
T Consensus       101 ~~~~~~~~~~~I~idqiR~l~~~l~~~~~~g~~kVviI~~Ae~m---------n~~aaNalLK~LEEPp~~~~~iL~~~~  171 (342)
T PRK06964        101 GGKKTRAPSKEIKIEQVRALLDFCGVGSHRGGARVVVLYPAEAL---------NVAAANALLKTLEEPPPGVVFLLVSAR  171 (342)
T ss_pred             HCCCCCCCCCCCCHHHHHHHHHHHHHCCCCCCCEEEEECCHHHH---------CHHHHHHHHHHHCCCCCCEEEEEEECC
T ss_conf             10123565564549999999999700754588449998277873---------899999999972379878489998699


Q ss_pred             HHHHHHHHCCHHHHHHCEEEEECCCCHHHHHHHHHH
Q ss_conf             999998520111432001443068786899999986
Q gi|254780163|r  343 SEYRQFFEKDKALVRRFQKIDVSEPSIEDAIEIVKG  378 (798)
Q Consensus       343 ~ey~~~~e~d~al~rrF~~i~v~ep~~~~~~~iL~~  378 (798)
T Consensus       172 ~--~~l---lpTI~SRcq~~~~~~~~~~~~~~~L~~  202 (342)
T PRK06964        172 I--DRL---LPTILSRCRQWPMTVPAPEAAAAWLAA  202 (342)
T ss_pred             H--HHC---CHHHHHCCEEECCCCCCHHHHHHHHHH
T ss_conf             2--548---368876764302899599999999987