HHsearch alignment for GI: 254780163 and conserved domain: PRK10820

>PRK10820 DNA-binding transcriptional regulator TyrR; Provisional.
Probab=98.00  E-value=0.00011  Score=52.95  Aligned_cols=171  Identities=18%  Similarity=0.227  Sum_probs=97.8

Q ss_pred             CCCCHHHHHHHHHHHHHHHHHHCC--CCCCEEEECCCCCHHHHHHHHHHHHHHCCCCCHHHHEEEEEEEEHHHHHC----
Q ss_conf             486112221789999999986226--77874896676411668999999998548988345201445540467530----
Q gi|254780163|r  200 KGKVDILVGRHEEINRTIQILCRR--SKNNPLYVGDPGVGKTAIAEGFAKQIVDGMVPDILLGARIFSLDMGNLIA----  273 (798)
Q Consensus       200 eGKLDPVIGRd~EI~riiqIL~RR--~KNn~~lvG~~gvGktaive~la~~i~~~~vp~~l~~~~i~~ld~~~l~a----  273 (798)
T Consensus       200 ~~~F~~iig~S~~m~~v~~~a~r~A~~d~pVLI~GEsGTGKellAraIH~~S~-------R~~~pFv~vnC~alp~~l~e  272 (513)
T PRK10820        200 VSAFSQIVAVSPKMKHVVEQARKLAMLSAPLLITGDTGTGKDLFAYACHLASP-------RAKKPYLALNCASIPEDAVE  272 (513)
T ss_pred             CCCHHHHEECCHHHHHHHHHHHHHHCCCCCEEEECCCCCCHHHHHHHHHHCCC-------CCCCCCEEEECCCCCHHHHH
T ss_conf             16877751089999999999999859899889989898249999999996688-------78998268889989967899


Q ss_pred             ----CC---CCCCHHHHHHHHHHHHHCCCCCEEEEECCHHHHHCCCCCCCCCCCHHHHHHHHHCCC-------------C
Q ss_conf             ----63---431237899999998720389839997361663015544434477788887663026-------------6
Q gi|254780163|r  274 ----GT---RYRGDFEERIKKIVKEIESYANAILYIDEIHTLVGAGSASGISVDASNLLKPALSSG-------------A  333 (798)
Q Consensus       274 ----g~---~~rg~fe~r~~~~~~~~~~~~~~ilfideih~ligag~~~g~~~d~an~lkP~L~rg-------------~  333 (798)
T Consensus       273 seLFG~a~~~~~G~fe-----------~A~gGTLfLdEI~~l---------~~~~Q~kLLr~Lq~~~~~rvG~~~~~~~d  332 (513)
T PRK10820        273 SELFGHAPEGKKGFFE-----------QANGGSVLLDEIGEM---------SPRMQAKLLRFLNDGTFRRVGEDHEVHVD  332 (513)
T ss_pred             HHHCCCCCCCCCCCEE-----------ECCCCEEEEECHHHC---------CHHHHHHHHHHHHCCEEEECCCCCEEEEE
T ss_conf             9863876668897557-----------858988999783659---------99999999999868979965998535677


Q ss_pred             EEEEEECCHHHHHHHHHCCH---HHHHHCEEEEECCCCHHHHH----HHHHHHHHHHHHHCC---CEECCHHHHH
Q ss_conf             03887304899999852011---14320014430687868999----999861276654103---5121117899
Q gi|254780163|r  334 VRCIGSTTYSEYRQFFEKDK---ALVRRFQKIDVSEPSIEDAI----EIVKGIKPYFEEHHQ---LRYSKEAIRA  398 (798)
Q Consensus       334 ~~~IgatT~~ey~~~~e~d~---al~rrF~~i~v~ep~~~~~~----~iL~~~~~~ye~~h~---v~~~~~al~~  398 (798)
T Consensus       333 vRiIaaT~~dL-~~lv~~g~FReDLyyRL~v~~I~lPpLReR~eDI~~L~~~fl~~~~~~~g~~~~~ls~~a~~~  406 (513)
T PRK10820        333 VRVICATQKNL-VELVQKGLFREDLYYRLNVLTLNLPPLRDCPQDIMPLTELFVARFADEQGVPRPKLSADLSTV  406 (513)
T ss_pred             EEEEECCCHHH-HHHHHCCCCCHHHHHHHHCCCCCCCCHHHCHHHHHHHHHHHHHHHHHHCCCCCCCCCHHHHHH
T ss_conf             89996265309-999872985088999861672558883446556999999999999997599989847999999