HHsearch alignment for GI: 254780163 and conserved domain: TIGR03345

>TIGR03345 VI_ClpV1 type VI secretion ATPase, ClpV1 family. Members of this protein family are homologs of ClpB, an ATPase associated with chaperone-related functions. These ClpB homologs, designated ClpV1, are a key component of the bacterial pathogenicity-associated type VI secretion system.
Probab=99.38  E-value=1.1e-09  Score=88.69  Aligned_cols=64  Identities=19%  Similarity=0.223  Sum_probs=58.8

Q ss_pred             CCHHHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHCCCCHHHHHHHHCCCCHHHHHHHHHHHCC
Q ss_conf             6989999999999999980998125999878787377429999999849998999999983000
Q gi|254780163|r   82 PTSSFQRVVQRAVLHVQSTGRGIVTGANILVALFSEPDSHATYFLQEQEMTLYDAVNFISHGIS  145 (798)
Q Consensus        82 ~S~~l~rVL~~A~~~A~~~G~~~I~~eHLLLALL~e~ds~a~~iL~~~gis~~~v~~~i~~~~~  145 (798)
T Consensus         1 Lt~~~~~aL~~A~~~A~~~~H~~I~~eHLLlaLl~~~~~~~~~iL~~~gvd~~~l~~~l~~~l~   64 (852)
T TIGR03345         1 LNPTSRRALEQAAALCVARGHPEVELEHWLLALLDQPDSDLAAILRHFGVDLGRLKADLARALD   64 (852)
T ss_pred             CCHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHCCCCCHHHHHHHHCCCCHHHHHHHHHHHHH
T ss_conf             9889999999999999985998138999999998399747999999869999999999999996