HHsearch alignment for GI: 254780163 and conserved domain: PRK12726

>PRK12726 flagellar biosynthesis regulator FlhF; Provisional.
Probab=96.59  E-value=0.0072  Score=39.79  Aligned_cols=32  Identities=31%  Similarity=0.403  Sum_probs=20.6

Q ss_pred             CEEEEECCCCHHHHHHHHHHHH-----HCCCCEEEEE
Q ss_conf             0688614320038899999873-----0477337720
Q gi|254780163|r  508 GCYVFSGPTGVGKTEISKQLAF-----ALGVQLLRFD  539 (798)
Q Consensus       508 g~flf~GptGvGKTelak~la~-----~~~~~lir~d  539 (798)
T Consensus       207 ~VIaLVGvnGvGKTTTiAKLA~~l~~~gkkV~LVAaD  243 (407)
T PRK12726        207 RIISLIGQTGVGKTTTLVKLGWQLLKQNRTVGFITTD  243 (407)
T ss_pred             CEEEEECCCCCCHHHHHHHHHHHHHHCCCCEEEEECC
T ss_conf             0899989998978999999999999779917999706