HHsearch alignment for GI: 254780163 and conserved domain: TIGR00455

>TIGR00455 apsK adenylylsulfate kinase; InterPro: IPR002891 Enzyme that catalyses the phosphorylation of adenylylsulphate to 3'-phosphoadenylylsulphate. This domain contains an ATP binding P-loop motif .; GO: 0005524 ATP binding, 0016301 kinase activity, 0016772 transferase activity transferring phosphorus-containing groups, 0000103 sulfate assimilation.
Probab=95.55  E-value=0.017  Score=37.13  Aligned_cols=110  Identities=19%  Similarity=0.231  Sum_probs=60.2

Q ss_pred             CCCEEE-EECCCCHHHHHHHHHHHH---HCCCCEEEEEHHHHHCCCCCCHHCCCCCHHCCCCCCCCCCHHHHHCCCEEEE
Q ss_conf             740688-614320038899999873---0477337720688612465301104780002564443100355515851777
Q gi|254780163|r  506 PIGCYV-FSGPTGVGKTEISKQLAF---ALGVQLLRFDMSEYMERHAVSRLIGAPPGYVGFGQGGILADSVDQNPYSVVL  581 (798)
Q Consensus       506 P~g~fl-f~GptGvGKTelak~la~---~~~~~lir~dmsey~e~~~vs~LiGappGYvG~~egg~Lte~vr~~P~sVvl  581 (798)
T Consensus        17 h~g~vlWlTGLSGsGKsTiA~Al~~~L~~~G~~~~~LD-----------------------GD------nvR~gL~~dLG   67 (187)
T TIGR00455        17 HRGVVLWLTGLSGSGKSTIANALEKKLEKKGYRVYVLD-----------------------GD------NVRHGLNKDLG   67 (187)
T ss_pred             CCEEEEEEECCCCCHHHHHHHHHHHHHHHCCCEEEEEC-----------------------CC------EEECCCCCCCC
T ss_conf             97389851168856357999999999996697499975-----------------------86------34247788888


Q ss_pred             ECCHHHCCHHHHHHHHHHHHHHHCCCCCCCEECC------CCEEEEEECCCCHHHHHHCCCCCCCCCCHHHHHHHHHHHC
Q ss_conf             4044550289999999987775021779977612------5429999424214553303689882111488999998728
Q gi|254780163|r  582 LDEIEKSHPDVLNILLQIMDYGILTDQSGKKISF------RNVILIMTTNAGALEMSKARIGFGSSRNDDADKEALRNFL  655 (798)
Q Consensus       582 ~DEiEKAh~~v~~~llqild~G~ltd~~Gr~vdf------~n~iii~TsN~G~~~~~~~~~g~~~~~~~~~~~~~l~~~f  655 (798)
T Consensus        68 FS~~-----------------D--R~eNIRRigEVa~L~~~~G~i~ltsfI-----S------PyR~~R~~vR~~~~~--  115 (187)
T TIGR00455        68 FSEE-----------------D--RKENIRRIGEVAKLLVRNGVIVLTSFI-----S------PYRADRQMVRELIEE--  115 (187)
T ss_pred             CCHH-----------------H--HCCCCCEEHHHHHHHHHCCEEEEEEEE-----C------CCHHHHHHHHHHHHC--
T ss_conf             8856-----------------7--056883532646777647938998421-----7------766678999887540--


Q ss_pred             CHHHHCCCCEEEECCCCCHHHHHH
Q ss_conf             878817768289628899999999
Q gi|254780163|r  656 SPEFLNRLDSIIPFFPLSSDIIRQ  679 (798)
Q Consensus       656 ~peflnRid~ii~F~~l~~~~~~~  679 (798)
T Consensus       116 ---~Gl~F~Evfv~~PL~vcE~RD  136 (187)
T TIGR00455       116 ---GGLEFIEVFVKCPLEVCEQRD  136 (187)
T ss_pred             ---CCEEEEEEECCCCHHHHCCCC
T ss_conf             ---573689972178868632689