HHsearch alignment for GI: 254780163 and conserved domain: PRK08770

>PRK08770 DNA polymerase III subunits gamma and tau; Validated.
Probab=98.68  E-value=7.2e-08  Score=75.70  Aligned_cols=258  Identities=19%  Similarity=0.242  Sum_probs=155.2

Q ss_pred             HHHCCCCHHHHHHHHHHHHHHHHHHCCCCCC-EEEECCCCCHHHHHHHHHHHHHHCCCCCH-HH-------------HEE
Q ss_conf             7754861122217899999999862267787-48966764116689999999985489883-45-------------201
Q gi|254780163|r  197 KVKKGKVDILVGRHEEINRTIQILCRRSKNN-PLYVGDPGVGKTAIAEGFAKQIVDGMVPD-IL-------------LGA  261 (798)
Q Consensus       197 ~AreGKLDPVIGRd~EI~riiqIL~RR~KNn-~~lvG~~gvGktaive~la~~i~~~~vp~-~l-------------~~~  261 (798)
T Consensus         9 k~rp~~f~~~~gq~~~~~~l~~~~~~~~~~~a~lf~g~rg~gkt~~ar~~a~~lnc~~~~~~~pc~~c~~c~~i~~~~~~   88 (663)
T PRK08770          9 KWRPKRFAELVGQEHVVRALSNALDSGRVHHAFLFTGTRGVGKTTIARIFAKSLNCETGTSADPCGQCPACLDIDAGRYI   88 (663)
T ss_pred             HHCCCCHHHHCCCHHHHHHHHHHHHCCCCCEEEEEECCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCCHHHHHHHCCCCC
T ss_conf             50887464522859999999999970997404762279988888999999998678999999978778778988548988


Q ss_pred             EEEEEEHHHHHCCCCCCCHHHHHHHHHHHHHCC---CCC-EEEEECCHHHHHCCCCCCCCCCCHHH-HHHHHHC--CCCE
Q ss_conf             445540467530634312378999999987203---898-39997361663015544434477788-8876630--2660
Q gi|254780163|r  262 RIFSLDMGNLIAGTRYRGDFEERIKKIVKEIES---YAN-AILYIDEIHTLVGAGSASGISVDASN-LLKPALS--SGAV  334 (798)
Q Consensus       262 ~i~~ld~~~l~ag~~~rg~fe~r~~~~~~~~~~---~~~-~ilfideih~ligag~~~g~~~d~an-~lkP~L~--rg~~  334 (798)
T Consensus        89 d~~e~daas------~~~v--~~~r~~~~~~~~~p~~~~~kvy~idevhmls---------~~~fna~lk-tleepp~~v  150 (663)
T PRK08770         89 DLLEIDAAS------NTGV--DDVREVIENAQYMPSRGKFKVYLIDEVHMLS---------KAAFNALLK-TLEEPPEHV  150 (663)
T ss_pred             CEEEEECCC------CCCH--HHHHHHHHHCCCCCCCCCEEEEEEECHHHCC---------HHHHHHHHH-HHCCCCCCE
T ss_conf             658864676------5888--9999999844358877743699970043328---------999999987-402786442


Q ss_pred             EEEEECCHHHHHHHHHCCHHHHHHCEEEEECCCCHHHHHHHHHHHHHHHHHHCCCEECCHHHHHHHHHHHHHCCCCCCHH
Q ss_conf             38873048999998520111432001443068786899999986127665410351211178999998654201555646
Q gi|254780163|r  335 RCIGSTTYSEYRQFFEKDKALVRRFQKIDVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLPD  414 (798)
Q Consensus       335 ~~IgatT~~ey~~~~e~d~al~rrF~~i~v~ep~~~~~~~iL~~~~~~ye~~h~v~~~~~al~~av~ls~ryi~~r~lPd  414 (798)
T Consensus       151 ~f~~att~~--~k~--p~t~~src-~~f~~~~~~~~~~~~~l~~~~~----~e~~~~~~~~~~~~~~~~~gs~rd-----  216 (663)
T PRK08770        151 KFLLATTDP--QKL--PVTVLSRC-LQFNLKRLDEDQIQGQMTRILA----AEQIESDPSAIVQLSKAADGSLRD-----  216 (663)
T ss_pred             EEEEECCCH--HHC--CHHHHHHH-HHCCCCCCCHHHHHHHHHHHHH----HCCCCCCHHHHHHHHHHCCCCHHH-----
T ss_conf             899854873--337--48999888-7634377999999999999999----839976999999999974785677-----


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHCCCCCC---HHHHHCCHHHHHHHHCCHHHHHHHCHHHHHHHHHH
Q ss_conf             798899865333321144322113657899986631024531---01110011233421000024665345899999999
Q gi|254780163|r  415 KAIDVIDEAGASQILQPLSKRRKFITEKDIKKTIASMNRSIH---TTSFSRDDDSVLSNLEKNLGTVVYGQEEAIKKLSS  491 (798)
Q Consensus       415 kAidllDea~a~~~~~~~~~~~~~~~~~~i~~~~~~~~~gip---~~~~~~~~~~~l~~l~~~l~~~v~GQ~~ai~~v~~  491 (798)
T Consensus       217 -~lsl~~q~~~~~--------~~~~~~~~v~~mlg~~~~~~~~~l~~al~~~d~~~~~~~~~~~~~~~~~~~~~l~~l~~  287 (663)
T PRK08770        217 -GLSLLDQAIAYA--------GGALREDVVRTMLGTVDRTQVGAMLQALADGDGARLLQVVAALAEFSPDWSGVLEALAE  287 (663)
T ss_pred             -HHHHHHHHHHHC--------CCCCCHHHHHHHHCCCCHHHHHHHHHHHHHCCHHHHHHHHHHHHHHCCCHHHHHHHHHH
T ss_conf             -888999999866--------89768999999848888789999999999668999999999999868899999999999


Q ss_pred             HHHH
Q ss_conf             9877
Q gi|254780163|r  492 SIKI  495 (798)
Q Consensus       492 ~i~~  495 (798)
T Consensus       288 ~~~~  291 (663)
T PRK08770        288 ALHR  291 (663)
T ss_pred             HHHH
T ss_conf             9999