HHsearch alignment for GI: 254780163 and conserved domain: PRK07132

>PRK07132 DNA polymerase III subunit delta'; Validated.
Probab=98.39  E-value=8.2e-06  Score=60.93  Aligned_cols=66  Identities=23%  Similarity=0.246  Sum_probs=29.8

Q ss_pred             EEEEECCHHHHHCCCCCCCCCCCHHHHHHHHHCC--CCEEEEEECCHHHHHHHHHCCHHHHHHCEEEEECCCCHHHHHHH
Q ss_conf             3999736166301554443447778888766302--66038873048999998520111432001443068786899999
Q gi|254780163|r  298 AILYIDEIHTLVGAGSASGISVDASNLLKPALSS--GAVRCIGSTTYSEYRQFFEKDKALVRRFQKIDVSEPSIEDAIEI  375 (798)
Q Consensus       298 ~ilfideih~ligag~~~g~~~d~an~lkP~L~r--g~~~~IgatT~~ey~~~~e~d~al~rrF~~i~v~ep~~~~~~~i  375 (798)
T Consensus        94 Kv~IIdea~~l---------t~~A~NaLLKtLEEPp~~~~fil~t~~~--~~i---l~TI~SRCq~~~f~~~~~~~i~~~  159 (303)
T PRK07132         94 KILIIKNIEKT---------SNSSLNALLKTIEEPSKNTYFLLTTKNI--NKV---IPTIVSRCQVINVKEPDQQKILAK  159 (303)
T ss_pred             EEEEEECHHHC---------CHHHHHHHHHHCCCCCCCEEEEEEECCH--HHC---CHHHHHCCEEEECCCCCHHHHHHH
T ss_conf             69998165533---------9999999998703898684899972882--438---377863665663788999999999


Q ss_pred             HH
Q ss_conf             98
Q gi|254780163|r  376 VK  377 (798)
Q Consensus       376 L~  377 (798)
T Consensus       160 l~  161 (303)
T PRK07132        160 LL  161 (303)
T ss_pred             HH
T ss_conf             98