Query         gi|254780163|ref|YP_003064576.1| ATP-dependent Clp protease ATP-binding subunit [Candidatus Liberibacter asiaticus str. psy62]
Match_columns 798
No_of_seqs    241 out of 3742
Neff          6.1 
Searched_HMMs 39220
Date          Mon May 23 14:02:18 2011
Command       /home/congqian_1/programs/hhpred/hhsearch -i 254780163.hhm -d /home/congqian_1/database/cdd/Cdd.hhm 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 TIGR02639 ClpA ATP-dependent C 100.0       0       0 2162.5  53.7  750    4-755     1-774 (774)
  2 CHL00095 clpC Clp protease ATP 100.0       0       0 1872.8  71.6  727    3-760     4-808 (823)
  3 PRK11034 clpA ATP-dependent Cl 100.0       0       0 1866.4  72.3  744    3-764     1-744 (758)
  4 PRK10865 protein disaggregatio 100.0       0       0 1860.1  71.6  727    1-760     1-853 (857)
  5 TIGR03346 chaperone_ClpB ATP-d 100.0       0       0 1859.7  70.7  725    4-761     1-851 (852)
  6 COG0542 clpA ATP-binding subun 100.0       0       0 1854.2  69.5  722    3-758     1-777 (786)
  7 TIGR03345 VI_ClpV1 type VI sec 100.0       0       0 1848.7  67.6  729    4-756     1-851 (852)
  8 KOG1051 consensus              100.0       0       0 1297.7  50.1  721    4-761    12-858 (898)
  9 pfam07724 AAA_2 AAA domain (Cd 100.0       0       0  409.4  11.0  162  505-666     1-168 (168)
 10 PRK05342 clpX ATP-dependent pr 100.0 7.7E-29   2E-33  226.4  20.2  268  470-758    65-396 (411)
 11 TIGR00382 clpX ATP-dependent C 100.0 7.2E-29 1.8E-33  226.6  13.8  278  453-758    87-441 (452)
 12 COG1219 ClpX ATP-dependent pro  99.9 2.1E-25 5.5E-30  201.7  17.5  271  470-758    54-385 (408)
 13 PRK05201 hslU ATP-dependent pr  99.9 4.1E-24 1.1E-28  192.4  17.5  240  470-733     8-404 (442)
 14 KOG0730 consensus               99.9 1.3E-21 3.3E-26  174.5  24.1  401  227-738   220-656 (693)
 15 KOG0733 consensus               99.9 1.4E-20 3.7E-25  167.0  25.3  452  202-743   188-742 (802)
 16 KOG0745 consensus               99.9 3.2E-22 8.1E-27  178.9  16.7  231  509-758   228-525 (564)
 17 PRK10787 DNA-binding ATP-depen  99.9 2.2E-19 5.5E-24  158.5  20.3  293  407-743   258-563 (784)
 18 TIGR00763 lon ATP-dependent pr  99.9 1.4E-20 3.6E-25  167.0  13.6  315  386-741   322-667 (941)
 19 TIGR01243 CDC48 AAA family ATP  99.8 5.1E-18 1.3E-22  148.6  24.6  388  227-687   242-726 (980)
 20 COG0466 Lon ATP-dependent Lon   99.8 1.5E-17 3.8E-22  145.3  19.0  292  407-745   259-567 (782)
 21 COG0464 SpoVK ATPases of the A  99.8 2.8E-16 7.2E-21  136.1  21.0  429  217-739    10-467 (494)
 22 PRK13342 recombination factor   99.8 2.7E-17 6.9E-22  143.4  15.6  245  195-492     4-261 (417)
 23 CHL00195 ycf46 Ycf46; Provisio  99.8 3.4E-16 8.7E-21  135.5  18.9  304  289-688    74-408 (491)
 24 KOG0735 consensus               99.7 7.5E-14 1.9E-18  118.7  28.0  427  223-741   429-892 (952)
 25 KOG0741 consensus               99.7 4.5E-16 1.1E-20  134.7  14.7  358  216-624   247-648 (744)
 26 KOG0736 consensus               99.7 1.5E-14 3.7E-19  123.8  21.1  431  205-735   402-896 (953)
 27 KOG2170 consensus               99.7 1.1E-15 2.9E-20  131.7  14.6  222  466-711    71-317 (344)
 28 PRK13341 recombination factor   99.7 6.1E-16 1.5E-20  133.7  12.9  179  205-423    35-221 (726)
 29 PRK10923 glnG nitrogen regulat  99.7 6.7E-14 1.7E-18  119.0  22.5  351  296-732     3-369 (469)
 30 TIGR00390 hslU heat shock prot  99.7 1.9E-15 4.8E-20  130.2  13.3  266  471-757     6-442 (463)
 31 PRK11361 acetoacetate metaboli  99.7   3E-13 7.5E-18  114.4  23.8  348  297-732     5-374 (457)
 32 COG1220 HslU ATP-dependent pro  99.6 1.6E-14 4.1E-19  123.5  15.7  268  471-757     9-425 (444)
 33 KOG2004 consensus               99.6 2.5E-14 6.5E-19  122.1  16.6  297  401-742   342-652 (906)
 34 PRK10365 transcriptional regul  99.6 1.4E-12 3.6E-17  109.6  23.0  349  297-732     6-370 (441)
 35 pfam10431 ClpB_D2-small C-term  99.6 8.9E-15 2.3E-19  125.4  11.7   85  672-757     1-85  (89)
 36 CHL00181 cbbX CbbX; Provisiona  99.6 7.1E-13 1.8E-17  111.7  20.8  186  227-424    61-251 (287)
 37 PRK03992 proteasome-activating  99.6 3.7E-13 9.6E-18  113.7  18.5  217  204-452   132-374 (390)
 38 CHL00195 ycf46 Ycf46; Provisio  99.6 1.9E-12 4.8E-17  108.6  21.9  210  227-469   261-478 (491)
 39 pfam05496 RuvB_N Holliday junc  99.6 1.2E-13 3.2E-18  117.1  14.6  198  476-731    23-226 (234)
 40 pfam07728 AAA_5 AAA domain (dy  99.6 5.4E-15 1.4E-19  126.9   7.1  112  510-627     2-124 (139)
 41 pfam05496 RuvB_N Holliday junc  99.5 1.9E-13 4.9E-18  115.8  12.8  187  199-430    19-232 (234)
 42 COG2256 MGS1 ATPase related to  99.5 1.5E-13 3.9E-18  116.5  12.0  238  194-483    14-264 (436)
 43 CHL00176 ftsH cell division pr  99.5   1E-12 2.6E-17  110.5  15.8  223  202-457   175-423 (631)
 44 PRK10733 hflB ATP-dependent me  99.5 1.8E-12 4.7E-17  108.7  16.4  226  202-459   150-400 (644)
 45 PRK03992 proteasome-activating  99.5 7.3E-13 1.9E-17  111.6  13.8  197  479-734   134-353 (390)
 46 PRK13342 recombination factor   99.5 5.8E-13 1.5E-17  112.3  13.2  183  477-729    13-201 (417)
 47 PRK11608 pspF phage shock prot  99.5 7.4E-13 1.9E-17  111.6  13.6  226  474-731     3-237 (325)
 48 COG2204 AtoC Response regulato  99.5 1.4E-10 3.5E-15   95.2  24.1  347  297-731     5-371 (464)
 49 COG0714 MoxR-like ATPases [Gen  99.5 3.1E-13 7.9E-18  114.3   9.4  140  466-625    13-162 (329)
 50 PRK05022 anaerobic nitric oxid  99.5 4.5E-12 1.1E-16  105.9  14.8  215  477-732   186-417 (510)
 51 TIGR02903 spore_lon_C ATP-depe  99.5 3.9E-12 9.9E-17  106.4  14.0  258  367-711    61-384 (616)
 52 PRK11388 DNA-binding transcrip  99.4 6.3E-12 1.6E-16  104.9  14.4  219  478-731   326-551 (639)
 53 TIGR03346 chaperone_ClpB ATP-d  99.4 2.4E-09   6E-14   86.4  26.8   65   82-146     1-65  (852)
 54 CHL00181 cbbX CbbX; Provisiona  99.4 1.1E-10 2.8E-15   96.0  19.8  224  462-740     8-260 (287)
 55 cd00009 AAA The AAA+ (ATPases   99.4 2.3E-12 5.8E-17  108.0  11.1  146  481-670     2-150 (151)
 56 TIGR01241 FtsH_fam ATP-depende  99.4 1.4E-12 3.7E-17  109.5   9.6  231  203-467    58-316 (505)
 57 PRK13341 recombination factor   99.4 6.2E-12 1.6E-16  104.9  12.4   99    1-104     1-111 (726)
 58 PRK12402 replication factor C   99.4 1.3E-11 3.2E-16  102.7  13.2  204  195-422     6-229 (337)
 59 COG0464 SpoVK ATPases of the A  99.4 5.6E-11 1.4E-15   98.1  16.2  195  227-450   278-482 (494)
 60 PRK10820 DNA-binding transcrip  99.4 3.3E-11 8.4E-16   99.7  14.8  215  476-731   203-427 (513)
 61 TIGR03345 VI_ClpV1 type VI sec  99.4 1.1E-09 2.9E-14   88.7  22.1   64   82-145     1-64  (852)
 62 pfam00004 AAA ATPase family as  99.3 9.8E-12 2.5E-16  103.5  10.0  118  228-362     1-126 (131)
 63 PRK04195 replication factor C   99.3 1.7E-11 4.4E-16  101.7  10.9  180  195-405     5-195 (403)
 64 PRK10865 protein disaggregatio  99.3 7.3E-08 1.8E-12   75.7  29.2   66   81-146     5-70  (857)
 65 pfam07726 AAA_3 ATPase family   99.3 3.3E-12 8.3E-17  106.9   6.9  108  510-626     2-112 (131)
 66 CHL00176 ftsH cell division pr  99.3 5.6E-11 1.4E-15   98.0  12.8  162  476-686   176-361 (631)
 67 PRK06647 DNA polymerase III su  99.3 6.2E-11 1.6E-15   97.7  13.0  214  195-448     7-241 (560)
 68 PRK00411 cdc6 cell division co  99.3   2E-09   5E-14   86.9  20.6  228  205-452    31-283 (394)
 69 PRK10733 hflB ATP-dependent me  99.3 6.1E-11 1.5E-15   97.8  12.7  125  477-626   152-299 (644)
 70 COG1222 RPT1 ATP-dependent 26S  99.3 1.3E-10 3.3E-15   95.4  14.3  145  497-688   179-338 (406)
 71 PRK00440 rfc replication facto  99.3 6.4E-10 1.6E-14   90.4  17.7  194  195-423     7-206 (318)
 72 PRK07270 DNA polymerase III su  99.3 6.7E-11 1.7E-15   97.5  12.3  200  194-425     5-225 (557)
 73 PRK06674 DNA polymerase III su  99.3 1.9E-10 4.8E-15   94.3  14.6  213  196-448     8-241 (563)
 74 PRK05896 DNA polymerase III su  99.3 7.7E-11   2E-15   97.1  12.4  202  193-426     5-227 (613)
 75 COG1221 PspF Transcriptional r  99.3 2.3E-10 5.9E-15   93.6  14.8  224  471-732    72-307 (403)
 76 PRK06305 DNA polymerase III su  99.3 9.8E-11 2.5E-15   96.3  12.8  215  194-448     7-243 (462)
 77 pfam00004 AAA ATPase family as  99.3 1.2E-11   3E-16  102.9   7.4  115  510-670     1-130 (131)
 78 KOG2028 consensus               99.3 1.9E-10 4.8E-15   94.3  13.4  397  184-665   111-541 (554)
 79 PRK00080 ruvB Holliday junctio  99.3 8.8E-11 2.2E-15   96.6  11.7  223  202-475    23-272 (328)
 80 pfam01078 Mg_chelatase Magnesi  99.3 1.9E-10 4.9E-15   94.2  13.3  178  477-677     3-207 (207)
 81 CHL00095 clpC Clp protease ATP  99.3 1.6E-07   4E-12   73.2  28.1   65   81-145     4-68  (823)
 82 PRK07940 DNA polymerase III su  99.3 9.3E-11 2.4E-15   96.5  11.5  160  477-681     5-188 (395)
 83 PRK00440 rfc replication facto  99.3 6.6E-11 1.7E-15   97.5  10.8  173  477-714    16-193 (318)
 84 pfam00158 Sigma54_activat Sigm  99.3 2.9E-11 7.3E-16  100.1   8.4  159  479-668     1-166 (168)
 85 TIGR02928 TIGR02928 orc1/cdc6   99.3 2.1E-09 5.3E-14   86.8  17.8  318  205-567    18-377 (383)
 86 PRK00080 ruvB Holliday junctio  99.2 1.1E-09 2.7E-14   88.8  16.0  200  470-726    18-226 (328)
 87 TIGR02640 gas_vesic_GvpN gas v  99.2 6.2E-11 1.6E-15   97.7   9.3  130  482-626     3-160 (265)
 88 PRK09112 DNA polymerase III su  99.2 1.4E-10 3.6E-15   95.2  11.0  164  475-683    21-211 (352)
 89 COG1223 Predicted ATPase (AAA+  99.2 4.9E-10 1.3E-14   91.3  13.7  203  475-743   119-340 (368)
 90 COG2256 MGS1 ATPase related to  99.2   1E-10 2.6E-15   96.2  10.1  188  477-729    24-215 (436)
 91 PRK08451 DNA polymerase III su  99.2 2.3E-10 5.9E-15   93.6  11.6  215  194-448     4-239 (523)
 92 TIGR02902 spore_lonB ATP-depen  99.2 1.7E-10 4.3E-15   94.6  10.8  205  477-728    65-306 (532)
 93 PRK05563 DNA polymerase III su  99.2 2.8E-10 7.1E-15   93.0  11.7  199  196-426     8-227 (541)
 94 PRK12402 replication factor C   99.2 1.1E-09 2.9E-14   88.7  14.3  189  477-727    15-224 (337)
 95 KOG0738 consensus               99.2 3.4E-10 8.5E-15   92.5  11.5  222  199-450   207-468 (491)
 96 PRK00411 cdc6 cell division co  99.2 1.6E-09 4.1E-14   87.6  14.9  214  473-726    26-254 (394)
 97 PRK07471 DNA polymerase III su  99.2 3.5E-10 8.9E-15   92.3  11.3  161  476-681    16-207 (363)
 98 cd00009 AAA The AAA+ (ATPases   99.2 9.2E-11 2.3E-15   96.5   8.2  140  207-361     1-145 (151)
 99 PRK07764 DNA polymerase III su  99.2 1.4E-10 3.4E-15   95.3   8.9  200  194-425     5-227 (775)
100 KOG0740 consensus               99.2 3.8E-10 9.6E-15   92.1  11.0  160  227-409   188-358 (428)
101 PRK05564 DNA polymerase III su  99.2 2.2E-10 5.7E-15   93.7   9.8  153  477-683     4-163 (313)
102 PRK04195 replication factor C   99.2 1.1E-09 2.8E-14   88.8  12.7  186  477-729    14-203 (403)
103 PRK13407 bchI magnesium chelat  99.2 2.3E-09 5.8E-14   86.5  14.1  226  477-743     8-291 (334)
104 KOG0730 consensus               99.2 3.9E-09 9.8E-14   84.8  15.2  213  207-451   436-674 (693)
105 TIGR02903 spore_lon_C ATP-depe  99.2 1.7E-09 4.4E-14   87.3  13.1  232  198-463   149-442 (616)
106 PRK08853 DNA polymerase III su  99.1 1.3E-09 3.2E-14   88.3  11.9  198  197-426     9-227 (717)
107 PRK07133 DNA polymerase III su  99.1 2.1E-09 5.4E-14   86.7  12.9  201  194-426     8-226 (718)
108 TIGR00635 ruvB Holliday juncti  99.1 1.5E-09 3.8E-14   87.8  12.1  227  206-493     6-265 (305)
109 PRK06645 DNA polymerase III su  99.1 2.1E-09 5.3E-14   86.8  12.8  215  197-448    14-253 (507)
110 KOG0736 consensus               99.1 1.1E-09 2.8E-14   88.7  10.8   96  508-625   432-541 (953)
111 TIGR02902 spore_lonB ATP-depen  99.1 1.7E-09 4.3E-14   87.4  11.6  226  191-449    52-330 (532)
112 COG5271 MDN1 AAA ATPase contai  99.1 1.7E-09 4.3E-14   87.4  11.3  153  503-686  1542-1704(4600)
113 COG1222 RPT1 ATP-dependent 26S  99.1 7.9E-09   2E-13   82.6  14.3  214  207-452   154-393 (406)
114 PRK11034 clpA ATP-dependent Cl  99.1 2.8E-06 7.1E-11   64.3  29.1   62   82-145     2-63  (758)
115 PRK07399 DNA polymerase III su  99.1 5.1E-09 1.3E-13   83.9  12.7  163  475-683     2-193 (314)
116 PRK09862 putative ATP-dependen  99.1 6.5E-09 1.7E-13   83.2  13.0  225  478-728   192-466 (506)
117 PRK08691 DNA polymerase III su  99.1 3.2E-09 8.1E-14   85.4  11.3  198  196-426     8-227 (704)
118 TIGR02397 dnaX_nterm DNA polym  99.1 3.4E-09 8.7E-14   85.2  11.4  116  478-603    15-143 (363)
119 PRK07994 DNA polymerase III su  99.1 1.1E-09 2.8E-14   88.7   8.6  197  197-425     9-226 (643)
120 PRK07003 DNA polymerase III su  99.0 3.8E-09 9.6E-14   84.9  11.1  197  197-426     9-227 (816)
121 CHL00081 chlI Mg-protoporyphyr  99.0 8.3E-08 2.1E-12   75.3  17.8  227  477-743    12-302 (347)
122 COG3604 FhlA Transcriptional r  99.0 2.4E-08 6.1E-13   79.1  15.0  214  478-733   224-455 (550)
123 PRK05563 DNA polymerase III su  99.0 4.8E-08 1.2E-12   77.0  16.5   36  259-302   118-153 (541)
124 COG0542 clpA ATP-binding subun  99.0 3.4E-06 8.7E-11   63.7  25.9   62   82-145     2-63  (786)
125 KOG0731 consensus               99.0 2.5E-08 6.5E-13   78.9  14.6  158  203-377   310-492 (774)
126 pfam05621 TniB Bacterial TniB   99.0   2E-08   5E-13   79.7  14.0  220  213-446    46-284 (302)
127 TIGR01242 26Sp45 26S proteasom  99.0 2.5E-09 6.3E-14   86.2   9.2  210  208-450   126-362 (364)
128 TIGR03015 pepcterm_ATPase puta  99.0 6.9E-08 1.8E-12   75.8  16.5  223  209-451    27-266 (269)
129 PRK09111 DNA polymerase III su  99.0 1.2E-08 3.1E-13   81.2  12.5  211  197-448    16-253 (600)
130 TIGR01241 FtsH_fam ATP-depende  99.0 3.2E-10 8.2E-15   92.6   4.1  161  477-685    59-243 (505)
131 PRK07270 DNA polymerase III su  99.0 1.5E-07 3.9E-12   73.4  17.2   36  259-302   117-152 (557)
132 COG2255 RuvB Holliday junction  99.0 9.9E-08 2.5E-12   74.7  16.1  175  203-422    25-226 (332)
133 COG0465 HflB ATP-dependent Zn   99.0 2.7E-08 6.8E-13   78.8  13.0  339  202-612   148-513 (596)
134 PRK06305 DNA polymerase III su  99.0 5.8E-07 1.5E-11   69.2  19.7  128  477-625    17-159 (462)
135 KOG0734 consensus               99.0 1.3E-08 3.3E-13   81.1  11.3  153  200-377   300-481 (752)
136 KOG0989 consensus               99.0 4.3E-08 1.1E-12   77.3  13.5  187  194-404    26-221 (346)
137 TIGR03420 DnaA_homol_Hda DnaA   99.0 2.1E-07 5.4E-12   72.3  17.0  161  216-405    29-193 (226)
138 KOG0731 consensus               98.9 1.2E-08 3.1E-13   81.2  10.5  126  476-625   310-458 (774)
139 COG0714 MoxR-like ATPases [Gen  98.9 3.8E-08 9.6E-13   77.7  12.6  151  205-376    25-198 (329)
140 PRK08058 DNA polymerase III su  98.9 5.2E-08 1.3E-12   76.7  13.2   43  478-528     6-49  (329)
141 PRK05342 clpX ATP-dependent pr  98.9 6.4E-08 1.6E-12   76.1  13.2  170  224-405   108-359 (411)
142 PRK12323 DNA polymerase III su  98.9 2.7E-08   7E-13   78.7  11.3  197  197-426     9-232 (721)
143 PRK08451 DNA polymerase III su  98.9 5.2E-07 1.3E-11   69.5  17.6  123  477-626    14-156 (523)
144 PRK08853 DNA polymerase III su  98.9 5.7E-07 1.5E-11   69.2  17.8   19  314-332   210-228 (717)
145 COG0606 Predicted ATPase with   98.9 3.7E-08 9.5E-13   77.8  11.4  225  477-730   179-447 (490)
146 pfam01637 Arch_ATPase Archaeal  98.9 4.9E-07 1.3E-11   69.7  17.1  189  206-404     1-214 (223)
147 COG2255 RuvB Holliday junction  98.9 5.7E-08 1.5E-12   76.4  12.0  200  470-726    19-227 (332)
148 PRK07003 DNA polymerase III su  98.9 1.5E-06 3.7E-11   66.3  19.2   27  676-702   686-712 (816)
149 TIGR01817 nifA Nif-specific re  98.9 9.3E-08 2.4E-12   74.9  12.9  233  473-758   208-458 (574)
150 PRK06674 DNA polymerase III su  98.9 1.6E-06 4.1E-11   66.0  19.1   37  258-302   117-153 (563)
151 PRK06645 DNA polymerase III su  98.9 7.1E-07 1.8E-11   68.6  17.3  128  477-625    21-166 (507)
152 PRK06647 DNA polymerase III su  98.8 9.5E-07 2.4E-11   67.6  17.2  129  477-626    16-158 (560)
153 TIGR00635 ruvB Holliday juncti  98.8 2.9E-08 7.4E-13   78.5   9.4  192  477-725     4-204 (305)
154 KOG0727 consensus               98.8   2E-08 5.1E-13   79.7   8.4  135  498-680   184-333 (408)
155 COG3829 RocR Transcriptional r  98.8 5.8E-07 1.5E-11   69.2  15.8  214  477-731   245-476 (560)
156 COG1474 CDC6 Cdc6-related prot  98.8 3.2E-06 8.1E-11   63.9  19.4  229  206-450    19-264 (366)
157 PRK08691 DNA polymerase III su  98.8 4.2E-06 1.1E-10   63.0  19.7   40  255-302   114-153 (704)
158 PRK00149 dnaA chromosomal repl  98.8 2.9E-07 7.3E-12   71.4  13.5  155  226-402   145-308 (447)
159 COG1223 Predicted ATPase (AAA+  98.8 2.5E-07 6.4E-12   71.8  13.1  221  194-450   111-354 (368)
160 PRK05896 DNA polymerase III su  98.8 1.6E-06 4.2E-11   65.9  17.2  127  477-625    16-157 (613)
161 PRK07133 DNA polymerase III su  98.8 1.6E-06   4E-11   66.1  17.0   38  257-302   115-152 (718)
162 COG1474 CDC6 Cdc6-related prot  98.8 1.9E-07 4.8E-12   72.7  12.2  209  472-722    12-233 (366)
163 TIGR02928 TIGR02928 orc1/cdc6   98.8 3.8E-08 9.6E-13   77.7   8.7  220  473-731    11-265 (383)
164 KOG0739 consensus               98.8 7.8E-08   2E-12   75.5  10.1  133  225-376   166-308 (439)
165 pfam06068 TIP49 TIP49 C-termin  98.8 6.2E-07 1.6E-11   69.0  14.7  104  578-716   277-380 (395)
166 TIGR03420 DnaA_homol_Hda DnaA   98.8 5.8E-07 1.5E-11   69.2  14.4  157  510-729    41-204 (226)
167 pfam00493 MCM MCM2/3/5 family.  98.8   7E-07 1.8E-11   68.6  14.6  221  466-711    13-268 (327)
168 KOG0737 consensus               98.8 7.7E-07   2E-11   68.3  14.5  137  226-381   128-275 (386)
169 KOG0733 consensus               98.8 7.5E-08 1.9E-12   75.6   9.4  137  225-379   545-691 (802)
170 TIGR01242 26Sp45 26S proteasom  98.8 5.3E-08 1.3E-12   76.7   8.3  124  477-625   122-269 (364)
171 COG5271 MDN1 AAA ATPase contai  98.8 5.4E-07 1.4E-11   69.4  13.4  148  504-682   888-1044(4600)
172 PRK12422 chromosomal replicati  98.7 3.9E-07 9.9E-12   70.4  12.6  171  206-402   114-302 (455)
173 PRK10787 DNA-binding ATP-depen  98.7 1.2E-06 3.1E-11   66.8  15.1  178  206-405   324-537 (784)
174 PRK13407 bchI magnesium chelat  98.7 1.3E-06 3.3E-11   66.7  14.8  232  206-461    10-320 (334)
175 smart00382 AAA ATPases associa  98.7 2.5E-08 6.3E-13   79.0   6.0  116  508-626     3-125 (148)
176 pfam00308 Bac_DnaA Bacterial d  98.7 3.6E-07 9.1E-12   70.7  11.8  159  505-714    32-199 (219)
177 pfam06309 Torsin Torsin. This   98.7 4.1E-08   1E-12   77.5   6.8  106  466-582    14-127 (127)
178 PRK05648 DNA polymerase III su  98.7 2.4E-08 6.1E-13   79.1   5.4  197  197-426     9-227 (705)
179 TIGR00763 lon ATP-dependent pr  98.7 1.7E-07 4.4E-12   73.0   9.6  152  229-405   454-643 (941)
180 KOG0735 consensus               98.7 3.2E-07 8.2E-12   71.0  10.8   98  508-625   432-549 (952)
181 PRK08770 DNA polymerase III su  98.7 7.2E-08 1.8E-12   75.7   7.2  258  197-495     9-291 (663)
182 COG0593 DnaA ATPase involved i  98.7 3.4E-06 8.7E-11   63.6  15.1  209  226-465   113-345 (408)
183 PRK05648 DNA polymerase III su  98.7 2.5E-05 6.4E-10   57.4  19.5   39  256-302   115-153 (705)
184 KOG2028 consensus               98.6 8.2E-08 2.1E-12   75.3   6.5  213  435-714   110-327 (554)
185 PRK08084 DNA replication initi  98.6 3.7E-06 9.5E-11   63.4  15.0  187  206-423    25-216 (235)
186 CHL00081 chlI Mg-protoporyphyr  98.6 2.2E-06 5.5E-11   65.1  13.8  238  206-463    14-333 (347)
187 pfam07728 AAA_5 AAA domain (dy  98.6 2.7E-08   7E-13   78.7   4.0  116  227-359     1-139 (139)
188 PRK12377 putative replication   98.6 6.2E-07 1.6E-11   69.0  10.9  122  481-631    82-210 (248)
189 COG2812 DnaX DNA polymerase II  98.6 2.8E-07 7.1E-12   71.5   9.1  212  196-448     8-241 (515)
190 PRK07764 DNA polymerase III su  98.6 9.5E-06 2.4E-10   60.5  16.7  118  476-603    14-147 (775)
191 KOG0737 consensus               98.6 2.1E-07 5.4E-12   72.4   8.2  200  374-622    18-235 (386)
192 pfam00308 Bac_DnaA Bacterial d  98.6   3E-06 7.5E-11   64.1  14.0  191  213-428    19-217 (219)
193 PRK06872 DNA polymerase III su  98.6 1.5E-07 3.8E-12   73.4   7.3  196  198-426    10-227 (696)
194 PRK08770 DNA polymerase III su  98.6 4.4E-05 1.1E-09   55.7  19.6   40  255-302   114-153 (663)
195 KOG0732 consensus               98.6   6E-07 1.5E-11   69.1  10.0  140  227-378   301-449 (1080)
196 PRK13765 ATP-dependent proteas  98.6 1.7E-05 4.3E-10   58.6  17.0  141  299-449   229-398 (637)
197 KOG0729 consensus               98.6 8.4E-07 2.1E-11   68.0  10.3  133  227-376   213-357 (435)
198 KOG0738 consensus               98.6 6.2E-07 1.6E-11   69.0   9.6  108  479-601   214-341 (491)
199 PRK07994 DNA polymerase III su  98.6 6.8E-05 1.7E-09   54.3  20.0   40  255-302   114-153 (643)
200 pfam05673 DUF815 Protein of un  98.6 1.7E-05 4.3E-10   58.7  16.7  159  205-393    29-215 (248)
201 PRK08903 hypothetical protein;  98.6 5.3E-06 1.4E-10   62.3  14.0   45  355-403   142-189 (227)
202 PRK08116 hypothetical protein;  98.6 1.5E-06 3.8E-11   66.3  11.1  165  481-692    86-261 (262)
203 PRK12323 DNA polymerase III su  98.6 6.2E-05 1.6E-09   54.6  19.4   36  259-302   123-158 (721)
204 PRK05642 DNA replication initi  98.5 1.3E-05 3.3E-10   59.5  15.7  151  226-405    45-200 (234)
205 PRK13765 ATP-dependent proteas  98.5 2.7E-06   7E-11   64.3  12.2   49  200-250    27-75  (637)
206 PRK05564 DNA polymerase III su  98.5 1.3E-05 3.3E-10   59.5  15.7  184  203-422     3-193 (313)
207 COG1241 MCM2 Predicted ATPase   98.5   1E-05 2.7E-10   60.2  14.9  255  468-748   277-584 (682)
208 TIGR02397 dnaX_nterm DNA polym  98.5 1.3E-05 3.4E-10   59.4  15.5  207  202-448    12-241 (363)
209 PRK09111 DNA polymerase III su  98.5 2.4E-05 6.1E-10   57.6  16.7   43  256-306   127-172 (600)
210 PRK06872 DNA polymerase III su  98.5 9.4E-05 2.4E-09   53.3  19.6   36  259-302   118-153 (696)
211 TIGR02974 phageshock_pspF psp   98.5 2.1E-06 5.3E-11   65.2  11.0  219  479-733     1-232 (349)
212 KOG0728 consensus               98.5 8.3E-06 2.1E-10   60.9  14.1  141  505-689   180-335 (404)
213 PRK05642 DNA replication initi  98.5 7.3E-06 1.9E-10   61.3  13.8  185  474-730    17-212 (234)
214 TIGR01243 CDC48 AAA family ATP  98.5 1.1E-05 2.9E-10   59.9  14.7  304   11-377   401-721 (980)
215 PRK13531 regulatory ATPase Rav  98.5 1.7E-07 4.5E-12   72.9   5.2  257  186-490     6-317 (498)
216 PRK08181 transposase; Validate  98.5 1.1E-06 2.8E-11   67.1   9.2   70  223-305   104-176 (269)
217 PRK04132 replication factor C   98.5 1.1E-07 2.9E-12   74.3   4.1   55  196-250    17-71  (863)
218 COG1224 TIP49 DNA helicase TIP  98.5 2.2E-05 5.5E-10   57.9  15.3  115  578-733   293-407 (450)
219 PRK08769 DNA polymerase III su  98.5 3.6E-06 9.2E-11   63.5  11.1  180  213-424    13-213 (319)
220 TIGR00368 TIGR00368 Mg chelata  98.5 7.4E-08 1.9E-12   75.6   2.3  224  478-727   195-478 (505)
221 KOG0728 consensus               98.5   2E-06 5.2E-11   65.3   9.5  196  224-451   180-388 (404)
222 COG0466 Lon ATP-dependent Lon   98.4   1E-05 2.6E-10   60.2  13.0  177  207-405   326-539 (782)
223 COG3284 AcoR Transcriptional a  98.4 7.4E-06 1.9E-10   61.2  12.2  215  480-730   316-536 (606)
224 PRK13531 regulatory ATPase Rav  98.4 2.7E-05 6.9E-10   57.2  14.8  142  465-626     8-156 (498)
225 PRK08727 hypothetical protein;  98.4 2.8E-05 7.2E-10   57.1  14.7  141  510-714    44-195 (233)
226 PRK09183 transposase/IS protei  98.4 1.2E-06   3E-11   67.0   7.6   99  509-630   103-208 (258)
227 COG1484 DnaC DNA replication p  98.4 2.9E-06 7.3E-11   64.2   9.5  121  508-653   106-232 (254)
228 PRK06526 transposase; Provisio  98.4 1.2E-06 3.1E-11   66.9   7.5   69  224-305    97-168 (254)
229 PRK08727 hypothetical protein;  98.4   7E-05 1.8E-09   54.2  16.5  204  207-450    23-230 (233)
230 PRK05201 hslU ATP-dependent pr  98.4 7.3E-06 1.9E-10   61.3  11.4   55  224-289    49-104 (442)
231 PRK07952 DNA replication prote  98.4 1.8E-06 4.6E-11   65.7   8.2  124  481-633    77-208 (242)
232 KOG0651 consensus               98.4 1.9E-06 4.9E-11   65.4   8.4  157  203-376   131-312 (388)
233 COG0465 HflB ATP-dependent Zn   98.4 1.8E-05 4.5E-10   58.5  13.2   97  475-587   148-253 (596)
234 PRK07132 DNA polymerase III su  98.4 8.2E-06 2.1E-10   60.9  11.4   66  298-377    94-161 (303)
235 pfam07726 AAA_3 ATPase family   98.4 3.3E-07 8.5E-12   70.9   4.1  107  227-360     1-130 (131)
236 TIGR00382 clpX ATP-dependent C  98.4 6.5E-07 1.7E-11   68.8   5.5   74  224-308   151-229 (452)
237 COG0470 HolB ATPase involved i  98.4 1.7E-06 4.4E-11   65.8   7.6  169  206-408     3-194 (325)
238 smart00382 AAA ATPases associa  98.4 3.6E-06 9.3E-11   63.5   9.1  126  225-361     2-140 (148)
239 PRK11331 5-methylcytosine-spec  98.4 2.4E-06 6.2E-11   64.7   7.9  213  504-739   193-441 (459)
240 COG3283 TyrR Transcriptional r  98.4 6.1E-05 1.5E-09   54.7  15.0  217  477-731   204-429 (511)
241 pfam08298 AAA_PrkA PrkA AAA do  98.4 1.6E-05   4E-10   58.9  12.0  109  578-711   235-344 (358)
242 KOG0734 consensus               98.3 9.8E-07 2.5E-11   67.6   5.8   95  477-587   304-407 (752)
243 COG1219 ClpX ATP-dependent pro  98.3 1.7E-05 4.3E-10   58.6  11.8  167  224-403    96-346 (408)
244 pfam01695 IstB IstB-like ATP b  98.3 3.3E-06 8.4E-11   63.8   8.1  101  509-632    49-155 (178)
245 KOG0744 consensus               98.3 1.2E-05 3.1E-10   59.7  10.9  139  500-690   173-345 (423)
246 KOG2004 consensus               98.3 2.3E-05 5.9E-10   57.7  12.3  180  206-403   413-625 (906)
247 PRK06893 DNA replication initi  98.3 7.6E-05 1.9E-09   54.0  14.7   39  361-403   155-193 (229)
248 smart00350 MCM minichromosome   98.3 7.3E-05 1.9E-09   54.1  14.6  223  468-711   194-448 (509)
