HHsearch alignment for GI: 254780163 and conserved domain: PRK13407

>PRK13407 bchI magnesium chelatase subunit I; Provisional.
Probab=99.16  E-value=2.3e-09  Score=86.47  Aligned_cols=226  Identities=19%  Similarity=0.275  Sum_probs=135.9

Q ss_pred             HHHHCHHHHHHHHHHHHHHHHCCCCCCCCCCCEEEEECCCCHHHHHHHHHHHHHCCC----CEEEEE------HHHHHCC
Q ss_conf             665345899999999987752044565787406886143200388999998730477----337720------6886124
Q gi|254780163|r  477 TVVYGQEEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFALGV----QLLRFD------MSEYMER  546 (798)
Q Consensus       477 ~~v~GQ~~ai~~v~~~i~~~~~gl~~~~rP~g~flf~GptGvGKTelak~la~~~~~----~lir~d------msey~e~  546 (798)
T Consensus         8 s~IvGQe~~K~AL~laav-------~p~--~ggvLi~G~~GtgKStlaR~l~~iLP~~~~~e~~~~~~~~~~~~~~~~~~   78 (334)
T PRK13407          8 SAIVGQEEMKQAMVLTAI-------DPG--IGGVLVFGDRGTGKSTAVRALAALLPLIKAVEGCPVNSARPEDCPEWAEV   78 (334)
T ss_pred             HHHCCCHHHHHHHHHHHC-------CCC--CCEEEEECCCCCCHHHHHHHHHHHCCCCCHHCCCCCCCCCCCCCHHHHHC
T ss_conf             376493999999999772-------789--86089978998659999999997289951103675566774211334311


Q ss_pred             CCC------------------CHHCCCC---CHHCC---CCCCCCCCHHHHHCCCEEEEECCHHHCCHHHHHHHHHHHHH
Q ss_conf             653------------------0110478---00025---64443100355515851777404455028999999998777
Q gi|254780163|r  547 HAV------------------SRLIGAP---PGYVG---FGQGGILADSVDQNPYSVVLLDEIEKSHPDVLNILLQIMDY  602 (798)
Q Consensus       547 ~~v------------------s~LiGap---pGYvG---~~egg~Lte~vr~~P~sVvl~DEiEKAh~~v~~~llqild~  602 (798)
T Consensus        79 ~~~~~~~~~~p~v~lPl~atedr~~G~ldie~al~~G~~~~~PGlLa~Ah~----GVLylDEinll~~~vld~Ll~~~e~  154 (334)
T PRK13407         79 SSTTMVERPTPVIDLPLGATEDRVVGALDIERALTRGEKAFEPGLLARANR----GYLYIDEVNLLEDHIVDLLLDVAQS  154 (334)
T ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHCCCCCCCCCHHHHCCC----CEEEEECHHHCCHHHHHHHHHHHHC
T ss_conf             455534489987678999998664474218888626987788605434028----8678720533338899999988716


Q ss_pred             HHCC-CCCCCEECC-CCEEEEEECCCCHHHHHHCCCCCCCCCCHHHHHHHHHHHCCHHHHCCCCEEEECCCC-CHHHHHH
Q ss_conf             5021-779977612-542999942421455330368988211148899999872887881776828962889-9999999
Q gi|254780163|r  603 GILT-DQSGKKISF-RNVILIMTTNAGALEMSKARIGFGSSRNDDADKEALRNFLSPEFLNRLDSIIPFFPL-SSDIIRQ  679 (798)
Q Consensus       603 G~lt-d~~Gr~vdf-~n~iii~TsN~G~~~~~~~~~g~~~~~~~~~~~~~l~~~f~peflnRid~ii~F~~l-~~~~~~~  679 (798)
T Consensus       155 G~~~IeReg~s~~~ParF~LVatmNP--------eE----------------g~Lrp~lLDRf~l~v~v~~~~~~~~r~e  210 (334)
T PRK13407        155 GENVVEREGLSIRHPARFVLVGSGNP--------EE----------------GELRPQLLDRFGLSVEVRSPRDVETRVE  210 (334)
T ss_pred             CCEEEEECCEEEECCCCCEEEEEECC--------CC----------------CCCCHHHHHHHCEEEEECCCCCHHHHHH
T ss_conf             95799977634603662658982088--------87----------------7759899836100687148788777668


Q ss_pred             HHHHHH-----------------HHHHHHH-H--HCCCEEEECHHHHHHHHHCCCCC-CCCCHHHHHHHHHHHHHHHHHH
Q ss_conf             999999-----------------9999999-8--66988999889999999718981-0153267999998623599999
Q gi|254780163|r  680 VVHKFI-----------------MKLELQL-Q--EKGISFHFSEEVINWLVSHGYDV-KMGARPLERIIKEHVKVPLADE  738 (798)
Q Consensus       680 i~~~~l-----------------~~l~~~l-~--~~~i~l~~~~~~~~~l~~~~~~~-~~GAR~l~r~i~~~i~~~la~~  738 (798)
T Consensus       211 iv~r~~~~~~~~~~~~~~~~~e~~~l~~~i~~Ar~~l~~v~~~d~~~~~~~~~~~~~~~~g~Ra~i~l----~r~ARa~A  286 (334)
T PRK13407        211 VITRRDAYDADHDAFMAKWGAEDMQLRGRILGARAALPQLKTPDTVLHDCAALCIALGSDGLRGELTL----LRAARAQA  286 (334)
T ss_pred             HHHHHHHHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHCCCCCHHHHHH----HHHHHHHH
T ss_conf             89999986538799999889899999999999987511468999999999999998589871099999----99999999


Q ss_pred             HHCCC
Q ss_conf             96296
Q gi|254780163|r  739 ILFGK  743 (798)
Q Consensus       739 il~~~  743 (798)
T Consensus       287 aL~Gr  291 (334)
T PRK13407        287 AFEGA  291 (334)
T ss_pred             HHCCC
T ss_conf             97499