HHsearch alignment for GI: 254780163 and conserved domain: TIGR01243

>TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily; InterPro: IPR005938 The ATPase Cdc48 is required for membrane fusion and protein degradation. It possesses chaperone-like activities and can functionally interact with Hsc70. Yeast CDC48 plays a role in cell division control whereas eukaryotic homologues are involved in the budding and transfer of membrane from the transitional endoplasmic reticulum to the Golgi apparatus.; GO: 0016787 hydrolase activity.
Probab=98.52  E-value=1.1e-05  Score=59.92  Aligned_cols=304  Identities=20%  Similarity=0.265  Sum_probs=166.6

Q ss_pred             HHHHHHHHHHHCCCCCCCHHHHHHHHHH---CHHHHHHHHHCCCCHHHHHHHHHHH-HHHCCCCCCCCCCCCCCCCCHHH
Q ss_conf             9999999999828995119999999820---7468999998599989999999999-64136545778886776469899
Q gi|254780163|r   11 VLHQALVLANERNHEYATLEHLLLALID---DSDAAIVMLSCNVDLKVLKNNLLNY-IDNDSSNKLKNGFRVECKPTSSF   86 (798)
Q Consensus        11 vL~~A~~lAk~~~H~~Vt~EHLLLaLL~---d~~~~~iL~~~giD~~~Lk~~Le~~-L~~~~~~~~~~~~~~ei~~S~~l   86 (798)
T Consensus       401 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~la--~~thG~-----~Gadl  473 (980)
T TIGR01243       401 VIKVLKDLEKDERFEKEKIEKIIEKVSKANSEDEIKEILKEDGNVYVEVRNRLIDKLLDKLA--EVTHGF-----VGADL  473 (980)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHH--HHHCCC-----HHHHH
T ss_conf             99999876665566788999999988631026789999750121246789999999999886--542362-----03559


Q ss_pred             HHHHHHHHHHHH--HCCCCCCCHHHHHHHHHHCCCCHHHHHHHHCCCCHHHHHHHHHHHCCCCHHHHHHHHHCCCCCCCC
Q ss_conf             999999999999--809981259998787873774299999998499989999999830000000111211024432100
Q gi|254780163|r   87 QRVVQRAVLHVQ--STGRGIVTGANILVALFSEPDSHATYFLQEQEMTLYDAVNFISHGISKRKEFANFQSKLNVDGSSA  164 (798)
Q Consensus        87 ~rVL~~A~~~A~--~~G~~~I~~eHLLLALL~e~ds~a~~iL~~~gis~~~v~~~i~~~~~~~~~~~~~~~~~~~~~~~~  164 (798)
T Consensus       474 aal~~eaam~~lrr~~~eg~i~~---------ea~~iP~~vl~~lkvt~~df~ealk~~~P~~~re~~~evP~v~W~---  541 (980)
T TIGR01243       474 AALAKEAAMAALRRLIREGKINL---------EAEEIPKEVLEELKVTMKDFKEALKMVEPSALREVLVEVPNVKWE---  541 (980)
T ss_pred             HHHHHHHHHHHHHHHHCCCCCCH---------HHHHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHEEEEECCCCCCC---
T ss_conf             99989999999998740277450---------267757999987322289999998510623411000233751100---


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHCCCCCCEEEECCCCCHHHHHHHH
Q ss_conf             00012444444455554455303565442588775486112221789999999986226778748966764116689999
Q gi|254780163|r  165 GSDGEGFVNDYQAKTDLNLFPALSAYCVDLTEKVKKGKVDILVGRHEEINRTIQILCRRSKNNPLYVGDPGVGKTAIAEG  244 (798)
Q Consensus       165 ~~~~~~~~~~~~~~~~~~~~~~LdkFg~DLTe~AreGKLDPVIGRd~EI~riiqIL~RR~KNn~~lvG~~gvGktaive~  244 (798)
T Consensus       542 --d----------------iGGlee~kq~lreaveW----Pl--k~~---~~f~k~G~~PP~Gvll~GPPGtGktllaka  594 (980)
T TIGR01243       542 --D----------------IGGLEEVKQELREAVEW----PL--KAP---EVFEKLGIRPPKGVLLFGPPGTGKTLLAKA  594 (980)
T ss_pred             --C----------------CCCHHHHHHHHHHHHHC----CC--CHH---HHHHHCCCCCCCCEEEECCCCCCHHHHHHH
T ss_conf             --1----------------46678999999877523----44--405---899860788997348746898616888887


Q ss_pred             HHHHHHCCCCCHHHHEEEEEEEEHHHHHCCCCCCCHHHHHHHHHHHHHCCCCCEEEEECCHHHHHCCCC-CCCCC--CC-
Q ss_conf             999985489883452014455404675306343123789999999872038983999736166301554-44344--77-
Q gi|254780163|r  245 FAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIESYANAILYIDEIHTLVGAGS-ASGIS--VD-  320 (798)
Q Consensus       245 la~~i~~~~vp~~l~~~~i~~ld~~~l~ag~~~rg~fe~r~~~~~~~~~~~~~~ilfideih~ligag~-~~g~~--~d-  320 (798)
T Consensus       595 va~es~a----------nfi~v~GPe~l--skWvGese~~ir~if~~arq~aP~~~f~deidaiaP~rG~~~~~~~vtd~  662 (980)
T TIGR01243       595 VATESGA----------NFIAVRGPEIL--SKWVGESEKAIREIFRKARQAAPAIIFFDEIDAIAPARGASLDEKGVTDR  662 (980)
T ss_pred             HHHCCCC----------CEEEECCCHHH--HHHHCHHHHHHHHHHHHHHHCCCEEEEEECHHHHCCCCCCCCCCCCHHHH
T ss_conf             7401456----------46774073122--34403247999999998641287378730211105412442100102689


Q ss_pred             HHHHHHHH----HCCCCEEEEEECCHHHHHHHHHCCHHHHH--HCEE-EEECCCCHHHHHHHHH
Q ss_conf             78888766----30266038873048999998520111432--0014-4306878689999998
Q gi|254780163|r  321 ASNLLKPA----LSSGAVRCIGSTTYSEYRQFFEKDKALVR--RFQK-IDVSEPSIEDAIEIVK  377 (798)
Q Consensus       321 ~an~lkP~----L~rg~~~~IgatT~~ey~~~~e~d~al~r--rF~~-i~v~ep~~~~~~~iL~  377 (798)
T Consensus       663 ~~nqll~e~dG~~~~~~vvvi~atnrPd-----i~dPallrPGr~dr~i~vP~Pd~~ar~~ifk  721 (980)
T TIGR01243       663 IVNQLLTELDGLEELSDVVVIAATNRPD-----ILDPALLRPGRLDRLILVPAPDEEARLEIFK  721 (980)
T ss_pred             HHHHHHHHHHCCCCCCCEEEEEECCCCC-----CCCCCCCCCCCCCEEEEECCCCHHHHHHHHH
T ss_conf             9999998640443436658986158874-----2361004887412168605985567676765