249 KOG0989 consensus               98.3 2.9E-05 7.5E-10   56.9  12.5  172  477-713    36-220 (346)
250 TIGR02915 PEP_resp_reg putativ  98.3 7.8E-05   2E-09   53.9  14.7  247  441-731   106-372 (451)
251 PRK00149 dnaA chromosomal repl  98.3 4.7E-05 1.2E-09   55.5  13.5  207  473-741   116-344 (447)
252 PRK08084 DNA replication initi  98.3 0.00014 3.4E-09   52.2  15.6  184  473-730    19-213 (235)
253 PRK08903 hypothetical protein;  98.3 4.3E-05 1.1E-09   55.8  13.0  161  510-741    45-224 (227)
254 PRK06893 DNA replication initi  98.3 1.1E-05 2.8E-10   60.0   9.9  159  509-729    41-206 (229)
255 pfam02861 Clp_N Clp amino term  98.3 1.6E-06 4.2E-11   66.0   5.6   50   15-64      1-52  (53)
256 PRK10923 glnG nitrogen regulat  98.3 3.8E-06 9.7E-11   63.3   7.3  151  202-373   136-315 (469)
257 pfam03215 Rad17 Rad17 cell cyc  98.3 0.00017 4.3E-09   51.5  15.5  138  185-333     8-160 (490)
258 PRK09112 DNA polymerase III su  98.2 0.00011 2.7E-09   52.9  14.4  197  204-425    23-247 (352)
259 KOG0726 consensus               98.2 3.4E-06 8.7E-11   63.7   6.6  132  227-376   221-365 (440)
260 TIGR02880 cbbX_cfxQ CbbX prote  98.2  0.0001 2.7E-09   53.0  14.0  215  473-739    18-258 (284)
261 COG1224 TIP49 DNA helicase TIP  98.2 7.7E-05   2E-09   53.9  13.2   44  227-271    67-111 (450)
262 PRK11608 pspF phage shock prot  98.2 2.2E-05 5.6E-10   57.8  10.3  145  201-373     3-183 (325)
263 PRK06835 DNA replication prote  98.2 2.6E-05 6.5E-10   57.4  10.6  129  481-633   160-295 (330)
264 PRK07399 DNA polymerase III su  98.2 0.00018 4.6E-09   51.3  14.8  193  202-421     2-223 (314)
265 pfam01078 Mg_chelatase Magnesi  98.2 1.2E-05 2.9E-10   59.9   8.4  144  206-370     5-205 (207)
266 PRK11331 5-methylcytosine-spec  98.2 1.4E-05 3.6E-10   59.2   8.7  147  213-366   184-357 (459)
267 PRK08769 DNA polymerase III su  98.2 0.00039 9.9E-09   48.9  16.0  120  482-626     9-152 (319)
268 PRK07471 DNA polymerase III su  98.2 0.00051 1.3E-08   48.0  16.5  191  205-423    18-241 (363)
269 KOG0732 consensus               98.2 7.5E-06 1.9E-10   61.2   7.0   82  511-601   303-399 (1080)
270 COG3854 SpoIIIAA ncharacterize  98.2 2.2E-05 5.6E-10   57.8   9.4  113  213-340   125-250 (308)
271 PRK12422 chromosomal replicati  98.2 0.00021 5.4E-09   50.8  14.4  205  472-730   107-317 (455)
272 PRK09087 hypothetical protein;  98.2 0.00012 3.1E-09   52.5  13.1  171  503-741    40-220 (226)
273 COG0470 HolB ATPase involved i  98.1   8E-05   2E-09   53.8  12.0  118  478-625     2-147 (325)
274 pfam00493 MCM MCM2/3/5 family.  98.1 0.00026 6.7E-09   50.1  14.6  175  223-421    55-267 (327)
275 KOG1969 consensus               98.1 6.3E-05 1.6E-09   54.6  11.2  170  208-404   308-501 (877)
276 PRK11361 acetoacetate metaboli  98.1 2.4E-05 6.2E-10   57.5   8.8  145  202-374   141-321 (457)
277 KOG0740 consensus               98.1 0.00011 2.9E-09   52.7  12.2  128  479-626   155-299 (428)
278 KOG0726 consensus               98.1 1.2E-05 3.1E-10   59.7   6.9  158  481-685   189-369 (440)
279 TIGR03015 pepcterm_ATPase puta  98.1 0.00049 1.2E-08   48.2  15.0  207  481-740    27-248 (269)
280 PRK11388 DNA-binding transcrip  98.1 7.5E-05 1.9E-09   54.0  10.9  176  202-398   323-530 (639)
281 KOG0729 consensus               98.1 6.1E-06 1.5E-10   61.9   5.2  123  480-626   180-325 (435)
282 pfam07724 AAA_2 AAA domain (Cd  98.1 9.1E-06 2.3E-10   60.6   6.0   94  224-335     2-105 (168)
283 PRK09183 transposase/IS protei  98.1 2.9E-05 7.3E-10   57.0   8.6  112  223-353    99-217 (258)
284 PRK08939 primosomal protein Dn  98.1 6.2E-05 1.6E-09   54.6  10.2  126  483-633   138-268 (306)
285 KOG0743 consensus               98.1 7.3E-05 1.9E-09   54.1  10.5  219  451-730   188-434 (457)
286 COG2607 Predicted ATPase (AAA+  98.1   0.001 2.6E-08   45.8  16.2  159  209-397    69-252 (287)
287 TIGR02881 spore_V_K stage V sp  98.0 0.00035   9E-09   49.2  13.6  207  479-739     8-243 (261)
288 KOG0652 consensus               98.0 8.8E-05 2.2E-09   53.5  10.0  156  206-379   173-354 (424)
289 smart00763 AAA_PrkA PrkA AAA d  98.0 0.00014 3.7E-09   52.0  11.0  107  578-710   238-346 (361)
290 PRK05917 DNA polymerase III su  98.0 3.7E-05 9.5E-10   56.2   7.9  124  482-627     2-135 (290)
291 PHA02244 ATPase-like protein    98.0 2.7E-05   7E-10   57.1   7.2  189  500-723   115-315 (383)
292 PRK10820 DNA-binding transcrip  98.0 0.00011 2.7E-09   53.0  10.2  171  200-398   200-406 (513)
293 pfam05673 DUF815 Protein of un  98.0  0.0011 2.7E-08   45.7  15.2  190  477-713    28-230 (248)
294 TIGR02881 spore_V_K stage V sp  98.0 0.00029 7.3E-09   49.8  12.3  171  211-398    19-205 (261)
295 COG1484 DnaC DNA replication p  98.0 0.00014 3.6E-09   52.1  10.3  113  224-351   104-219 (254)
296 PRK12377 putative replication   98.0 7.9E-05   2E-09   53.8   9.0  114  224-357   100-221 (248)
297 PRK06526 transposase; Provisio  97.9 6.4E-05 1.6E-09   54.5   8.2  101  509-632   100-206 (254)
298 KOG0478 consensus               97.9  0.0011 2.7E-08   45.8  14.4  264  463-746   415-714 (804)
299 PRK06964 DNA polymerase III su  97.9 0.00019 4.9E-09   51.1  10.6  140  225-378    21-202 (342)
300 pfam06068 TIP49 TIP49 C-termin  97.9 0.00014 3.5E-09   52.1   9.9   44  227-271    52-96  (395)
301 pfam00158 Sigma54_activat Sigm  97.9 1.4E-05 3.5E-10   59.3   4.6  127  206-353     1-153 (168)
302 COG1221 PspF Transcriptional r  97.9 0.00029 7.4E-09   49.8  11.3  176  203-394    77-278 (403)
303 TIGR01818 ntrC nitrogen regula  97.9 0.00066 1.7E-08   47.2  13.1  233  473-760   131-382 (471)
304 PRK00131 aroK shikimate kinase  97.9 0.00075 1.9E-08   46.8  13.3  158  223-406     2-172 (175)
305 PRK05707 DNA polymerase III su  97.9 3.8E-05 9.7E-10   56.1   6.6  159  228-422    25-206 (328)
306 KOG0745 consensus               97.9 2.8E-05 7.1E-10   57.1   5.8   76  223-309   224-304 (564)
307 PRK09862 putative ATP-dependen  97.9 0.00025 6.3E-09   50.3  10.4  145  203-368   190-389 (506)
308 PRK08181 transposase; Validate  97.9 0.00011 2.8E-09   52.9   8.6  100  509-631   108-213 (269)
309 KOG0739 consensus               97.9 0.00012 3.1E-09   52.5   8.9  184  478-715   134-335 (439)
310 COG1239 ChlI Mg-chelatase subu  97.9 0.00049 1.3E-08   48.1  11.9  217  473-726    13-294 (423)
311 smart00350 MCM minichromosome   97.9  0.0013 3.3E-08   45.1  13.8  180  223-423   234-449 (509)
312 KOG0742 consensus               97.9 0.00022 5.5E-09   50.7   9.8  157  484-690   361-533 (630)
313 KOG0991 consensus               97.9 0.00048 1.2E-08   48.2  11.6  180  194-405    17-206 (333)
314 PRK08699 DNA polymerase III su  97.9  0.0005 1.3E-08   48.1  11.5   22  229-250    25-46  (325)
315 pfam01695 IstB IstB-like ATP b  97.8 0.00014 3.5E-09   52.1   8.6  108  223-350    45-159 (178)
316 PRK12724 flagellar biosynthesi  97.8 9.3E-05 2.4E-09   53.3   7.6   87  506-594   222-317 (432)
317 KOG0652 consensus               97.8 0.00036 9.2E-09   49.1  10.4  156  481-688   175-358 (424)
318 PRK05057 aroK shikimate kinase  97.8 0.00074 1.9E-08   46.9  11.7  152  223-401     2-163 (172)
319 KOG0727 consensus               97.8 0.00037 9.5E-09   49.0   9.9  190  227-450   191-395 (408)
320 COG0593 DnaA ATPase involved i  97.8 0.00096 2.5E-08   46.1  11.8  211  474-748    85-318 (408)
321 TIGR02639 ClpA ATP-dependent C  97.7 0.00013 3.4E-09   52.2   7.1  175  479-713   210-409 (774)
322 KOG1808 consensus               97.7 3.2E-05 8.1E-10   56.7   3.9   88  512-601   720-818 (1856)
323 KOG0651 consensus               97.7 0.00048 1.2E-08   48.2   9.6  124  479-627   134-281 (388)
324 PRK06620 hypothetical protein;  97.7  0.0026 6.6E-08   43.0  13.2  132  509-714    46-180 (214)
325 PRK07276 DNA polymerase III su  97.7 0.00039 9.9E-09   48.9   8.9  118  481-626     6-143 (290)
326 PRK06871 DNA polymerase III su  97.7 0.00033 8.5E-09   49.4   8.5  160  227-422    25-205 (324)
327 KOG3595 consensus               97.7  0.0025 6.5E-08   43.0  13.0  165  504-688   462-649 (1395)
328 COG3899 Predicted ATPase [Gene  97.7 6.1E-05 1.6E-09   54.7   4.7   48  205-252     1-51  (849)
329 PTZ00111 DNA replication licen  97.7  0.0017 4.3E-08   44.3  11.9  186  466-671   440-643 (916)
330 PRK13946 shikimate kinase; Pro  97.7  0.0069 1.8E-07   39.9  14.9  139  218-388    13-164 (195)
331 KOG0742 consensus               97.6  0.0013 3.2E-08   45.2  11.0  161  198-378   347-526 (630)
332 PRK06921 hypothetical protein;  97.6 0.00026 6.6E-09   50.2   7.4   21  508-528   117-137 (265)
333 COG2204 AtoC Response regulato  97.6 0.00048 1.2E-08   48.2   8.7  148  203-371   140-316 (464)
334 pfam05729 NACHT NACHT domain.   97.6  0.0079   2E-07   39.5  14.8  140  228-376     3-158 (165)
335 pfam02861 Clp_N Clp amino term  97.6 0.00016 4.2E-09   51.6   6.0   50   93-142     1-50  (53)
336 KOG1051 consensus               97.6  0.0011 2.8E-08   45.7  10.2   66    2-67     88-155 (898)
337 PRK10365 transcriptional regul  97.6 0.00021 5.4E-09   50.8   6.5  176  205-398   140-348 (441)
338 PRK08116 hypothetical protein;  97.6  0.0023 5.9E-08   43.3  11.8  128  227-371   110-247 (262)
339 TIGR00678 holB DNA polymerase   97.6 0.00021 5.3E-09   50.9   6.4  143  504-684    11-192 (216)
340 KOG1970 consensus               97.6  0.0029 7.3E-08   42.6  12.2  122  211-344    92-238 (634)
341 TIGR03499 FlhF flagellar biosy  97.6 0.00019 4.7E-09   51.2   6.0   74  508-583   195-279 (282)
342 PRK06871 DNA polymerase III su  97.6  0.0092 2.4E-07   39.0  14.5  109  504-626    20-145 (324)
343 PRK12727 flagellar biosynthesi  97.6 5.6E-05 1.4E-09   54.9   3.0  109  506-626   347-467 (557)
344 PRK05022 anaerobic nitric oxid  97.6 0.00032 8.2E-09   49.5   6.8  151  205-373   187-363 (510)
345 COG2812 DnaX DNA polymerase II  97.5    0.01 2.6E-07   38.7  14.3   42  479-528    18-59  (515)
346 pfam00910 RNA_helicase RNA hel  97.5   7E-05 1.8E-09   54.2   3.2   95  511-626     2-105 (105)
347 pfam00437 GSPII_E Type II/IV s  97.5 0.00016   4E-09   51.7   5.0   91  508-605   140-235 (283)
348 PRK08058 DNA polymerase III su  97.5   0.005 1.3E-07   40.9  12.6  180  204-421     5-206 (329)
349 pfam03266 DUF265 Protein of un  97.5  0.0007 1.8E-08   47.1   8.2  133  227-371     1-162 (168)
350 PRK05703 flhF flagellar biosyn  97.5 0.00023 5.8E-09   50.6   5.7   89  503-593   206-305 (412)
351 pfam01637 Arch_ATPase Archaeal  97.5  0.0085 2.2E-07   39.3  13.7  170  480-688     2-197 (223)
352 PRK13406 bchD magnesium chelat  97.5  0.0015 3.8E-08   44.7   9.4  196  227-448    27-247 (584)
353 KOG0744 consensus               97.5  0.0023 5.9E-08   43.3  10.3  155  220-381   164-341 (423)
354 PRK06995 flhF flagellar biosyn  97.5  0.0003 7.6E-09   49.7   5.8   83  508-592   177-270 (404)
355 PRK07993 DNA polymerase III su  97.5 0.00043 1.1E-08   48.6   6.5  181  184-422     4-207 (334)
356 PRK12723 flagellar biosynthesi  97.4  0.0005 1.3E-08   48.1   6.4  119  502-632   170-303 (388)
357 KOG1514 consensus               97.4   0.014 3.7E-07   37.6  17.9  189  505-732   419-626 (767)
358 TIGR02442 Cob-chelat-sub cobal  97.4   0.015 3.9E-07   37.4  14.6  205  224-448    24-306 (688)
359 COG1239 ChlI Mg-chelatase subu  97.4  0.0051 1.3E-07   40.9  11.1  200  227-454    40-306 (423)
360 pfam00448 SRP54 SRP54-type pro  97.4 0.00024 6.2E-09   50.4   4.2  112  509-631     3-130 (196)
361 cd01131 PilT Pilus retraction   97.4  0.0007 1.8E-08   47.0   6.5   93  508-605     2-101 (198)
362 PRK03731 aroL shikimate kinase  97.3  0.0059 1.5E-07   40.4  10.8  146  225-393     2-153 (172)
363 KOG0743 consensus               97.3  0.0068 1.7E-07   40.0  11.0  128  223-376   233-378 (457)
364 PTZ00112 origin recognition co  97.3  0.0016 4.1E-08   44.4   7.7  336  205-578   268-643 (650)
365 cd03115 SRP The signal recogni  97.3 0.00054 1.4E-08   47.8   5.2   31  509-539     2-37  (173)
366 PRK06731 flhF flagellar biosyn  97.3  0.0015 3.9E-08   44.6   7.5  106  483-590    51-168 (270)
367 TIGR02880 cbbX_cfxQ CbbX prote  97.3   0.009 2.3E-07   39.1  11.4  178  186-377    16-205 (284)
368 TIGR02915 PEP_resp_reg putativ  97.3  0.0013 3.3E-08   45.1   7.1  142  203-368   141-314 (451)
369 COG3829 RocR Transcriptional r  97.2  0.0013 3.4E-08   45.0   6.9  175  202-420   243-456 (560)
370 COG4650 RtcR Sigma54-dependent  97.2  0.0072 1.8E-07   39.8  10.5  212  474-718   181-406 (531)
371 COG0606 Predicted ATPase with   97.2  0.0028 7.1E-08   42.7   8.4  134  205-369   180-337 (490)
372 PRK07132 DNA polymerase III su  97.2  0.0045 1.1E-07   41.3   9.4  122  482-625     3-130 (303)
373 PRK06090 DNA polymerase III su  97.2  0.0016   4E-08   44.5   7.0  183  184-422     5-204 (319)
374 pfam03969 AFG1_ATPase AFG1-lik  97.2  0.0031 7.9E-08   42.4   8.4   96  227-338    63-162 (361)
375 PRK06921 hypothetical protein;  97.2  0.0056 1.4E-07   40.6   9.6   70  224-305   115-185 (265)
376 PRK07940 DNA polymerase III su  97.2   0.026 6.6E-07   35.8  17.2  153  203-377     4-189 (395)
377 PRK09087 hypothetical protein;  97.2   0.021 5.4E-07   36.4  12.4  188  212-451    31-222 (226)
378 TIGR02858 spore_III_AA stage I  97.1  0.0064 1.6E-07   40.1   9.2  106  226-344   124-245 (282)
379 cd01129 PulE-GspE PulE/GspE Th  97.1  0.0017 4.3E-08   44.3   6.2   95  504-604    77-175 (264)
380 pfam00931 NB-ARC NB-ARC domain  97.1    0.01 2.6E-07   38.7  10.2  149  209-378     1-167 (285)
381 PRK13947 shikimate kinase; Pro  97.0   0.023 5.8E-07   36.2  11.5  137  226-387     2-144 (171)
382 PRK13695 putative NTPase; Prov  97.0  0.0046 1.2E-07   41.2   7.9  139  227-380     5-171 (174)
383 PRK06090 DNA polymerase III su  97.0   0.035 8.9E-07   34.8  12.6  113  504-631    22-152 (319)
384 KOG0741 consensus               97.0  0.0013 3.4E-08   45.0   5.2   19  511-529   260-278 (744)
385 pfam07693 KAP_NTPase KAP famil  97.0   0.036 9.2E-07   34.7  14.5  124  578-729   162-293 (301)
386 PRK11160 cysteine/glutathione   97.0  0.0027 6.9E-08   42.8   6.6   32  508-539   368-401 (575)
387 TIGR02640 gas_vesic_GvpN gas v  97.0  0.0019 4.8E-08   44.0   5.7  152  227-404    23-213 (265)
388 PRK13900 type IV secretion sys  97.0  0.0017 4.3E-08   44.3   5.5   89  509-603   162-259 (332)
389 PRK05707 DNA polymerase III su  97.0   0.032 8.3E-07   35.1  12.0  111  504-628    19-147 (328)
390 PRK11664 ATP-dependent RNA hel  97.0   0.015 3.8E-07   37.5  10.2   34  205-243     5-38  (812)
391 PRK04132 replication factor C   97.0  0.0053 1.4E-07   40.7   7.7   37  583-631   652-689 (863)
392 KOG1969 consensus               97.0   0.022 5.7E-07   36.2  10.9  172  496-713   314-500 (877)
393 TIGR01842 type_I_sec_PrtD type  96.9  0.0008   2E-08   46.6   3.4   37  508-544   356-395 (556)
394 PRK06835 DNA replication prote  96.9   0.019 4.8E-07   36.8  10.4  133  216-368   175-318 (330)
395 COG1419 FlhF Flagellar GTP-bin  96.9  0.0012 3.1E-08   45.4   4.3   82  505-594   201-299 (407)
396 cd01130 VirB11-like_ATPase Typ  96.9  0.0017 4.5E-08   44.2   5.1   91  508-603    26-124 (186)
397 PRK07993 DNA polymerase III su  96.9   0.042 1.1E-06   34.3  14.7  112  505-630    22-151 (334)
398 KOG2227 consensus               96.9   0.007 1.8E-07   39.9   8.1  196  204-421   150-373 (529)
399 KOG0055 consensus               96.9  0.0098 2.5E-07   38.8   8.8   90  509-600  1018-1173(1228)
400 PRK13406 bchD magnesium chelat  96.9   0.025 6.4E-07   35.8  10.8   11  392-402   239-249 (584)
401 KOG3347 consensus               96.9    0.03 7.5E-07   35.4  11.2  121  509-658     9-143 (176)
402 cd03238 ABC_UvrA The excision   96.9  0.0025 6.5E-08   43.0   5.6   20  509-528    23-42  (176)
403 cd00464 SK Shikimate kinase (S  96.9   0.029 7.4E-07   35.4  11.0  140  227-392     1-146 (154)
404 COG1643 HrpA HrpA-like helicas  96.9  0.0062 1.6E-07   40.2   7.5  138  205-356    50-221 (845)
405 PTZ00112 origin recognition co  96.9  0.0068 1.7E-07   39.9   7.7  215  473-732   263-494 (650)
406 PRK13948 shikimate kinase; Pro  96.9   0.024   6E-07   36.1  10.4  144  223-392     8-157 (182)
407 COG0703 AroK Shikimate kinase   96.8   0.048 1.2E-06   33.8  11.4  142  225-392     2-150 (172)
408 COG2804 PulE Type II secretory  96.8  0.0019 4.8E-08   44.0   4.1   96  504-605   255-354 (500)
409 KOG2035 consensus               96.7    0.01 2.6E-07   38.7   7.8  195  201-423    10-232 (351)
410 COG1485 Predicted ATPase [Gene  96.7   0.022 5.6E-07   36.3   9.3  105  506-632    65-176 (367)
411 PRK13894 conjugal transfer ATP  96.7  0.0043 1.1E-07   41.4   5.5   23  227-249   151-173 (320)
412 PRK11889 flhF flagellar biosyn  96.7  0.0035 8.8E-08   42.1   5.0   95  505-601   239-347 (436)
413 TIGR00678 holB DNA polymerase   96.7   0.064 1.6E-06   32.9  12.1  146  215-379     3-192 (216)
414 TIGR01846 type_I_sec_HlyB type  96.7  0.0013 3.4E-08   45.1   2.8   78  508-588   491-631 (703)
415 smart00487 DEXDc DEAD-like hel  96.7   0.018 4.7E-07   36.8   8.6   21  508-528    25-45  (201)
416 PRK11823 DNA repair protein Ra  96.6 0.00051 1.3E-08   48.1   0.5  195  210-418    76-296 (454)
417 PRK06696 uridine kinase; Valid  96.6  0.0059 1.5E-07   40.4   5.9   61  483-549     8-71  (227)
418 PRK10938 putative molybdenum t  96.6  0.0075 1.9E-07   39.6   6.4   20  509-528   288-307 (490)
419 TIGR00368 TIGR00368 Mg chelata  96.6 0.00024 6.1E-09   50.4  -1.4  120  190-335   189-328 (505)
420 PRK12726 flagellar biosynthesi  96.6  0.0072 1.8E-07   39.8   6.1   32  508-539   207-243 (407)
421 PRK08939 primosomal protein Dn  96.6   0.074 1.9E-06   32.5  11.9  124  208-350   136-271 (306)
422 KOG1514 consensus               96.6   0.022 5.6E-07   36.3   8.5  249  185-458   380-661 (767)
423 cd03214 ABC_Iron-Siderophores_  96.6   0.013 3.3E-07   37.9   7.3   20  509-528    27-46  (180)
424 PRK10436 hypothetical protein;  96.5  0.0034 8.7E-08   42.1   4.2   96  504-605   212-311 (461)
425 TIGR01818 ntrC nitrogen regula  96.5   0.016 4.1E-07   37.2   7.4  181  205-421   136-346 (471)
426 cd03246 ABCC_Protease_Secretio  96.5  0.0061 1.6E-07   40.3   5.2   69  508-587    28-125 (173)
427 cd04157 Arl6 Arl6 subfamily.    96.5   0.011 2.9E-07   38.4   6.4   20  227-246     1-20  (162)
428 PRK07952 DNA replication prote  96.3   0.031 7.8E-07   35.2   8.1   69  226-305    97-168 (242)
429 PRK00771 signal recognition pa  96.3   0.027 6.8E-07   35.7   7.7   26  226-251    98-123 (433)
430 cd00267 ABC_ATPase ABC (ATP-bi  96.3  0.0099 2.5E-07   38.8   5.5   89  508-601    26-128 (157)
431 PRK00091 miaA tRNA delta(2)-is  96.3  0.0044 1.1E-07   41.3   3.6   39  225-273     4-42  (304)
432 PRK05917 DNA polymerase III su  96.3    0.11 2.7E-06   31.4  18.2  167  228-422    22-205 (290)
433 pfam05729 NACHT NACHT domain.   96.3   0.024   6E-07   36.1   7.3  106  509-628     2-130 (165)
434 cd01121 Sms Sms (bacterial rad  96.3  0.0094 2.4E-07   38.9   5.1  182  227-419    83-290 (372)
435 TIGR01420 pilT_fam twitching m  96.3  0.0068 1.7E-07   39.9   4.4  180  504-733   124-329 (350)
436 PRK10867 signal recognition pa  96.2   0.025 6.3E-07   35.9   7.2   25  227-251   102-126 (453)
437 KOG0991 consensus               96.2   0.019 4.9E-07   36.7   6.6  118  477-631    27-157 (333)
438 pfam00931 NB-ARC NB-ARC domain  96.2   0.022 5.5E-07   36.3   6.9  122  483-625     2-136 (285)
439 PRK03846 adenylylsulfate kinas  96.2   0.009 2.3E-07   39.1   4.9   41  504-545    22-65  (198)
440 cd03229 ABC_Class3 This class   96.2   0.017 4.3E-07   37.1   6.2   20  509-528    28-47  (178)
441 cd03221 ABCF_EF-3 ABCF_EF-3  E  96.2   0.025 6.4E-07   35.9   7.1   93  509-627    28-128 (144)
442 pfam02562 PhoH PhoH-like prote  96.2  0.0092 2.3E-07   39.0   4.8   34  480-528     7-40  (205)
443 KOG1808 consensus               96.2    0.12 3.1E-06   30.9  21.9  134  482-627   421-561 (1856)
444 TIGR03158 cas3_cyano CRISPR-as  96.2    0.11 2.7E-06   31.4  10.1   51  230-295    19-69  (357)
445 PRK13949 shikimate kinase; Pro  96.1    0.13 3.3E-06   30.8  10.5   68  227-299     3-74  (169)
446 PRK03839 putative kinase; Prov  96.1    0.11 2.8E-06   31.3  10.0   37  510-548     3-39  (180)
447 cd04154 Arl2 Arl2 subfamily.    96.1   0.032 8.3E-07   35.1   7.2   27  221-247    10-36  (173)
448 cd03115 SRP The signal recogni  96.1   0.031   8E-07   35.2   7.2   37  228-269     3-39  (173)
449 COG2607 Predicted ATPase (AAA+  96.1    0.13 3.4E-06   30.7  15.6  195  478-716    61-266 (287)
450 TIGR00958 3a01208 antigen pept  96.1   0.014 3.5E-07   37.8   5.3   91  509-601   561-718 (770)
451 pfam01745 IPT Isopentenyl tran  96.1  0.0065 1.7E-07   40.1   3.5   22  228-249     4-25  (232)
452 cd03227 ABC_Class2 ABC-type Cl  96.0   0.077   2E-06   32.4   8.9  110  228-347    24-145 (162)
453 PRK13635 cbiO cobalt transport  96.0   0.034 8.7E-07   34.9   7.1   21  228-248    36-56  (279)
454 PRK08533 flagellar accessory p  96.0   0.049 1.3E-06   33.8   7.9   18  512-529    29-46  (230)
455 COG1373 Predicted ATPase (AAA+  96.0    0.15 3.7E-06   30.4  13.0  170  208-418    21-191 (398)
456 KOG0482 consensus               96.0    0.15 3.7E-06   30.4  11.5  233  466-747   331-629 (721)
457 cd03247 ABCC_cytochrome_bd The  96.0   0.027   7E-07   35.6   6.4   44  509-554    30-78  (178)
458 COG1936 Predicted nucleotide k  96.0   0.025 6.5E-07   35.8   6.2  151  510-688     3-154 (180)
459 PRK13652 cbiO cobalt transport  96.0   0.016 4.1E-07   37.2   5.1   19  228-246    33-51  (277)
460 KOG0477 consensus               95.9   0.042 1.1E-06   34.2   7.2  136  473-626   445-598 (854)
461 PRK13851 type IV secretion sys  95.9  0.0095 2.4E-07   38.9   3.9   87  509-603   164-260 (343)
462 COG1419 FlhF Flagellar GTP-bin  95.9   0.046 1.2E-06   34.0   7.3   43  223-270   201-245 (407)
463 pfam00448 SRP54 SRP54-type pro  95.9   0.043 1.1E-06   34.2   7.2   37  228-269     4-40  (196)
464 TIGR02782 TrbB_P P-type conjug  95.9   0.048 1.2E-06   33.9   7.4  115  186-377   114-232 (315)
465 PRK04220 2-phosphoglycerate ki  95.9   0.018 4.5E-07   37.0   5.1   40  500-540    86-126 (306)
466 TIGR02533 type_II_gspE general  95.9  0.0086 2.2E-07   39.2   3.5  207  504-748   242-485 (495)
467 PTZ00133 ADP-ribosylation fact  95.9    0.13 3.4E-06   30.7   9.4   28  219-246    11-38  (182)
468 COG1124 DppF ABC-type dipeptid  95.9   0.036 9.2E-07   34.7   6.6   38  508-545    34-73  (252)
469 pfam01583 APS_kinase Adenylyls  95.9   0.015 3.7E-07   37.6   4.5   36  509-544     4-42  (157)
470 pfam00025 Arf ADP-ribosylation  95.8   0.019 4.7E-07   36.8   5.0   32  216-247     5-36  (174)
471 cd01882 BMS1 Bms1.  Bms1 is an  95.8   0.051 1.3E-06   33.7   7.3   97  229-342    43-142 (225)
472 KOG1942 consensus               95.8   0.015 3.7E-07   37.5   4.5  118  578-736   298-415 (456)
473 cd04153 Arl5_Arl8 Arl5/Arl8 su  95.8   0.052 1.3E-06   33.6   7.3   41  215-255     5-45  (174)
474 pfam04851 ResIII Type III rest  95.8    0.02 5.2E-07   36.5   5.2   61  224-309    17-77  (103)
475 TIGR02329 propionate_PrpR prop  95.8    0.03 7.5E-07   35.4   6.0  222  478-731   320-567 (658)
476 pfam05621 TniB Bacterial TniB   95.8   0.032   8E-07   35.2   6.1  111  473-588    30-157 (302)
477 COG1066 Sms Predicted ATP-depe  95.8   0.031   8E-07   35.2   6.1  175  227-419    94-300 (456)
478 KOG0055 consensus               95.8   0.095 2.4E-06   31.7   8.5   43  227-271   381-425 (1228)
479 cd03283 ABC_MutS-like MutS-lik  95.8   0.006 1.5E-07   40.3   2.4  126  224-354    24-159 (199)
480 cd03299 ABC_ModC_like Archeal   95.8   0.031 7.8E-07   35.3   6.0   20  509-528    27-46  (235)
481 TIGR00174 miaA tRNA delta(2)-i  95.8  0.0075 1.9E-07   39.7   2.8   66  228-303     2-95  (307)
482 KOG0480 consensus               95.8    0.18 4.6E-06   29.7  15.2  228  465-712   333-588 (764)
483 COG0324 MiaA tRNA delta(2)-iso  95.7   0.011 2.9E-07   38.4   3.5   76  226-302     4-98  (308)
484 PRK05541 adenylylsulfate kinas  95.7   0.019 4.9E-07   36.7   4.7   36  509-544     9-47  (176)
485 PRK09302 circadian clock prote  95.7   0.036 9.1E-07   34.8   5.9   20  509-528   268-287 (501)
486 PRK13642 cbiO cobalt transport  95.7   0.064 1.6E-06   33.0   7.2   20  228-247    36-55  (277)
487 PRK00625 shikimate kinase; Pro  95.6     0.2 5.1E-06   29.4  12.9  129  227-392     2-148 (173)
488 COG3604 FhlA Transcriptional r  95.6   0.018 4.7E-07   36.9   4.3  114  203-343   222-368 (550)
489 TIGR03608 L_ocin_972_ABC putat  95.6   0.032 8.1E-07   35.1   5.5   20  509-528    26-45  (206)
490 PRK03839 putative kinase; Prov  95.6   0.052 1.3E-06   33.6   6.6   59  228-298     3-68  (180)
491 KOG0058 consensus               95.6    0.03 7.6E-07   35.3   5.4   36  509-544   496-536 (716)
492 CHL00026 ycf2 Ycf2              95.6    0.11 2.7E-06   31.4   8.1  108  509-628  1632-1785(2286)
493 pfam08423 Rad51 Rad51. Rad51 i  95.6    0.11 2.9E-06   31.1   8.3   36  504-539    39-84  (261)
494 cd03222 ABC_RNaseL_inhibitor T  95.6   0.028 7.2E-07   35.5   5.2   84  509-604    27-122 (177)
495 PRK13833 conjugal transfer pro  95.6   0.029 7.4E-07   35.4   5.2   51  194-251   120-170 (323)
496 TIGR02538 type_IV_pilB type IV  95.6  0.0052 1.3E-07   40.8   1.3   65  504-585   323-404 (577)
497 pfam00625 Guanylate_kin Guanyl  95.6    0.14 3.6E-06   30.5   8.7   22  228-249     4-25  (182)
498 pfam06414 Zeta_toxin Zeta toxi  95.6   0.017 4.4E-07   37.0   4.0   46  501-547     7-53  (191)
499 cd03223 ABCD_peroxisomal_ALDP   95.6   0.095 2.4E-06   31.7   7.8   20  509-528    29-48  (166)
500 TIGR00455 apsK adenylylsulfate  95.6   0.017 4.3E-07   37.1   3.9  110  506-679    17-136 (187)

