HHsearch alignment for GI: 254780163 and conserved domain: TIGR03346

>TIGR03346 chaperone_ClpB ATP-dependent chaperone ClpB. Members of this protein family are the bacterial ATP-dependent chaperone ClpB. This protein belongs to the AAA family, ATPases associated with various cellular activities (pfam00004). This molecular chaperone does not act as a protease, but rather serves to disaggregate misfolded and aggregated proteins.
Probab=100.00  E-value=0  Score=1859.72  Aligned_cols=725  Identities=42%  Similarity=0.701  Sum_probs=676.2

Q ss_pred             CCHHHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHCHH--HHHHHHHCCCCHHHHHHHHHHHHHHCCCCCCCCCCCCCCC
Q ss_conf             43899999999999999828995119999999820746--8999998599989999999999641365457788867764
Q gi|254780163|r    4 FSENLEKVLHQALVLANERNHEYATLEHLLLALIDDSD--AAIVMLSCNVDLKVLKNNLLNYIDNDSSNKLKNGFRVECK   81 (798)
Q Consensus         4 fS~~a~~vL~~A~~lAk~~~H~~Vt~EHLLLaLL~d~~--~~~iL~~~giD~~~Lk~~Le~~L~~~~~~~~~~~~~~ei~   81 (798)
T Consensus         1 ft~~a~~aL~~A~~~A~~~~h~~V~~eHlLlaLl~~~~~~~~~~L~~~gvd~~~l~~~l~~~l~~~~~~---~~~~~~~~   77 (852)
T TIGR03346         1 FTEKFQEALQAAQSLALGRDHQQIEPEHLLKALLDQEGGLARRLLQKAGVNVGALRQALEKELEKLPKV---SGPGGQVY   77 (852)
T ss_pred             CCHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHCCCCCHHHHHHHHCCCCHHHHHHHHHHHHHHCCCC---CCCCCCCC
T ss_conf             988999999999999998599902799999999739984799999985989999999999999737988---89988828


Q ss_pred             CCHHHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHCCCCHHHHHHHHCCCCHHHHHHHHHHHCCCCHHHHHHHHHCCCCC
Q ss_conf             69899999999999999809981259998787873774299999998499989999999830000000111211024432
Q gi|254780163|r   82 PTSSFQRVVQRAVLHVQSTGRGIVTGANILVALFSEPDSHATYFLQEQEMTLYDAVNFISHGISKRKEFANFQSKLNVDG  161 (798)
Q Consensus        82 ~S~~l~rVL~~A~~~A~~~G~~~I~~eHLLLALL~e~ds~a~~iL~~~gis~~~v~~~i~~~~~~~~~~~~~~~~~~~~~  161 (798)
T Consensus        78 ~s~~~~~vL~~A~~~a~~~~~~~I~~~hlLlall~~~~~-~~~~l~~~gi~~~~l~~~l~~~~~~~--------------  142 (852)
T TIGR03346        78 LSPELNRLLNLAEKLAQKRGDEFISSEHLLLALLDDKGT-LGKLLKEAGATADALEAAINAVRGGQ--------------  142 (852)
T ss_pred             CCHHHHHHHHHHHHHHHHCCCCEECHHHHHHHHHCCCCH-HHHHHHHCCCCHHHHHHHHHHHHCCC--------------
T ss_conf             698999999999999998499977399999999709855-99999986999999999999871788--------------


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHCCCCCCEEEECCCCCHHHHH
Q ss_conf             10000012444444455554455303565442588775486112221789999999986226778748966764116689
Q gi|254780163|r  162 SSAGSDGEGFVNDYQAKTDLNLFPALSAYCVDLTEKVKKGKVDILVGRHEEINRTIQILCRRSKNNPLYVGDPGVGKTAI  241 (798)
Q Consensus       162 ~~~~~~~~~~~~~~~~~~~~~~~~~LdkFg~DLTe~AreGKLDPVIGRd~EI~riiqIL~RR~KNn~~lvG~~gvGktai  241 (798)
T Consensus       143 ------------~~~~~~~~~~~~~L~~y~~dLT~~A~~gklDpviGRd~Ei~r~i~IL~Rr~KNNpiLVGepGVGKTAI  210 (852)
T TIGR03346       143 ------------KVTSANAEDQYEALEKYARDLTERAREGKLDPVIGRDEEIRRTIQVLSRRTKNNPVLIGEPGVGKTAI  210 (852)
T ss_pred             ------------CCCCCCCCCCHHHHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHHHHHHCCCCCCEECCCCCCHHHH
T ss_conf             ------------88888875435789999888999998289997738369999999999873248972127999879999


