HHsearch alignment for GI: 254780163 and conserved domain: PRK13406

>PRK13406 bchD magnesium chelatase subunit D; Provisional.
Probab=97.47  E-value=0.0015  Score=44.68  Aligned_cols=196  Identities=19%  Similarity=0.188  Sum_probs=98.5

Q ss_pred             CEEEECCCCCHHHHHHHHHHHHHHCC----CCCHHHHEEEE-EEEEHHHHHC-CCCCCCHHHHHHHHHHHHHCCCCCEEE
Q ss_conf             74896676411668999999998548----98834520144-5540467530-634312378999999987203898399
Q gi|254780163|r  227 NPLYVGDPGVGKTAIAEGFAKQIVDG----MVPDILLGARI-FSLDMGNLIA-GTRYRGDFEERIKKIVKEIESYANAIL  300 (798)
Q Consensus       227 n~~lvG~~gvGktaive~la~~i~~~----~vp~~l~~~~i-~~ld~~~l~a-g~~~rg~fe~r~~~~~~~~~~~~~~il  300 (798)
T Consensus        27 Gvlirg~~Gtakst~~r~l~~llp~~~p~~~lPl~~tedrl~G~lDi~~tL~~G~~---v~~~---GLLa~---A~~gvL   97 (584)
T PRK13406         27 GVVLRARAGPVRDRWLAALRALLPAGTPLRRLPPGIADDRLLGGLDLAATLRAGRP---VAER---GLLAE---ADGGVL   97 (584)
T ss_pred             CEEEECCCCCHHHHHHHHHHHHCCCCCCEEECCCCCCHHHHCCCCCHHHHHHCCCE---ECCC---CHHHC---CCCCEE
T ss_conf             18997799957999999999756899984656999974151471259999976898---5257---53330---369989


Q ss_pred             EECCHHHHHCCCCCCCCCCCHHHHHHHHHCCCCEEE---------------EEECCHHHHHHHHHCCHHHHHHCEE-EEE
Q ss_conf             973616630155444344777888876630266038---------------8730489999985201114320014-430
Q gi|254780163|r  301 YIDEIHTLVGAGSASGISVDASNLLKPALSSGAVRC---------------IGSTTYSEYRQFFEKDKALVRRFQK-IDV  364 (798)
Q Consensus       301 fideih~ligag~~~g~~~d~an~lkP~L~rg~~~~---------------IgatT~~ey~~~~e~d~al~rrF~~-i~v  364 (798)
T Consensus        98 yvdevnll---------~d~lv~~Ll~a~~~G~~~vEReGiS~~~parf~LIa~deg~e~d--e~~~~~l~dRla~~vd~  166 (584)
T PRK13406         98 VLAMAERL---------EPGTAARLAAALDAGEVAIERDGLALRMPARFGLVALDEGAEED--ERAPAALADRLAFHLDL  166 (584)
T ss_pred             EEECHHHC---------CHHHHHHHHHHHHCCCCCCCCCCCCCCCCCEEEEEEECCCCCCC--CCHHHHHHHHHCCCCCH
T ss_conf             98514737---------88899999999854874002587663566505899946788764--31107888765070681


Q ss_pred             CCCCHHHHHH--HH-HHHHHHHHHHCCCEECCHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHCCCCH
Q ss_conf             6878689999--99-86127665410351211178999998654201555646798899865333321144322113657
Q gi|254780163|r  365 SEPSIEDAIE--IV-KGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLPDKAIDVIDEAGASQILQPLSKRRKFITE  441 (798)
Q Consensus       365 ~ep~~~~~~~--iL-~~~~~~ye~~h~v~~~~~al~~av~ls~ryi~~r~lPdkAidllDea~a~~~~~~~~~~~~~~~~  441 (798)
T Consensus       167 ~~~~~~~~~~~~~~~~~i~~Ar~~L~~V~i~d~~~~~l~~~a~~~gv~g~R--a~i~~~raArA~AAl----~Gr~~V~~  240 (584)
T PRK13406        167 DGLALRDTREFPIDADDIAAARARLAAVRVPPEAIEALCAAAAALGIASLR--APLLALRAARAAAAL----AGRTAVEE  240 (584)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHHHHCCCCCC--HHHHHHHHHHHHHHH----CCCCCCCH
T ss_conf             676666401111236899999986786666999999999999983998620--999999999999997----49997889


Q ss_pred             HHHHHHH
Q ss_conf             8999866
Q gi|254780163|r  442 KDIKKTI  448 (798)
Q Consensus       442 ~~i~~~~  448 (798)
T Consensus       241 ~Dl~~Aa  247 (584)
T PRK13406        241 ADIALAA  247 (584)
T ss_pred             HHHHHHH
T ss_conf             9999999