No 1  
>TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit ClpA; InterPro: IPR013461    Proteins in this entry are related to ClpA () from Escherichia coli. ClpA is an ATP-dependent chaperone and part of the ClpAP protease that participates in regulatory protein degradation and the dissolution and degradation of protein aggregates . ClpA recognises sequences in specific proteins, which it then unfolds in an ATP-dependent manner and transports into the degradation chamber of the associated ClpP protein , . A small adaptor-like protein, ClpS, modulates the activity of ClpA and is an important regulatory factor for this protein . It protects ClpA from autodegradation and appears to redirect its activity away from soluble proteins and toward aggregated proteins..
Probab=100.00  E-value=0  Score=2162.47  Aligned_cols=750  Identities=55%  Similarity=0.894  Sum_probs=717.4

Q ss_pred             CCHHHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHCHHHHHHHHHCC-CCHHHHHHHHHHHHHHCCCCCCC------CCC
Q ss_conf             43899999999999999828995119999999820746899999859-99899999999996413654577------888
Q gi|254780163|r    4 FSENLEKVLHQALVLANERNHEYATLEHLLLALIDDSDAAIVMLSCN-VDLKVLKNNLLNYIDNDSSNKLK------NGF   76 (798)
Q Consensus         4 fS~~a~~vL~~A~~lAk~~~H~~Vt~EHLLLaLL~d~~~~~iL~~~g-iD~~~Lk~~Le~~L~~~~~~~~~------~~~   76 (798)
                      +|++++++|..|.++|+.++|+|||+|||||||+.++.+..+|+.|| +|++.|++.|++||++..+....      +..
T Consensus         1 ~~~~l~~~L~~A~~~AK~~~HEf~T~EH~Llal~~~~~~~~il~~cgd~d~~~L~~~L~~yl~~~~~~~~~~qlGyGg~~   80 (774)
T TIGR02639         1 ISKELERILSEALEEAKERRHEFVTLEHLLLALLDDNEAIEILEECGDGDVELLRKKLEDYLEENLEVLEEEQLGYGGSE   80 (774)
T ss_pred             CCHHHHHHHHHHHHHHHHHCCCEECHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCC
T ss_conf             98789999999999998618942438999999703767899998533311899999999987513887760224468886


