HHsearch alignment for GI: 254780163 and conserved domain: PRK13765

>PRK13765 ATP-dependent protease Lon; Provisional.
Probab=98.58  E-value=1.7e-05  Score=58.65  Aligned_cols=141  Identities=16%  Similarity=0.271  Sum_probs=74.2

Q ss_pred             EEEECCHHHHH-C----------------CCCCCCCCCCHHHHHHHHHCCCCEEEEEECCHHHHHHHHHCCHHHHHHC--
Q ss_conf             99973616630-1----------------5544434477788887663026603887304899999852011143200--
Q gi|254780163|r  299 ILYIDEIHTLV-G----------------AGSASGISVDASNLLKPALSSGAVRCIGSTTYSEYRQFFEKDKALVRRF--  359 (798)
Q Consensus       299 ilfideih~li-g----------------ag~~~g~~~d~an~lkP~L~rg~~~~IgatT~~ey~~~~e~d~al~rrF--  359 (798)
T Consensus       229 vL~IDei~~L~~~~q~~Ll~alq~~k~~I~g~~e~Ss---gA~v~tepvP~Df~lV~aGn~d~~~~m---~palrsri~g  302 (637)
T PRK13765        229 VLFIDEINTLRLESQQSLLTAMQEKKYPITGQSERSS---GAMVRTEPVPCDFIMVAAGNLDAIENM---HPALRSRIRG  302 (637)
T ss_pred             EEEEEHHHHCCHHHHHHHHHHHHCCCEECCCCCCCCC---CCCCCCCCCCEEEEEEEECCHHHHHHC---CHHHHHHHHC
T ss_conf             6998445647988999999999659153236886667---762578986613699995372766643---9988865104


Q ss_pred             --EEEEECC---CCHHHHHHHHHHHHHHHHHHCCC-EECCHHHHHHHHHHHHHCCCC-CCH---HHHHHHHHHHHHHHHH
Q ss_conf             --1443068---78689999998612766541035-121117899999865420155-564---6798899865333321
Q gi|254780163|r  360 --QKIDVSE---PSIEDAIEIVKGIKPYFEEHHQL-RYSKEAIRAAVQLSVRHFTSR-KLP---DKAIDVIDEAGASQIL  429 (798)
Q Consensus       360 --~~i~v~e---p~~~~~~~iL~~~~~~ye~~h~v-~~~~~al~~av~ls~ryi~~r-~lP---dkAidllDea~a~~~~  429 (798)
T Consensus       303 ~gyev~~~~~m~dt~enr~k~arfiaqev~~dg~iPhfdr~AVaeII~eA~R~AG~k~kLTLrLReL~~LIReAgdiA~-  381 (637)
T PRK13765        303 YGYEVYMNDTMEDTPENRKKLVRFVAQEVKRDGKIPHFDREAVEEIIREARRRAGRKGHLTLKLRDLGGLVRVAGDIAR-  381 (637)
T ss_pred             CCEEEEECCCCCCCHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHHHHHHHH-
T ss_conf             7749982356778788999999999999974388899998999999999997405456630528988749999889999-


Q ss_pred             HHHHHHHCCCCHHHHHHHHH
Q ss_conf             14432211365789998663
Q gi|254780163|r  430 QPLSKRRKFITEKDIKKTIA  449 (798)
Q Consensus       430 ~~~~~~~~~~~~~~i~~~~~  449 (798)
T Consensus       382 ---~eg~~~Vta~hV~~A~~  398 (637)
T PRK13765        382 ---SEGADLVTAEHVLEAKK  398 (637)
T ss_pred             ---HCCCCCCCHHHHHHHHH
T ss_conf             ---75999664999999999