HHsearch alignment for GI: 254780163 and conserved domain: TIGR02639

>TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit ClpA; InterPro: IPR013461 Proteins in this entry are related to ClpA () from Escherichia coli. ClpA is an ATP-dependent chaperone and part of the ClpAP protease that participates in regulatory protein degradation and the dissolution and degradation of protein aggregates . ClpA recognises sequences in specific proteins, which it then unfolds in an ATP-dependent manner and transports into the degradation chamber of the associated ClpP protein , . A small adaptor-like protein, ClpS, modulates the activity of ClpA and is an important regulatory factor for this protein . It protects ClpA from autodegradation and appears to redirect its activity away from soluble proteins and toward aggregated proteins..
Probab=97.74  E-value=0.00013  Score=52.22  Aligned_cols=175  Identities=23%  Similarity=0.387  Sum_probs=110.8

Q ss_pred             HHCHHHHHHHHHHHHHHHHCCCCCCCCCCCEEEEECCCCHHHHHHHHHHH----HH-C------CCCEEEEEHHHHHCCC
Q ss_conf             53458999999999877520445657874068861432003889999987----30-4------7733772068861246
Q gi|254780163|r  479 VYGQEEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLA----FA-L------GVQLLRFDMSEYMERH  547 (798)
Q Consensus       479 v~GQ~~ai~~v~~~i~~~~~gl~~~~rP~g~flf~GptGvGKTelak~la----~~-~------~~~lir~dmsey~e~~  547 (798)
T Consensus       210 LIGRE~EleRtiQvLCR-----R~KNNP----l~VGEPGVGKTAI~EGLA~~I~~~~kvPe~Lkn~~IY~LDmG~L----  276 (774)
T TIGR02639       210 LIGREDELERTIQVLCR-----RKKNNP----LLVGEPGVGKTAIVEGLAQRIAEGQKVPEVLKNAKIYSLDMGTL----  276 (774)
T ss_pred             CCCCHHHHHHHHHHHCC-----CCCCCC----CEECCCCCCHHHHHHHHHHHHHCCCCCCHHHCCCCEEEECHHHH----
T ss_conf             34566887423332034-----567887----20448886448999999998641564670024783454043456----


Q ss_pred             CCCHHCCCCCHHCC-CCCC-CCCCHHHHHCCCE-EEEECCHHH---------CCHHHHHHHHHHHHHHHCCCCCCCEECC
Q ss_conf             53011047800025-6444-3100355515851-777404455---------0289999999987775021779977612
Q gi|254780163|r  548 AVSRLIGAPPGYVG-FGQG-GILADSVDQNPYS-VVLLDEIEK---------SHPDVLNILLQIMDYGILTDQSGKKISF  615 (798)
Q Consensus       548 ~vs~LiGappGYvG-~~eg-g~Lte~vr~~P~s-Vvl~DEiEK---------Ah~~v~~~llqild~G~ltd~~Gr~vdf  615 (798)
T Consensus       277 ----LAGT--KYRGDFE~RLK~V~~Ei~~~~~anILFIDEIHTIVGAGATSGGsmDASNLLKPaL~~G~iR---------  341 (774)
T TIGR02639       277 ----LAGT--KYRGDFEERLKAVVSEIEKEPNANILFIDEIHTIVGAGATSGGSMDASNLLKPALASGKIR---------  341 (774)
T ss_pred             ----HHHC--CCCCHHHHHHHHHHHHHHCCCCCCEEEEECCCCEEECCCCCCHHHHHHHHHHHHHHCCCEE---------
T ss_conf             ----4102--4542478999999999852899954664110103317878751552443211253078778---------


Q ss_pred             CCEEEEEECCCCHHHHHHCCCCCCCCCCHHHHHHHHHHHCC--HHHHCCCCEEEECCCCCHHHHHHHHHHHHHHHHHHHH
Q ss_conf             54299994242145533036898821114889999987288--7881776828962889999999999999999999998
Q gi|254780163|r  616 RNVILIMTTNAGALEMSKARIGFGSSRNDDADKEALRNFLS--PEFLNRLDSIIPFFPLSSDIIRQVVHKFIMKLELQLQ  693 (798)
Q Consensus       616 ~n~iii~TsN~G~~~~~~~~~g~~~~~~~~~~~~~l~~~f~--peflnRid~ii~F~~l~~~~~~~i~~~~l~~l~~~l~  693 (798)
T Consensus       342 --C-------IGsTTy-----------------~EY~~~FeKDrALsRRFQKID-v~EPs~eet~~I----LkGLk~~YE  390 (774)
T TIGR02639       342 --C-------IGSTTY-----------------EEYKNHFEKDRALSRRFQKID-VGEPSIEETVKI----LKGLKEQYE  390 (774)
T ss_pred             --E-------ECCCCH-----------------HHHHCHHHCCCCCCCCCCEEC-CCCCCHHHHHHH----HHHHHHHHH
T ss_conf             --6-------226524-----------------864111010202165423311-795788899999----986554201


Q ss_pred             HCCCEEEECHHHHHHHHHCC
Q ss_conf             66988999889999999718
Q gi|254780163|r  694 EKGISFHFSEEVINWLVSHG  713 (798)
Q Consensus       694 ~~~i~l~~~~~~~~~l~~~~  713 (798)
T Consensus       391 ~fH-~V~Y~~eal~~Av~LS  409 (774)
T TIGR02639       391 EFH-HVKYSDEALEAAVELS  409 (774)
T ss_pred             CCC-CEECCHHHHHHHHHHH
T ss_conf             325-0113869999999998