Q ss_pred             CCCCCCCHHHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHCCCCHHHHHHHHCCCCHHHHHHHHHHHCCCCHHHHHHHHH
Q ss_conf             67764698999999999999998099812599987878737742999999984999899999998300000001112110
Q gi|254780163|r   77 RVECKPTSSFQRVVQRAVLHVQSTGRGIVTGANILVALFSEPDSHATYFLQEQEMTLYDAVNFISHGISKRKEFANFQSK  156 (798)
Q Consensus        77 ~~ei~~S~~l~rVL~~A~~~A~~~G~~~I~~eHLLLALL~e~ds~a~~iL~~~gis~~~v~~~i~~~~~~~~~~~~~~~~  156 (798)
                      ..+|.+|-.+++||++|..+.++.++++|+..|||.||+.|.+|+|+|+|+++|+++.++.++|+|.+............
T Consensus        81 ~~ep~~T~g~~~Viq~A~~h~~s~~~~~~~~gD~Lvalf~E~~S~a~Y~Lk~qgi~Rl~~~~~ish~i~~~~~~~~~~~~  160 (774)
T TIGR02639        81 EEEPEQTVGVQRVIQRALLHVKSAGKKEIDIGDLLVALFDEEDSHASYFLKSQGITRLDILNYISHGISKDDKKDQLGEE  160 (774)
T ss_pred             CCCCHHHHHHHHHHHHHHHHHHHCCCCCCCCCHHHHEECCCCCCHHHHHHHHCCCCHHHHHHHHCCCCCCCCCCCCCCCC
T ss_conf             55630014478999999998531488602311100111027861310203321786999999741455457875633122


