HHsearch alignment for GI: 254780163 and conserved domain: TIGR02902

>TIGR02902 spore_lonB ATP-dependent protease LonB; InterPro: IPR014251 This entry represents LonB, a paralog of the ATP-dependent protease La (LonA, IPR004815 from INTERPRO). LonB proteins are unassigned peptidases belonging to the MEROPS peptidase family S16 (lon protease family, clan SJ) and are found strictly, and almost universally, in endospore-forming bacteria. This protease was shown, in Bacillus subtilis, to be expressed specifically in the forespore during sporulation, under control of sigmaF . The lonB gene, despite being located immediately upstream of lonA, was shown to be monocistronic. LonB appears to be involved in the post-translation control of sigmaH, but lonB mutation did not produce an obvious sporulation defect under the conditions tested . Note that additional paralogs of LonA and LonB occur in the Clostridium lineage and these are excluded from this entry. .
Probab=99.22  E-value=1.7e-10  Score=94.63  Aligned_cols=205  Identities=26%  Similarity=0.484  Sum_probs=132.1

Q ss_pred             HHHHCHHHHHHHHHHHHHHHHCCCCCCCCCCCEEEEECCCCHHHHHHHHHH---H-------HHCCCCEEEEEHH--HHH
Q ss_conf             665345899999999987752044565787406886143200388999998---7-------3047733772068--861
Q gi|254780163|r  477 TVVYGQEEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQL---A-------FALGVQLLRFDMS--EYM  544 (798)
Q Consensus       477 ~~v~GQ~~ai~~v~~~i~~~~~gl~~~~rP~g~flf~GptGvGKTelak~l---a-------~~~~~~lir~dms--ey~  544 (798)
T Consensus        65 ~EIiGQe~GI~A-------LKAALCGPN-PQHVIiY-GPPGVGKTAAARLVLeeAKk~~~SPFke~A~FVEiDATT~RFD  135 (532)
T TIGR02902        65 DEIIGQEEGIKA-------LKAALCGPN-PQHVIIY-GPPGVGKTAAARLVLEEAKKNPASPFKEEAAFVEIDATTARFD  135 (532)
T ss_pred             CCCCCCHHHHHH-------HHHHCCCCC-CCEEEEE-CCCCCCHHHHHHHHHHHHHCCCCCCCCCCCEEEEEECCCCCCC
T ss_conf             325673556899-------998606868-9638987-8869617899999999865087537898866898505103602


Q ss_pred             CCCCCCHHCCC--CCHHCCCCCCCC------CCHHHHHCCCEEEEECCHHHCCHHHHHHHHHHHHHHHCCCCCCCEECCC
Q ss_conf             24653011047--800025644431------0035551585177740445502899999999877750217799776125
Q gi|254780163|r  545 ERHAVSRLIGA--PPGYVGFGQGGI------LADSVDQNPYSVVLLDEIEKSHPDVLNILLQIMDYGILTDQSGKKISFR  616 (798)
Q Consensus       545 e~~~vs~LiGa--ppGYvG~~egg~------Lte~vr~~P~sVvl~DEiEKAh~~v~~~llqild~G~ltd~~Gr~vdf~  616 (798)
T Consensus       136 ERGIADPLIGSVHDPIYQGAGplG~AGIPQPK~GAVT~AHGGvLFIDEIGELHP~~MNKLLKVLED--------RKVFLd  207 (532)
T TIGR02902       136 ERGIADPLIGSVHDPIYQGAGPLGVAGIPQPKPGAVTKAHGGVLFIDEIGELHPVQMNKLLKVLED--------RKVFLD  207 (532)
T ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCEEEECCCCCCCHHHHHHHHHHHHC--------CCCHHH
T ss_conf             146666567761585333765457885575877763202586551212466582435314113302--------220000


Q ss_pred             CEEEEEECCCCHHHHHHCCCCCCCCCCHHHHHHHHHH-----------------HCCHHHHCCCCEEEECCCCCHHHHHH
Q ss_conf             4299994242145533036898821114889999987-----------------28878817768289628899999999
Q gi|254780163|r  617 NVILIMTTNAGALEMSKARIGFGSSRNDDADKEALRN-----------------FLSPEFLNRLDSIIPFFPLSSDIIRQ  679 (798)
Q Consensus       617 n~iii~TsN~G~~~~~~~~~g~~~~~~~~~~~~~l~~-----------------~f~peflnRid~ii~F~~l~~~~~~~  679 (798)
T Consensus       208 SAYY~-s~~---------------pniP~hI~dIFqnGlPADFRLiGATTR~PeEIpPAlRSRC~EIF-FR~L~~EEi~~  270 (532)
T TIGR02902       208 SAYYS-SED---------------PNIPSHIRDIFQNGLPADFRLIGATTRNPEEIPPALRSRCVEIF-FRPLLKEEIKE  270 (532)
T ss_pred             CCCCC-CCC---------------CCCCHHHHHHHCCCCCCCEECCCCCCCCCCCCCHHHHCCCEEEE-ECCCCHHHHHH
T ss_conf             12358-777---------------86542789972067873401213336987767834650522677-16888789999


Q ss_pred             HHHHHHHHHHHHHHHCCCEEEECHHHHHHHHHCCCCCCCCCHHHHHHHH
Q ss_conf             9999999999999866988999889999999718981015326799999
Q gi|254780163|r  680 VVHKFIMKLELQLQEKGISFHFSEEVINWLVSHGYDVKMGARPLERIIK  728 (798)
Q Consensus       680 i~~~~l~~l~~~l~~~~i~l~~~~~~~~~l~~~~~~~~~GAR~l~r~i~  728 (798)
T Consensus       271 iAk~Aa---------eKIg~~l~~~Al~~I~~Ya~n---G-REAvN~~Q  306 (532)
T TIGR02902       271 IAKNAA---------EKIGLNLEKEALDLIAKYASN---G-REAVNLVQ  306 (532)
T ss_pred             HHHHHH---------HHCCCCCCHHHHHHHHHHHCC---C-CHHHHHHH
T ss_conf             987656---------530465475479999987405---4-06778999