HHsearch alignment for GI: 254780163 and conserved domain: PRK07270

>PRK07270 DNA polymerase III subunits gamma and tau; Validated.
Probab=98.98  E-value=1.5e-07  Score=73.36  Aligned_cols=36  Identities=11%  Similarity=0.372  Sum_probs=17.0

Q ss_pred             HEEEEEEEEHHHHHCCCCCCCHHHHHHHHHHHHHCCCCCEEEEE
Q ss_conf             20144554046753063431237899999998720389839997
Q gi|254780163|r  259 LGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIESYANAILYI  302 (798)
Q Consensus       259 ~~~~i~~ld~~~l~ag~~~rg~fe~r~~~~~~~~~~~~~~ilfi  302 (798)
T Consensus       117 ~~yKV~IIDEah~Ls~--------~A~NALLKtLEEPP~~~vFI  152 (557)
T PRK07270        117 ATYKVYIIDEVHMLST--------GAFNALLKTLEEPTENVVFI  152 (557)
T ss_pred             CCEEEEEECCHHHCCH--------HHHHHHHHHHHCCCCCEEEE
T ss_conf             8838999714453499--------99998999852899876999