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHCCCCCCEEEECCCCC
Q ss_conf             24432100000124444444555544553035654425887754861122217899999999862267787489667641
Q gi|254780163|r  157 LNVDGSSAGSDGEGFVNDYQAKTDLNLFPALSAYCVDLTEKVKKGKVDILVGRHEEINRTIQILCRRSKNNPLYVGDPGV  236 (798)
Q Consensus       157 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LdkFg~DLTe~AreGKLDPVIGRd~EI~riiqIL~RR~KNn~~lvG~~gv  236 (798)
                      ...+..-.................+....+|++||+|||++|++|||||+||||+||+|+|||||||+|||||+||||||
T Consensus       161 ~~~~~~e~~~~~~~~~~~~~~~~~~~~~~aL~~yt~~Lt~~A~~GkiDPLIGRE~EleRtiQvLCRR~KNNPl~VGEPGV  240 (774)
T TIGR02639       161 AAEEEEELQEEKEDSAREEDTDKAKKQQDALEKYTVDLTEKAKNGKIDPLIGREDELERTIQVLCRRKKNNPLLVGEPGV  240 (774)
T ss_pred             CCCCCHHHHCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHHHCCCCCCCCCEECCCCC
T ss_conf             23420143146777876656652004656998841548999860887873456688742333203456788720448886