Q ss_pred             HHHHHHHHHCCCCCHHHHEEEEEEEEHHHHHCCCCCCCHHHHHHHHHHHHHCCC-CCEEEEECCHHHHHCCCCCCCCCCC
Q ss_conf             999999985489883452014455404675306343123789999999872038-9839997361663015544434477
Q gi|254780163|r  242 AEGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIESY-ANAILYIDEIHTLVGAGSASGISVD  320 (798)
Q Consensus       242 ve~la~~i~~~~vp~~l~~~~i~~ld~~~l~ag~~~rg~fe~r~~~~~~~~~~~-~~~ilfideih~ligag~~~g~~~d  320 (798)
T Consensus       211 vEGLA~rI~~g~VP~~L~~~~i~~LDlg~LvAGtkyRGeFEeRlk~ii~ev~~~~~~iILFIDEiHtliGaG~~~G-~~D  289 (852)
T TIGR03346       211 VEGLAQRIVNGDVPESLKNKRLLALDMGALIAGAKYRGEFEERLKAVLNEVTKSEGQIILFIDELHTLVGAGKAEG-AMD  289 (852)
T ss_pred             HHHHHHHHHCCCCCHHHHHCCCEEEEHHHHHCCCCCCHHHHHHHHHHHHHHHHCCCCEEEEEHHHHHHCCCCCCCC-CCC
T ss_conf             9999999866999978851851275288775215300789999999999998589987999612555326887666-410


Q ss_pred             HHHHHHHHHCCCCEEEEEECCHHHHHHHHHCCHHHHHHCEEEEECCCCHHHHHHHHHHHHHHHHHHCCCEECCHHHHHHH
Q ss_conf             78888766302660388730489999985201114320014430687868999999861276654103512111789999
Q gi|254780163|r  321 ASNLLKPALSSGAVRCIGSTTYSEYRQFFEKDKALVRRFQKIDVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAV  400 (798)
Q Consensus       321 ~an~lkP~L~rg~~~~IgatT~~ey~~~~e~d~al~rrF~~i~v~ep~~~~~~~iL~~~~~~ye~~h~v~~~~~al~~av  400 (798)
T Consensus       290 AaNlLKPaLarGelr~IgATT~~EYrk~iEkD~AL~RRFq~I~V~EPs~e~t~~IL~gl~~~yE~hH~V~i~d~Ai~aav  369 (852)
T TIGR03346       290 AGNMLKPALARGELHCIGATTLDEYRKYIEKDAALERRFQPVFVDEPTVEDTISILRGLKERYEVHHGVRITDPAIVAAA  369 (852)
T ss_pred             HHHHHHHHHHCCCCEEEEECCHHHHHHHHHCCHHHHHHCCCCCCCCCCHHHHHHHHHHHHHHHHHCCCCEECHHHHHHHH
T ss_conf             67774378747985599827899999883226889973771204799868999999976999976279267399999999


Q ss_pred             HHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHH----------------------------------------------
Q ss_conf             9865420155564679889986533332114432----------------------------------------------
Q gi|254780163|r  401 QLSVRHFTSRKLPDKAIDVIDEAGASQILQPLSK----------------------------------------------  434 (798)
Q Consensus       401 ~ls~ryi~~r~lPdkAidllDea~a~~~~~~~~~----------------------------------------------  434 (798)
T Consensus       370 ~LS~RYi~~R~LPDKAIDlLDeA~a~~~~~~~~~p~~l~~~~~~~~~l~~e~~~l~~e~d~~~~~~~~~~~~~~~~l~~~  449 (852)
T TIGR03346       370 TLSHRYITDRFLPDKAIDLIDEAAARIRMEIDSKPEELDELDRRIIQLEIEREALKKEKDEASKERLEDLEKELAELEEE  449 (852)
T ss_pred             HHHCCCCCCCCCCHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHCHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             97134667788961899999999998876237894679999999999999999998443066799999999999999999


Q ss_pred             --------------------------------------------------------------------------HHCCCC
Q ss_conf             --------------------------------------------------------------------------211365
Q gi|254780163|r  435 --------------------------------------------------------------------------RRKFIT  440 (798)
Q Consensus       435 --------------------------------------------------------------------------~~~~~~  440 (798)
T Consensus       450 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~V~  529 (852)
T TIGR03346       450 YADLEEQWKAEKAAIQGIQQIKEEIEQVRLELEQAEREGDLAKAAELQYGKLPELEKRLQAAEAKLGEETKPRLLREEVT  529 (852)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCC
T ss_conf             99999999999999999999999999999889999875047777775432279999999999987641123442336679


