HHsearch alignment for GI: 254780163 and conserved domain: PRK12402

>PRK12402 replication factor C small subunit 2; Reviewed.
Probab=99.40  E-value=1.3e-11  Score=102.69  Aligned_cols=204  Identities=17%  Similarity=0.215  Sum_probs=136.5

Q ss_pred             HHHHHCCCCHHHHHHHHHHHHHHHHHHCCCCCCEEEECCCCCHHHHHHHHHHHHHHCCCCCHH----------HHEEEEE
Q ss_conf             887754861122217899999999862267787489667641166899999999854898834----------5201445
Q gi|254780163|r  195 TEKVKKGKVDILVGRHEEINRTIQILCRRSKNNPLYVGDPGVGKTAIAEGFAKQIVDGMVPDI----------LLGARIF  264 (798)
Q Consensus       195 Te~AreGKLDPVIGRd~EI~riiqIL~RR~KNn~~lvG~~gvGktaive~la~~i~~~~vp~~----------l~~~~i~  264 (798)
T Consensus         6 veKYRP~~~~dvvGq~~i~~~L~~~~~~~~~phlLf~GPpG~GKTt~A~~lA~~l~~~~~~~~~~~~nasd~~~~~~~~i   85 (337)
T PRK12402          6 TEKYRPSLFEDILGQESVVDHLSALAASGNLPHLVVYGPSGSGKTAAVRALARELYGDPWENNFTYFNVSDFFDQGKKYL   85 (337)
T ss_pred             CCCCCCCCHHHHCCCHHHHHHHHHHHHCCCCCEEEEECCCCCCHHHHHHHHHHHHCCCCCCCCCCEECCCCCCCCCCCEE
T ss_conf             21418897998039799999999999779987698889298489999999999967997567833311653113564001


Q ss_pred             EEEH--HHHHCCCCCCCH-HHHHHHHHHHHHCCC-----CCEEEEECCHHHHHCCCCCCCCCCCHHHHHHHHHC--CCCE
Q ss_conf             5404--675306343123-789999999872038-----98399973616630155444344777888876630--2660
Q gi|254780163|r  265 SLDM--GNLIAGTRYRGD-FEERIKKIVKEIESY-----ANAILYIDEIHTLVGAGSASGISVDASNLLKPALS--SGAV  334 (798)
Q Consensus       265 ~ld~--~~l~ag~~~rg~-fe~r~~~~~~~~~~~-----~~~ilfideih~ligag~~~g~~~d~an~lkP~L~--rg~~  334 (798)
T Consensus        86 ~~~~~~~~~~~~~~~~~~~~~d~i~~ii~~~a~~~p~~~~~KiiIlDEad~l---------t~~Aq~aLlk~lEe~~~~~  156 (337)
T PRK12402         86 VEDPRFAHFYDDPKRKYKSVIDNFKHILKEYASMRPLSADYKLILFDNAEAL---------REDAQQALRRIMERYSETC  156 (337)
T ss_pred             ECCCCHHHHHCCHHHCCCCHHHHHHHHHHHHHCCCCCCCCEEEEEEECCCCC---------CHHHHHHHHHHHHCCCCCE
T ss_conf             0166423442015332773789999999998614887788049997071317---------9999999998874088766


Q ss_pred             EEEEECCHHHHHHHHHCCHHHHHHCEEEEECCCCHHHHHHHHHHHHHHHHHHCCCEECCHHHHHHHHHHHHHCCCCCCHH
Q ss_conf             38873048999998520111432001443068786899999986127665410351211178999998654201555646
Q gi|254780163|r  335 RCIGSTTYSEYRQFFEKDKALVRRFQKIDVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLPD  414 (798)
Q Consensus       335 ~~IgatT~~ey~~~~e~d~al~rrF~~i~v~ep~~~~~~~iL~~~~~~ye~~h~v~~~~~al~~av~ls~ryi~~r~lPd  414 (798)
T Consensus       157 ~fIl~t~~~--~~ii---~tI~SRC~~i~F~~~s~~~i~~~L~~I~~~----E~i~~~~~~l~~ia~~s~Gd------lR  221 (337)
T PRK12402        157 RFIFSTTQP--SKLI---PPIRSRCLPLFFRPVPDDEIRSVLESIAAA----EGVEISDDGLDLIAYYAEGD------LR  221 (337)
T ss_pred             EEEEECCCC--CCCC---HHHHHHCEEEECCCCCHHHHHHHHHHHHHH----CCCCCCHHHHHHHHHHCCCC------HH
T ss_conf             998723864--4475---247762445435898999999999999998----49998999999999986998------99


Q ss_pred             HHHHHHHH
Q ss_conf             79889986
Q gi|254780163|r  415 KAIDVIDE  422 (798)
Q Consensus       415 kAidllDe  422 (798)
T Consensus       222 ~ain~Lq~  229 (337)
T PRK12402        222 KAILTLQL  229 (337)
T ss_pred             HHHHHHHH
T ss_conf             99999999