HHsearch alignment for GI: 254780163 and conserved domain: PRK12723

>PRK12723 flagellar biosynthesis regulator FlhF; Provisional.
Probab=97.42  E-value=0.0005  Score=48.11  Aligned_cols=119  Identities=22%  Similarity=0.412  Sum_probs=66.3

Q ss_pred             CCCCCCCEEEEECCCCHHHHHHHHHHH--HHC-------CCCEEEEEH---HHHHCCCCCCHHCCCCCHHCCCCCCCCCC
Q ss_conf             657874068861432003889999987--304-------773377206---88612465301104780002564443100
Q gi|254780163|r  502 DPNKPIGCYVFSGPTGVGKTEISKQLA--FAL-------GVQLLRFDM---SEYMERHAVSRLIGAPPGYVGFGQGGILA  569 (798)
Q Consensus       502 ~~~rP~g~flf~GptGvGKTelak~la--~~~-------~~~lir~dm---sey~e~~~vs~LiGappGYvG~~egg~Lt  569 (798)
T Consensus       170 ~~~k~-~vi~lVGPTGvGKTTTiAKLAa~~~l~~~~k~~~V~lit~DtyRigAveQLktya~il~vp~-~v~~~~-~dl~  246 (388)
T PRK12723        170 DNLKK-RIFILVGPTGVGKTTTIAKLAAIYGINSDDKSLNIKIITIDNYRIGAKKQIQTYGDIMGIPV-KAIESF-KDLK  246 (388)
T ss_pred             CCCCC-EEEEEECCCCCCHHHHHHHHHHHHHHHCCCCCCCEEEEEECCCCHHHHHHHHHHHHHHCCCE-EEECCH-HHHH
T ss_conf             35576-28999899887578799999999998626767737999807875889999999999978806-985788-9999


Q ss_pred             HHHHH-CCCEEEEECCHHHCCHHHH--HHHHHHHHHHHCCCCCCCEECCCCEEEEEECCCCHHHHH
Q ss_conf             35551-5851777404455028999--999998777502177997761254299994242145533
Q gi|254780163|r  570 DSVDQ-NPYSVVLLDEIEKSHPDVL--NILLQIMDYGILTDQSGKKISFRNVILIMTTNAGALEMS  632 (798)
Q Consensus       570 e~vr~-~P~sVvl~DEiEKAh~~v~--~~llqild~G~ltd~~Gr~vdf~n~iii~TsN~G~~~~~  632 (798)
T Consensus       247 ~~l~~~~~~D~IlIDTAGrs~~d~~~~~el~~~~~~------~~~~~---~~~Lvlsat~~~~d~~  303 (388)
T PRK12723        247 EEITQSKDFDLVLIDTIGKSPKDFMKLAEMKELLNA------CGRDA---EFHLAVSSTTKTSDIK  303 (388)
T ss_pred             HHHHHHCCCCEEEEECCCCCCCCHHHHHHHHHHHHH------CCCCC---EEEEEECCCCCHHHHH
T ss_conf             999972499999995899885689999999999974------18984---5999987989999999