Q ss_pred             HHHHHHHHHHHHHHCC-CCCHHHHEEEEEEEEHHHHHCCCCCCCHHHHHHHHHHHHHCCCCCE-EEEECCHHHHHCCCCC
Q ss_conf             1668999999998548-9883452014455404675306343123789999999872038983-9997361663015544
Q gi|254780163|r  237 GKTAIAEGFAKQIVDG-MVPDILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIESYANA-ILYIDEIHTLVGAGSA  314 (798)
Q Consensus       237 Gktaive~la~~i~~~-~vp~~l~~~~i~~ld~~~l~ag~~~rg~fe~r~~~~~~~~~~~~~~-ilfideih~ligag~~  314 (798)
                      ||||||||||+||+++ .||+.|+|.+||+||||+|+||||||||||+|||.||+|+++.+|. ||||||||||||||++
T Consensus       241 GKTAI~EGLA~~I~~~~kvPe~Lkn~~IY~LDmG~LLAGTKYRGDFE~RLK~V~~Ei~~~~~anILFIDEIHTIVGAGAT  320 (774)
T TIGR02639       241 GKTAIVEGLAQRIAEGQKVPEVLKNAKIYSLDMGTLLAGTKYRGDFEERLKAVVSEIEKEPNANILFIDEIHTIVGAGAT  320 (774)
T ss_pred             CHHHHHHHHHHHHHCCCCCCHHHCCCCEEEECHHHHHHHCCCCCHHHHHHHHHHHHHHCCCCCCEEEEECCCCEEECCCC
T ss_conf             44899999999864156467002478345404345641024542478999999999852899954664110103317878


