HHsearch alignment for GI: 254780163 and conserved domain: PRK09112

>PRK09112 DNA polymerase III subunit delta'; Validated.
Probab=99.24  E-value=1.4e-10  Score=95.20  Aligned_cols=164  Identities=21%  Similarity=0.362  Sum_probs=100.3

Q ss_pred             HHHHHHCHHHHHHHHHHHHHHHHCCCCCCCCCCCEEEEECCCCHHHHHHHHHHH-HHCCCCEEE---EEHHHHHCCCCCC
Q ss_conf             246653458999999999877520445657874068861432003889999987-304773377---2068861246530
Q gi|254780163|r  475 LGTVVYGQEEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLA-FALGVQLLR---FDMSEYMERHAVS  550 (798)
Q Consensus       475 l~~~v~GQ~~ai~~v~~~i~~~~~gl~~~~rP~g~flf~GptGvGKTelak~la-~~~~~~lir---~dmsey~e~~~vs  550 (798)
T Consensus        21 ~~~~liGq~~~~~~L~~a~~~gRl--------~HA~Lf~GP~GiGKaTlA~~~A~~Ll~~~~~~~~~~~~~~pd~~~~~~   92 (352)
T PRK09112         21 ENNRLFGHEEARAFLAQAYREGRL--------HHALLFEGPEGIGKATLAFHLANHILSHPDPNEAPETLADPDPASPLW   92 (352)
T ss_pred             CHHHHCCHHHHHHHHHHHHHCCCC--------CCEEEEECCCCCCHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCHHH
T ss_conf             464627869999999999984996--------524653589980899999999999866998666865567888787789


Q ss_pred             HHC--CCCCHHC----CCCCC-CC------------CCHHHHHCC----CEEEEECCHHHCCHHHHHHHHHHHHHHHCCC
Q ss_conf             110--4780002----56444-31------------003555158----5177740445502899999999877750217
Q gi|254780163|r  551 RLI--GAPPGYV----GFGQG-GI------------LADSVDQNP----YSVVLLDEIEKSHPDVLNILLQIMDYGILTD  607 (798)
Q Consensus       551 ~Li--GappGYv----G~~eg-g~------------Lte~vr~~P----~sVvl~DEiEKAh~~v~~~llqild~G~ltd  607 (798)
T Consensus        93 r~i~~g~hpdl~~i~r~~d~k~~~~~~~I~vd~iR~l~~~~~~~~~~~~~kv~Iid~ad~m~~~aaNALLK~LEEP----  168 (352)
T PRK09112         93 RQIAQGAHPNLLHLTRPFDEKTGKFKTAITVDEIRRVTHFLSQTSGDGNWRIVIIDPADDMNRNAANAILKTLEEP----  168 (352)
T ss_pred             HHHHCCCCCCEEEEECCCCHHHHHHHCCCCHHHHHHHHHHHCCCCCCCCEEEEEECCHHHHHHHHHHHHHHHHHCC----
T ss_conf             9997489999565534322021454335777999999998454886688069998187874699999999985348----


Q ss_pred             CCCCEECCCCEEEEEECCCCHHHHHHCCCCCCCCCCHHHHHHHHHHHCCHHHHCCCCEEEECCCCCHHHHHHHHHH
Q ss_conf             7997761254299994242145533036898821114889999987288788177682896288999999999999
Q gi|254780163|r  608 QSGKKISFRNVILIMTTNAGALEMSKARIGFGSSRNDDADKEALRNFLSPEFLNRLDSIIPFFPLSSDIIRQVVHK  683 (798)
Q Consensus       608 ~~Gr~vdf~n~iii~TsN~G~~~~~~~~~g~~~~~~~~~~~~~l~~~f~peflnRid~ii~F~~l~~~~~~~i~~~  683 (798)
T Consensus       169 -------p~~~~fiLit~~~~-----------------~ll--------~TI~SRC-q~~~f~pL~~~di~~~L~~  211 (352)
T PRK09112        169 -------PARALFILISHSSG-----------------RLL--------PTIRSRC-QPISLKPLDDDELKKALSH  211 (352)
T ss_pred             -------CCCEEEEEEECCHH-----------------HCH--------HHHHHHC-CCCCCCCCCHHHHHHHHHH
T ss_conf             -------98748998869977-----------------776--------8999743-3214889398999999998