Q ss_pred             HHHHHHHHHHCCCCCCHHHHHCCHHHHHHHHCCHHHHHHHCHHHHHHHHHHHHHHHHCCCCCCCCCCCEEEEECCCCHHH
Q ss_conf             78999866310245310111001123342100002466534589999999998775204456578740688614320038
Q gi|254780163|r  441 EKDIKKTIASMNRSIHTTSFSRDDDSVLSNLEKNLGTVVYGQEEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGK  520 (798)
Q Consensus       441 ~~~i~~~~~~~~~gip~~~~~~~~~~~l~~l~~~l~~~v~GQ~~ai~~v~~~i~~~~~gl~~~~rP~g~flf~GptGvGK  520 (798)
T Consensus       530 ~~~ia~vvs~~t-gIPv~~~~~~e~~~L~~Le~~L~~rViGQd~AI~~I~~aI~~sraGL~dp~rP~GsFlf~GptGvGK  608 (852)
T TIGR03346       530 AEEIAEVVSRWT-GIPVSKMLEGEREKLLHMEEVLHERVVGQDEAVEAVSDAIRRSRAGLSDPNRPIGSFLFLGPTGVGK  608 (852)
T ss_pred             HHHHHHHHHHHH-CCCHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHCCCCCCCCCCEEEEEECCCCCCH
T ss_conf             999999999996-8866766654799998788889989717099999999999999718888999745899867887768


Q ss_pred             HHHHHHHH---HHCCCCEEEEEHHHHHCCCCCCHHCCCCCHHCCCCCCCCCCHHHHHCCCEEEEECCHHHCCHHHHHHHH
Q ss_conf             89999987---304773377206886124653011047800025644431003555158517774044550289999999
Q gi|254780163|r  521 TEISKQLA---FALGVQLLRFDMSEYMERHAVSRLIGAPPGYVGFGQGGILADSVDQNPYSVVLLDEIEKSHPDVLNILL  597 (798)
Q Consensus       521 Telak~la---~~~~~~lir~dmsey~e~~~vs~LiGappGYvG~~egg~Lte~vr~~P~sVvl~DEiEKAh~~v~~~ll  597 (798)
T Consensus       609 TELAKaLAe~Lfg~~~~LIriDMSEy~E~hsvsrLiGaPPGYVGy~egG~Lte~vr~~PysVvL~DEIEKAh~~V~~~lL  688 (852)
T TIGR03346       609 TELAKALAEFLFDDEDAMVRIDMSEYMEKHSVARLIGAPPGYVGYEEGGQLTEAVRRKPYSVVLFDEVEKAHPDVFNVLL  688 (852)
T ss_pred             HHHHHHHHHHHHCCCCCEEEECHHHHCCHHHHHHHCCCCCCCCCCCCCCEECHHHHHCCCEEEEECCHHHHCHHHHHHHH
T ss_conf             99999999998558520698430443012247785589997677687874239898198879985305430768999999


Q ss_pred             HHHHHHHCCCCCCCEECCCCEEEEEECCCCHHHHHHCCCCCCCCCCHHHHHHHHHHHCCHHHHCCCCEEEECCCCCHHHH
Q ss_conf             98777502177997761254299994242145533036898821114889999987288788177682896288999999
Q gi|254780163|r  598 QIMDYGILTDQSGKKISFRNVILIMTTNAGALEMSKARIGFGSSRNDDADKEALRNFLSPEFLNRLDSIIPFFPLSSDII  677 (798)
Q Consensus       598 qild~G~ltd~~Gr~vdf~n~iii~TsN~G~~~~~~~~~g~~~~~~~~~~~~~l~~~f~peflnRid~ii~F~~l~~~~~  677 (798)
T Consensus       689 QilD~G~ltD~~Gr~vdF~NtiiimTSN~Ga~~i~~~~~~~~~~~~~~~~~~~~~~~F~PEflnRid~ii~F~~L~~~~l  768 (852)
T TIGR03346       689 QVLDDGRLTDGQGRTVDFRNTVIIMTSNLGSQFIQELAGGDDYEEMREAVMEVLRAHFRPEFLNRIDEIVVFHPLGREQI  768 (852)
T ss_pred             HHHCCCEEECCCCCEEEEEEEEEEEECCCCHHHHHHHCCCCCHHHHHHHHHHHHHHHCCHHHHHHCCEEEEECCCCHHHH
T ss_conf             88236743079998885355689861540659997411455579999999999996589989963786898378999999


Q ss_pred             HHHHHHHHHHHHHHHHHCCCEEEECHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHHHHHHHHHCCCCCCCCEEEEEEEEC
Q ss_conf             99999999999999986698899988999999971898101532679999986235999999629676888489999607
Q gi|254780163|r  678 RQVVHKFIMKLELQLQEKGISFHFSEEVINWLVSHGYDVKMGARPLERIIKEHVKVPLADEILFGKLKKGGGVVKVSLNP  757 (798)
Q Consensus       678 ~~i~~~~l~~l~~~l~~~~i~l~~~~~~~~~l~~~~~~~~~GAR~l~r~i~~~i~~~la~~il~~~~~~g~~~~~v~~~~  757 (798)
T Consensus       769 ~~I~~~~l~~l~~~l~~~~i~l~~~~~~~~~l~~~g~~~~~GAR~l~r~i~~~i~~~la~~iL~g~~~~g~~-v~v~~~~  847 (852)
T TIGR03346       769 ARIVEIQLG