HHsearch alignment for GI: 254780163 and conserved domain: PRK13407

>PRK13407 bchI magnesium chelatase subunit I; Provisional.
Probab=98.73  E-value=1.3e-06  Score=66.72  Aligned_cols=232  Identities=20%  Similarity=0.305  Sum_probs=120.2

Q ss_pred             HHHHHHHHHHHHHHHH-CCCCCCEEEECCCCCHHHHHHHHHHHHHHC-----C---------CCCHHH---------HEE
Q ss_conf             2217899999999862-267787489667641166899999999854-----8---------988345---------201
Q gi|254780163|r  206 LVGRHEEINRTIQILC-RRSKNNPLYVGDPGVGKTAIAEGFAKQIVD-----G---------MVPDIL---------LGA  261 (798)
Q Consensus       206 VIGRd~EI~riiqIL~-RR~KNn~~lvG~~gvGktaive~la~~i~~-----~---------~vp~~l---------~~~  261 (798)
T Consensus        10 IvGQ-e~~K~AL~laav~p~~ggvLi~G~~GtgKStlaR~l~~iLP~~~~~e~~~~~~~~~~~~~~~~~~~~~~~~~~~~   88 (334)
T PRK13407         10 IVGQ-EEMKQAMVLTAIDPGIGGVLVFGDRGTGKSTAVRALAALLPLIKAVEGCPVNSARPEDCPEWAEVSSTTMVERPT   88 (334)
T ss_pred             HCCC-HHHHHHHHHHHCCCCCCEEEEECCCCCCHHHHHHHHHHHCCCCCHHCCCCCCCCCCCCCHHHHHCCCCCCCCCCC
T ss_conf             6493-999999999772789860899789986599999999972899511036755667742113343114555344899


Q ss_pred             EEE-------------EEEHH-HHHCCCCCCCHHHHHHHHHHHHHCCCCCEEEEECCHHHHHCCCCCCCCCCCHHHHHHH
Q ss_conf             445-------------54046-7530634312378999999987203898399973616630155444344777888876
Q gi|254780163|r  262 RIF-------------SLDMG-NLIAGTRYRGDFEERIKKIVKEIESYANAILYIDEIHTLVGAGSASGISVDASNLLKP  327 (798)
Q Consensus       262 ~i~-------------~ld~~-~l~ag~~~rg~fe~r~~~~~~~~~~~~~~ilfideih~ligag~~~g~~~d~an~lkP  327 (798)
T Consensus        89 p~v~lPl~atedr~~G~ldie~al~~G~~---~~~P------GlLa~Ah~GVLylDEinll---------~~~vld~Ll~  150 (334)
T PRK13407         89 PVIDLPLGATEDRVVGALDIERALTRGEK---AFEP------GLLARANRGYLYIDEVNLL---------EDHIVDLLLD  150 (334)
T ss_pred             CCCCCCCCCCCCCCCCCCCHHHHHHCCCC---CCCC------CHHHHCCCCEEEEECHHHC---------CHHHHHHHHH
T ss_conf             87678999998664474218888626987---7886------0543402886787205333---------3889999998


Q ss_pred             HHCCCC---------------EEEEEECCHHHHHHHHHCCHHHHHHCE-EEEECCC-CHHHHHHHHHHHHHHHHHHCCCE
Q ss_conf             630266---------------038873048999998520111432001-4430687-86899999986127665410351
Q gi|254780163|r  328 ALSSGA---------------VRCIGSTTYSEYRQFFEKDKALVRRFQ-KIDVSEP-SIEDAIEIVKGIKPYFEEHHQLR  390 (798)
Q Consensus       328 ~L~rg~---------------~~~IgatT~~ey~~~~e~d~al~rrF~-~i~v~ep-~~~~~~~iL~~~~~~ye~~h~v~  390 (798)
T Consensus       151 ~~e~G~~~IeReg~s~~~ParF~LVatmNPeEg----~Lrp~lLDRf~l~v~v~~~~~~~~r~eiv~r-~~~~~~~~~~~  225 (334)
T PRK13407        151 VAQSGENVVEREGLSIRHPARFVLVGSGNPEEG----ELRPQLLDRFGLSVEVRSPRDVETRVEVITR-RDAYDADHDAF  225 (334)
T ss_pred             HHHCCCEEEEECCEEEECCCCCEEEEEECCCCC----CCCHHHHHHHCEEEEECCCCCHHHHHHHHHH-HHHHHHCHHHH
T ss_conf             871695799977634603662658982088877----7598998361006871487887776688999-99865387999


Q ss_pred             E-----CCHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHH---------------HHHHHHHHHCCCCHHHHHHHH--
Q ss_conf             2-----111789999986542015556467988998653333---------------211443221136578999866--
Q gi|254780163|r  391 Y-----SKEAIRAAVQLSVRHFTSRKLPDKAIDVIDEAGASQ---------------ILQPLSKRRKFITEKDIKKTI--  448 (798)
Q Consensus       391 ~-----~~~al~~av~ls~ryi~~r~lPdkAidllDea~a~~---------------~~~~~~~~~~~~~~~~i~~~~--  448 (798)
T Consensus       226 ~~~~~~e~~~l~~~i~~Ar~~l~~v~~~d~~~~~~~~~~~~~~~~g~Ra~i~l~r~ARa~AaL~Gr~~V~~~dl~~aa~l  305 (334)
T PRK13407        226 MAKWGAEDMQLRGRILGARAALPQLKTPDTVLHDCAALCIALGSDGLRGELTLLRAARAQAAFEGAETVGRSHLRSVATS  305 (334)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHH
T ss_conf             99889899999999999987511468999999999999998589871099999999999999749997899999999998


Q ss_pred             --HHCCCCCCHHHHH
Q ss_conf             --3102453101110
Q gi|254780163|r  449 --ASMNRSIHTTSFS  461 (798)
Q Consensus       449 --~~~~~gip~~~~~  461 (798)
T Consensus       306 vL~HRlRr~P~e~~~  320 (334)
T PRK13407        306 ALSHRLRRDPLDEAG  320 (334)
T ss_pred             HCCCCCCCCCCCCCC
T ss_conf             533124589865578