Q ss_pred             CCCCCCHHHHHHHHHCCCCEEEEEECCHHHHHHHHHCCHHHHHHCEEEEECCCCHHHHHHHHHHHHHHHHHHCCCEECCH
Q ss_conf             43447778888766302660388730489999985201114320014430687868999999861276654103512111
Q gi|254780163|r  315 SGISVDASNLLKPALSSGAVRCIGSTTYSEYRQFFEKDKALVRRFQKIDVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKE  394 (798)
Q Consensus       315 ~g~~~d~an~lkP~L~rg~~~~IgatT~~ey~~~~e~d~al~rrF~~i~v~ep~~~~~~~iL~~~~~~ye~~h~v~~~~~  394 (798)
                      |||||||||||||||+.|.|||||+||++|||+|||||+||.||||+|.|+|||.++|+.||+|||++||.||+|+|+++
T Consensus       321 SGGsmDASNLLKPaL~~G~iRCIGsTTy~EY~~~FeKDrALsRRFQKIDv~EPs~eet~~ILkGLk~~YE~fH~V~Y~~e  400 (774)
T TIGR02639       321 SGGSMDASNLLKPALASGKIRCIGSTTYEEYKNHFEKDRALSRRFQKIDVGEPSIEETVKILKGLKEQYEEFHHVKYSDE  400 (774)
T ss_pred             CCHHHHHHHHHHHHHHCCCEEEECCCCHHHHHCHHHCCCCCCCCCCEECCCCCCHHHHHHHHHHHHHHHHCCCCEECCHH
T ss_conf             75155244321125307877862265248641110102021654233117957888999999865542013250113869


Q ss_pred             HHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHCC--------------CCHHHHHHHHHHCCCCCCHHHH
Q ss_conf             78999998654201555646798899865333321144322113--------------6578999866310245310111
Q gi|254780163|r  395 AIRAAVQLSVRHFTSRKLPDKAIDVIDEAGASQILQPLSKRRKF--------------ITEKDIKKTIASMNRSIHTTSF  460 (798)
Q Consensus       395 al~~av~ls~ryi~~r~lPdkAidllDea~a~~~~~~~~~~~~~--------------~~~~~i~~~~~~~~~gip~~~~  460 (798)
                      ||++||.||+|||.|||||||||||||||||.+++....+++..              |+.+||.++|++|+ +||...+
T Consensus       401 al~~Av~LS~ryI~DRfLPDKAIDviDEaGA~~~l~~~~~~~~~eadekGleetalPev~~~diE~vvak~a-~iP~~~~  479 (774)
T TIGR02639       401 ALEAAVELSARYINDRFLPDKAIDVIDEAGAAFRLRAKAKKKANEADEKGLEETALPEVNVKDIEEVVAKMA-KIPVKTV  479 (774)
T ss_pred             HHHHHHHHHHHHCCCCCCCCHHHHHHHHHHHHHHHHHHCCCCCCCHHHCCCCCCCCCCCCHHHHHHHHHHHH-CCCCEEE
T ss_conf             999999998886025789854322889999999971202776432011253000478785444999998871-8994154


Q ss_pred             HCCH-HHHHHHHCCHHHHHHHCHHHHHHHHHHHHHHHHCCCCCCCCCCCEEEEECCCCHHHHHHHHHHHHHCCCCEEEEE
Q ss_conf             0011-233421000024665345899999999987752044565787406886143200388999998730477337720
Q gi|254780163|r  461 SRDD-DSVLSNLEKNLGTVVYGQEEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFALGVQLLRFD  539 (798)
Q Consensus       461 ~~~~-~~~l~~l~~~l~~~v~GQ~~ai~~v~~~i~~~~~gl~~~~rP~g~flf~GptGvGKTelak~la~~~~~~lir~d  539 (798)
                      +.+| +++|.+|+.+|+++|+|||+||++|+.+|+||||||.+|+||+|||||+|||||||||+||+||..++.+|+|||
T Consensus       480 s~ddD~~~L~~L~~~L~~kIfGQD~AI~~lv~aiK~SrAGl~~~nkP~GSFLF~GPTGVGKTElak~LA~~LGv~l~RFD  559 (774)
T TIGR02639       480 SSDDDREKLKNLEKELKAKIFGQDEAIEQLVSAIKRSRAGLGEPNKPVGSFLFVGPTGVGKTELAKQLAEELGVHLLRFD  559 (774)
T ss_pred             CCCHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHCCCCCCCEEEEEEECCCCCCHHHHHHHHHHHHCCHHCCCC
T ss_conf             26447988720447630131515899999999999987424778881688886479896257889999997082001046


Q ss_pred             HHHHHCCCCCCHHCCCCCHHCCCCCCCCCCHHHHHCCCEEEEECCHHHCCHHHHHHHHHHHHHHHCCCCCCCEECCCCEE
Q ss_conf             68861246530110478000256444310035551585177740445502899999999877750217799776125429
Q gi|254780163|r  540 MSEYMERHAVSRLIGAPPGYVGFGQGGILADSVDQNPYSVVLLDEIEKSHPDVLNILLQIMDYGILTDQSGKKISFRNVI  619 (798)
Q Consensus       540 msey~e~~~vs~LiGappGYvG~~egg~Lte~vr~~P~sVvl~DEiEKAh~~v~~~llqild~G~ltd~~Gr~vdf~n~i  619 (798)
                      ||||||+|+||||||||||||||||||+||+||||+||||||||||||||||++|+||||||.++||||+||++||||+|
T Consensus       560 MSEYmEKHTVsRLIGsPPGYVGfEqGGLLT~AvrK~P~cVLLLDEIEKAHpDI~NILLQVMD~AtLTDN~GrKaDFRNVI  639 (774)
T TIGR02639       560 MSEYMEKHTVSRLIGSPPGYVGFEQGGLLTDAVRKHPHCVLLLDEIEKAHPDIYNILLQVMDYATLTDNNGRKADFRNVI  639 (774)
T ss_pred             CHHHHHHHHHHHHHCCCCCCCCCCCCCCCHHHHCCCCCEEEHHHHHHHHHHHHHHHHHHHHCCCEEECCCCCEEEECCEE
T ss_conf             50446899998741688885131677721223312885354234666631336667876633543405888576311368


