HHsearch alignment for GI: 254780163 and conserved domain: TIGR03346

>TIGR03346 chaperone_ClpB ATP-dependent chaperone ClpB. Members of this protein family are the bacterial ATP-dependent chaperone ClpB. This protein belongs to the AAA family, ATPases associated with various cellular activities (pfam00004). This molecular chaperone does not act as a protease, but rather serves to disaggregate misfolded and aggregated proteins.
Probab=99.43  E-value=2.4e-09  Score=86.36  Aligned_cols=65  Identities=18%  Similarity=0.187  Sum_probs=59.8

Q ss_pred             CCHHHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHCCCCHHHHHHHHCCCCHHHHHHHHHHHCCC
Q ss_conf             69899999999999999809981259998787873774299999998499989999999830000
Q gi|254780163|r   82 PTSSFQRVVQRAVLHVQSTGRGIVTGANILVALFSEPDSHATYFLQEQEMTLYDAVNFISHGISK  146 (798)
Q Consensus        82 ~S~~l~rVL~~A~~~A~~~G~~~I~~eHLLLALL~e~ds~a~~iL~~~gis~~~v~~~i~~~~~~  146 (798)
T Consensus         1 ft~~a~~aL~~A~~~A~~~~h~~V~~eHlLlaLl~~~~~~~~~~L~~~gvd~~~l~~~l~~~l~~   65 (852)
T TIGR03346         1 FTEKFQEALQAAQSLALGRDHQQIEPEHLLKALLDQEGGLARRLLQKAGVNVGALRQALEKELEK   65 (852)
T ss_pred             CCHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHCCCCCHHHHHHHHCCCCHHHHHHHHHHHHHH
T ss_conf             98899999999999999859990279999999973998479999998598999999999999973