HHsearch alignment for GI: 254780163 and conserved domain: PRK07940

>PRK07940 DNA polymerase III subunit delta'; Validated.
Probab=99.27  E-value=9.3e-11  Score=96.48  Aligned_cols=160  Identities=16%  Similarity=0.299  Sum_probs=104.8

Q ss_pred             HHHHCHHHHHHHHHHHHHHHHCCC----CCCCCCCCEEEEECCCCHHHHHHHHHHHHHC--CCC-----EEEEEHHHHHC
Q ss_conf             665345899999999987752044----5657874068861432003889999987304--773-----37720688612
Q gi|254780163|r  477 TVVYGQEEAIKKLSSSIKIARAGL----SDPNKPIGCYVFSGPTGVGKTEISKQLAFAL--GVQ-----LLRFDMSEYME  545 (798)
Q Consensus       477 ~~v~GQ~~ai~~v~~~i~~~~~gl----~~~~rP~g~flf~GptGvGKTelak~la~~~--~~~-----lir~dmsey~e  545 (798)
T Consensus         5 ~~ivGQe~v~~~L~~A~~~~R~~~~~~~~~~~~~~HAyLF~Gp~G~Gk~~~A~~~A~~l~C~~~~~~~cg~C~~C~~i~-   83 (395)
T PRK07940          5 DRLVGQDAVVAELRAAARAARADSAHSAAAGSGMTHAWLFTGPPGSGRSNAARAFAAALQCTDPGVPGCGECRACRTVL-   83 (395)
T ss_pred             HHHCCCHHHHHHHHHHHHHCCCCCCCCCCCCCCCCEEEEEECCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHH-
T ss_conf             1315929999999999983634344333346876603763689987889999999999669999999998787899987-


Q ss_pred             CCCCCHHCCCCCHH---------CCCCCCCCCCHHHHHCC----CEEEEECCHHHCCHHHHHHHHHHHHHHHCCCCCCCE
Q ss_conf             46530110478000---------25644431003555158----517774044550289999999987775021779977
Q gi|254780163|r  546 RHAVSRLIGAPPGY---------VGFGQGGILADSVDQNP----YSVVLLDEIEKSHPDVLNILLQIMDYGILTDQSGKK  612 (798)
Q Consensus       546 ~~~vs~LiGappGY---------vG~~egg~Lte~vr~~P----~sVvl~DEiEKAh~~v~~~llqild~G~ltd~~Gr~  612 (798)
T Consensus        84 -------~g~hpDv~~i~p~~~~i~id~iR~l~~~~~~~p~~~~~kv~ii~~a~~m~~~a~NalLKtLEEPp--------  148 (395)
T PRK07940         84 -------AGTHPDVRVVVPEGLSIGVDEVREIVQIAARRPTTGRWRIVVIEDADRLTERAANALLKAVEEPP--------  148 (395)
T ss_pred             -------CCCCCCEEEEECCCCCCCHHHHHHHHHHHHHCCCCCCCEEEEEECHHHHCHHHHHHHHHHHCCCC--------
T ss_conf             -------68998718982687768899999999998527303795599980778748999999998521788--------


Q ss_pred             ECCCCEEEEEECCCCHHHHHHCCCCCCCCCCHHHHHHHHHHHCCHHHHCCCCEEEECCCCCHHHHHHHH
Q ss_conf             612542999942421455330368988211148899999872887881776828962889999999999
Q gi|254780163|r  613 ISFRNVILIMTTNAGALEMSKARIGFGSSRNDDADKEALRNFLSPEFLNRLDSIIPFFPLSSDIIRQVV  681 (798)
Q Consensus       613 vdf~n~iii~TsN~G~~~~~~~~~g~~~~~~~~~~~~~l~~~f~peflnRid~ii~F~~l~~~~~~~i~  681 (798)
T Consensus       149 ---~~~~fiL~t~~~-------------------------~~llpTI~SRc-q~~~f~~~~~~~i~~~L  188 (395)
T PRK07940        149 ---PRTVWLLCAPSV-------------------------EDVLPTIRSRC-RHVALRTPSVEAVADVL  188 (395)
T ss_pred             ---CCEEEEEEECCH-------------------------HHHHHHHHHHH-EECCCCCCCHHHHHHHH
T ss_conf             ---886999873997-------------------------87446887440-00237999999999999