HHsearch alignment for GI: 254780163 and conserved domain: TIGR02881

>TIGR02881 spore_V_K stage V sporulation protein K; InterPro: IPR014232 Proteins in this entry include the stage V sporulation protein K (SpoVK), a close homologue of the Rubisco expression protein CbbX (IPR000470 from INTERPRO), and are members of an ATPase family associated with various cellular activities. These proteins are strictly limited to bacterial endospore-forming species, but are not found universally among members of this group; they are missing from the Clostridium species..
Probab=98.05  E-value=0.00035  Score=49.19  Aligned_cols=207  Identities=20%  Similarity=0.339  Sum_probs=119.5

Q ss_pred             HHCHHHHHHHHHHH-------HHHHHCCCCCCCCCCCEEEEECCCCHHHHHHHHHHHH-HC------CCCEE---EEEHH
Q ss_conf             53458999999999-------8775204456578740688614320038899999873-04------77337---72068
Q gi|254780163|r  479 VYGQEEAIKKLSSS-------IKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAF-AL------GVQLL---RFDMS  541 (798)
Q Consensus       479 v~GQ~~ai~~v~~~-------i~~~~~gl~~~~rP~g~flf~GptGvGKTelak~la~-~~------~~~li---r~dms  541 (798)
T Consensus         8 ~vGL~~vK~~i~EiYA~i~i~~kR~~~GLk~~~~~L-HMiFKGNPGTGKTTVAR~~gklf~emnvL~KGH~iE~ERAD--   84 (261)
T TIGR02881         8 LVGLDEVKELIKEIYAWIQINEKRKEEGLKTSKQVL-HMIFKGNPGTGKTTVARLLGKLFKEMNVLSKGHLIEVERAD--   84 (261)
T ss_pred             CCCHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCEE-EEEEECCCCCCHHHHHHHHHHHHHHCCCCCCCCEEEEEECC--
T ss_conf             048889999999999999998888751011488447-87742786684389999999998533756788678876222--


Q ss_pred             HHHCCCCCCHHCCCCCHHCCCCCCCCCC-HHHHHCCCEEEEECCH-------HHC-CHHHHHHHHHHHHHHHCCCCCCCE
Q ss_conf             8612465301104780002564443100-3555158517774044-------550-289999999987775021779977
Q gi|254780163|r  542 EYMERHAVSRLIGAPPGYVGFGQGGILA-DSVDQNPYSVVLLDEI-------EKS-HPDVLNILLQIMDYGILTDQSGKK  612 (798)
Q Consensus       542 ey~e~~~vs~LiGappGYvG~~egg~Lt-e~vr~~P~sVvl~DEi-------EKA-h~~v~~~llqild~G~ltd~~Gr~  612 (798)
T Consensus        85 ----------LVGE---YIGHTA--qkTRe~~kkA~GGvLFiDEAYSLaRGGEKDFGKEAIDtLVK~mEd~-----~---  141 (261)
T TIGR02881        85 ----------LVGE---YIGHTA--QKTREVIKKALGGVLFIDEAYSLARGGEKDFGKEAIDTLVKAMEDQ-----R---  141 (261)
T ss_pred             ----------CCCC---CCCCHH--HHHHHHHHHHCCCCHHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHC-----C---
T ss_conf             ----------1223---203004--8999999986388005577777614888876620888999987615-----6---


Q ss_pred             ECCCCEEEEEECCCCHHHHHHCCCCCCCCCCHHHHHHHHHHHCCHHHHCCCCEEEECCCCCHHHHHHHHHHHHHHHHHHH
Q ss_conf             61254299994242145533036898821114889999987288788177682896288999999999999999999999
Q gi|254780163|r  613 ISFRNVILIMTTNAGALEMSKARIGFGSSRNDDADKEALRNFLSPEFLNRLDSIIPFFPLSSDIIRQVVHKFIMKLELQL  692 (798)
Q Consensus       613 vdf~n~iii~TsN~G~~~~~~~~~g~~~~~~~~~~~~~l~~~f~peflnRid~ii~F~~l~~~~~~~i~~~~l~~l~~~l  692 (798)
T Consensus       142 ---~~lvlILA-------------GY~------~EM~yF-L~~NPGL~SRFPi~i~FPdY~~eeL~~Ia~~m~~~ReY~L  198 (261)
T TIGR02881       142 ---NELVLILA-------------GYS------DEMDYF-LSLNPGLRSRFPISIDFPDYTVEELMEIAERMVKEREYKL  198 (261)
T ss_pred             ---CCEEEEEE-------------CCH------HHHHHH-HHCCCCCCCCCCCEEECCCCCHHHHHHHHHHHHHHHHHCC
T ss_conf             ---98689970-------------876------899998-6207797776650541889988899999999986464225


Q ss_pred             HHCCCEEEECHHHHHHHHHCCC--C-CCCCCHHHHHHHHHHHHHHHHHHH
Q ss_conf             8669889998899999997189--8-101532679999986235999999
Q gi|254780163|r  693 QEKGISFHFSEEVINWLVSHGY--D-VKMGARPLERIIKEHVKVPLADEI  739 (798)
Q Consensus       693 ~~~~i~l~~~~~~~~~l~~~~~--~-~~~GAR~l~r~i~~~i~~~la~~i  739 (798)
T Consensus       199 -----t~~A~~~lr~~l~~~~~~~~~~~sNaR~vRN~iE~AIR~QAvRlL  243 (261)
T TIGR02881       199 -----TEEAKWKLREHLAKVDQLSSREFSNARYVRNIIEKAIRRQAVRLL  243 (261)
T ss_pred             -----CHHHHHHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHHHHHHHH
T ss_conf             -----788999999997412444210057620124288999999998764