HHsearch alignment for GI: 254780163 and conserved domain: PRK08769

>PRK08769 DNA polymerase III subunit delta'; Validated.
Probab=98.47  E-value=3.6e-06  Score=63.50  Aligned_cols=180  Identities=19%  Similarity=0.259  Sum_probs=104.9

Q ss_pred             HHHHHHHHHCCCCCCE-EEECCCCCHHHHHHHHHHHHHHCCCCCHHHH-------------EEEEEEEEHHHHHCCCCCC
Q ss_conf             9999998622677874-8966764116689999999985489883452-------------0144554046753063431
Q gi|254780163|r  213 INRTIQILCRRSKNNP-LYVGDPGVGKTAIAEGFAKQIVDGMVPDILL-------------GARIFSLDMGNLIAGTRYR  278 (798)
Q Consensus       213 I~riiqIL~RR~KNn~-~lvG~~gvGktaive~la~~i~~~~vp~~l~-------------~~~i~~ld~~~l~ag~~~r  278 (798)
T Consensus        13 ~~~L~~~i~~~rl~HA~Lf~Gp~G~GK~~~A~~~A~~llc~~~~~~~~~~~~~~i~~g~HPD~~~i~~--~~~~~~~k~k   90 (319)
T PRK08769         13 FDQTVAALDAGRLGHGLLICGPEGLGKRAVALALAEHVLASGPDPALAQRTRQLIAAGTHPDLQLVSF--IPNRTGDKLR   90 (319)
T ss_pred             HHHHHHHHHCCCCCCEEEEECCCCCCHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHCCCCCCEEEEEC--CCCCCCCCCC
T ss_conf             99999999769942068758999878999999999998379979765433889996689989687753--4444543112


Q ss_pred             CHH-HHHHHHHHHHHCCC----CCEEEEECCHHHHHCCCCCCCCCCCHHHHHHHHHC--CCCEEEEEECCHHHHHHHHHC
Q ss_conf             237-89999999872038----98399973616630155444344777888876630--266038873048999998520
Q gi|254780163|r  279 GDF-EERIKKIVKEIESY----ANAILYIDEIHTLVGAGSASGISVDASNLLKPALS--SGAVRCIGSTTYSEYRQFFEK  351 (798)
Q Consensus       279 g~f-e~r~~~~~~~~~~~----~~~ilfideih~ligag~~~g~~~d~an~lkP~L~--rg~~~~IgatT~~ey~~~~e~  351 (798)
T Consensus        91 ~~I~IdqiR~l~~~~~~~p~~g~~KV~IId~Ad~m---------n~~AaNalLK~LEEPp~~~~~iL~~~~~~--~---l  156 (319)
T PRK08769         91 TEIVIEQVREISQKLALTPQYGIAQVVIVDPADAI---------NRSACNALLKTLEEPSPGRYLWLISAQPA--R---L  156 (319)
T ss_pred             CCCCHHHHHHHHHHHHHCCCCCCCEEEEECCHHHC---------CHHHHHHHHHHHCCCCCCEEEEEEECCHH--H---C
T ss_conf             34869999999999613720279569998066752---------89999999998227998848999869936--5---8


Q ss_pred             CHHHHHHCEEEEECCCCHHHHHHHHHHHHHHHHHHCCCEECCHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHH
Q ss_conf             1114320014430687868999999861276654103512111789999986542015556467988998653
Q gi|254780163|r  352 DKALVRRFQKIDVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLPDKAIDVIDEAG  424 (798)
Q Consensus       352 d~al~rrF~~i~v~ep~~~~~~~iL~~~~~~ye~~h~v~~~~~al~~av~ls~ryi~~r~lPdkAidllDea~  424 (798)
T Consensus       157 l~TI~SRCq~~~~~~p~~~~~~~~L~~~--------g--~~~~~a~~~l~~a------~g~p~~A~~~~~~~~  213 (319)
T PRK08769        157 PATIRSRCQRLEFKLPPAHEALAWLLSQ--------G--VSERAAQEALDAA------RGHPGLAAQWLREDG  213 (319)
T ss_pred             CHHHHHCCEEECCCCCCHHHHHHHHHHC--------C--CCHHHHHHHHHHH------CCCHHHHHHHHCCCC
T ss_conf             2477648501118996999999999975--------9--9918999999982------799689999843672