Q ss_pred             EEEECCCCHHHHHHCCCCCCCCCCHHHHHHHHHHHCCHHHHCCCCEEEECCCCCHHHHHHHHHHHHHHHHHHHHHCCCEE
Q ss_conf             99942421455330368988211148899999872887881776828962889999999999999999999998669889
Q gi|254780163|r  620 LIMTTNAGALEMSKARIGFGSSRNDDADKEALRNFLSPEFLNRLDSIIPFFPLSSDIIRQVVHKFIMKLELQLQEKGISF  699 (798)
Q Consensus       620 ii~TsN~G~~~~~~~~~g~~~~~~~~~~~~~l~~~f~peflnRid~ii~F~~l~~~~~~~i~~~~l~~l~~~l~~~~i~l  699 (798)
                      +|||||+||.+++++.+||..+...+...++++++|+|||+||||.||+|+||+.+.+.+|+.++|.+|+.+|.+|+|.|
T Consensus       640 LIMTSNaGa~E~~~~~iGF~~~~~~~~~~~Aikk~F~PEFRNRLDaii~F~~L~~~~~~~i~~K~l~el~~~L~eK~v~l  719 (774)
T TIGR02639       640 LIMTSNAGAREMSKNPIGFGGERVEDKSEKAIKKLFSPEFRNRLDAIIAFNDLSEEVAEKIVKKFLDELQKQLNEKNVEL  719 (774)
T ss_pred             EEECCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHCCCCCCCCCCCEEECCCCCHHHHHHHHHHHHHHHHHHHHHCCEEE
T ss_conf             88403700102367764425554123348889731587420133464416998899999999999999997553065378


Q ss_pred             EECHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHHHHHHHHHCCCCCCCCEEEEEEE
Q ss_conf             99889999999718981015326799999862359999996296768884899996
Q gi|254780163|r  700 HFSEEVINWLVSHGYDVKMGARPLERIIKEHVKVPLADEILFGKLKKGGGVVKVSL  755 (798)
Q Consensus       700 ~~~~~~~~~l~~~~~~~~~GAR~l~r~i~~~i~~~la~~il~~~~~~g~~~~~v~~  755 (798)
                      +++++|+.||+++|||++||||||.|+|+++|.++|+++||||+|++|+. |+|++
T Consensus       720 ~l~~~a~~~LA~KGY~~efGARpl~R~I~~~i~~~L~dEILFG~LKkGG~-v~~~~  774 (774)
T TIGR02639       720 ELTDDAIKYLAEKGYDEEFGARPLARVIQEEIKKPLSDEILFGKLKKGGE-VKISL  774 (774)
T ss_pred             EECHHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHHHHHHHCCCCCCCCCE-EEEEC
T ss_conf             76478999998636781105544899988741257654420570016726-88738


No 2  
>CHL00095 clpC Clp protease ATP binding subunit
Probab=100.00  E-value=0  Score=1872.78  Aligned_cols=727  Identities=42%  Similarity=0.694  Sum_probs=674.9

Q ss_pred             CCCHHHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHCHH--HHHHHHHCCCCHHHHHHHHHHHHHHCCCCCCCCCCCCCC
Q ss_conf             343899999999999999828995119999999820746--899999859998999999999964136545778886776
Q gi|254780163|r    3 FFSENLEKVLHQALVLANERNHEYATLEHLLLALIDDSD--AAIVMLSCNVDLKVLKNNLLNYIDNDSSNKLKNGFRVEC   80 (798)
Q Consensus         3 mfS~~a~~vL~~A~~lAk~~~H~~Vt~EHLLLaLL~d~~--~~~iL~~~giD~~~Lk~~Le~~L~~~~~~~~~~~~~~ei   80 (798)
                      .||++++++|..|+++|++++|+||++||||++|+.+++  +..+|..+|+|.+.++++++.++.....     ....++
T Consensus         4 kfT~~a~~~L~~A~~~A~~~~h~~V~~eHLLlaLl~~~~~~~~~~L~~~~vd~~~l~~~l~~~~~~~~~-----~~~~~~   78 (823)
T CHL00095          4 RFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAARALKSLNVNLKDARKEVEKYIGRGSG-----FVAVEI   78 (823)
T ss_pred             HHHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHCCCCCHHHHHHHHCCCCHHHHHHHHHHHHHCCCC-----CCCCCC
T ss_conf             366999999999999999859894089999999974998479999998699999999999999842699-----887886


Q ss_pred             CCCHHHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHCCCCHHHHHHHHCCCCHHHHHHHHHHHCCCCHHHHHHHHHCCCC
Q ss_conf             46989999999999999980998125999878787377429999999849998999999983000000011121102443
Q gi|254780163|r   81 KPTSSFQRVVQRAVLHVQSTGRGIVTGANILVALFSEPDSHATYFLQEQEMTLYDAVNFISHGISKRKEFANFQSKLNVD  160 (798)
Q Consensus        81 ~~S~~l~rVL~~A~~~A~~~G~~~I~~eHLLLALL~e~ds~a~~iL~~~gis~~~v~~~i~~~~~~~~~~~~~~~~~~~~  160 (798)
                      ++|+.++++|++|+.+|..+|+++|+++|||+||+.+.++++.++|..++++...+.+.+..........          
T Consensus        79 ~~s~~~~~vL~~A~~~a~~~~~~~I~~ehLllall~e~~~~a~~iL~~~gi~~~~~~~~~~~~~~~~~~~----------  148 (823)
T CHL00095         79 PFTPRAKRVLELSLEEARILGHNYIGTEHLLLGLIREGEGVAARVLENLNVDLPKVRSLIINLIGEIAEV----------  148 (823)
T ss_pred             CCCHHHHHHHHHHHHHHHHCCCCEECHHHHHHHHHCCCCCHHHHHHHHCCCCHHHHHHHHHHHHCCCCCC----------
T ss_conf             8887999999999999998299804399999999708974799999987999999999999984545655----------


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHCCCCCCEEEECCCCCHHHH
Q ss_conf             21000001244444445555445530356544258877548611222178999999998622677874896676411668
Q gi|254780163|r  161 GSSAGSDGEGFVNDYQAKTDLNLFPALSAYCVDLTEKVKKGKVDILVGRHEEINRTIQILCRRSKNNPLYVGDPGVGKTA  240 (798)
Q Consensus       161 ~~~~~~~~~~~~~~~~~~~~~~~~~~LdkFg~DLTe~AreGKLDPVIGRd~EI~riiqIL~RR~KNn~~lvG~~gvGkta  240 (798)
                                   ..........+++|++||+|||++|++|++|||||||+||+|++||||||+||||||||||||||||
T Consensus       149 -------------~~~~~~~~~~~~~L~ky~~dLT~~A~~GklDpvIGRd~EI~r~i~IL~RR~KNNpiLvGepGVGKTA  215 (823)
T CHL00095        149 -------------ILGGGTSREKTPTLEEFGNNLTKMAYEGNLDPVIGRDKEIERVIQILGRRTKNNPILIGEPGVGKTA  215 (823)
T ss_pred             -------------CCCCCCCCCCCHHHHHHHHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHHHCCCCCEEECCCCCCHHH
T ss_conf             -------------6788666656556999978889999838999875956999999999977324885023799987999


Q ss_pred             HHHHHHHHHHCCCCCHHHHEEEEEEEEHHHHHCCCCCCCHHHHHHHHHHHHHCCCCCEEEEECCHHHHHCCCCCCCCCCC
Q ss_conf             99999999854898834520144554046753063431237899999998720389839997361663015544434477
Q gi|254780163|r  241 IAEGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIESYANAILYIDEIHTLVGAGSASGISVD  320 (798)
Q Consensus       241 ive~la~~i~~~~vp~~l~~~~i~~ld~~~l~ag~~~rg~fe~r~~~~~~~~~~~~~~ilfideih~ligag~~~g~~~d  320 (798)
                      ||||||+||++|+||+.|+|++||+||+++|+|||+||||||+|||.|++++++++++||||||||||||||+++| +||
T Consensus       216 IvEGLA~rI~~g~VP~~L~~~~i~sLDl~~L~AGtkyRGeFEeRlk~il~ei~~~~~iILFIDEiHtlvGaG~~~g-~~D  294 (823)
T CHL00095        216 IAEGLAQRIANRDVPDILEDKLVLTLDIGLLLAGTKYRGEFEERIKKIMDEIKKANNIILVIDEIHTLIGAGAAEG-AID  294 (823)
T ss_pred             HHHHHHHHHHCCCCCHHHCCCCEEEEEHHHHHHCCCCCHHHHHHHHHHHHHHHHCCCEEEEECCHHHHCCCCCCCC-CHH
T ss_conf             9999999760889986875993688428877533422267999999999999857986999735165328897666-431


Q ss_pred             HHHHHHHHHCCCCEEEEEECCHHHHHHHHHCCHHHHHHCEEEEECCCCHHHHHHHHHHHHHHHHHHCCCEECCHHHHHHH
Q ss_conf             78888766302660388730489999985201114320014430687868999999861276654103512111789999
Q gi|254780163|r  321 ASNLLKPALSSGAVRCIGSTTYSEYRQFFEKDKALVRRFQKIDVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAV  400 (798)
Q Consensus       321 ~an~lkP~L~rg~~~~IgatT~~ey~~~~e~d~al~rrF~~i~v~ep~~~~~~~iL~~~~~~ye~~h~v~~~~~al~~av  400 (798)
                      |||+|||+||||+|||||||||+|||||||||+||+||||+|.|+|||.++|+.||+|++++||.||+|+|+|+||++||
T Consensus       295 aaNlLKPaLarGel~~IGATT~~EYrk~iEkD~AL~RRFq~V~V~EPs~e~t~~IL~gl~~~yE~~H~V~i~d~Ai~aav  374 (823)
T CHL00095        295 AANILKPALARGKLQCIGATTLEEYRKHIEKDPALERRFQPVYVGEPSVEETIEILLGLRDRYEKHHNLSISDKALEAAA  374 (823)
T ss_pred             HHHHHHHHHHCCCCEEEEECCHHHHHHHHHCCHHHHHHCCCCCCCCCCHHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHH
T ss_conf             78876578648986699707889999985305889962684102899879999999999999987508850478999999


Q ss_pred             HHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHH-----------------------------------------------
Q ss_conf             986542015556467988998653333211443-----------------------------------------------
Q gi|254780163|r  401 QLSVRHFTSRKLPDKAIDVIDEAGASQILQPLS-----------------------------------------------  433 (798)
Q Consensus       401 ~ls~ryi~~r~lPdkAidllDea~a~~~~~~~~-----------------------------------------------  433 (798)
                      +||.|||++|+||||||||||||||++++....                                               
T Consensus       375 ~LS~RYi~dr~LPDKAIDllDeA~A~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  454 (823)
T CHL00095        375 KLSDQYIKDRFLPDKAIDLLDEAGSRVRLINKQLPPAARELDKELRHILKDKDEAIRSQDFETAKQLRDREMEVRTQIAA  454 (823)
T ss_pred             HHHHHHCCCCCCCHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHH
T ss_conf             98776403777821788889999899998732586789999999999999999999674499999999889999999999


Q ss_pred             ------------HHHCCCCHHHHHHHHHHCCCCCCHHHHHCCHHHHHHHHCCHHHHHHHCHHHHHHHHHHHHHHHHCCCC
Q ss_conf             ------------22113657899986631024531011100112334210000246653458999999999877520445
Q gi|254780163|r  434 ------------KRRKFITEKDIKKTIASMNRSIHTTSFSRDDDSVLSNLEKNLGTVVYGQEEAIKKLSSSIKIARAGLS  501 (798)
Q Consensus       434 ------------~~~~~~~~~~i~~~~~~~~~gip~~~~~~~~~~~l~~l~~~l~~~v~GQ~~ai~~v~~~i~~~~~gl~  501 (798)
                                  .....|+.+||+++|+.|+ |||+.+++.+|.++|++|+..|+++||||++||++|+++|+|+|+||+
T Consensus       455 ~~~~~~~~~~~~~~~~~v~~~dI~~vvs~~t-giPv~~~~~~e~~~l~~le~~L~~~ViGQd~AI~~vs~ai~rsraGl~  533 (823)
T CHL00095        455 MKQSKKTEEELQKEVPVVTEKDIAEIVSAWT-GIPVNKLTKSESEKLIHMEETLHKRIIGQDEAVVAVSKAIRRARVGLK  533 (823)
T ss_pred             HHHHHHHHHHHCCCCCCCCHHHHHHHHHHHH-CCCHHHHCCCHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHCCCC
T ss_conf             9999874044323677207999999999986-898476334588999878887877840769999999999999970899


Q ss_pred             CCCCCCCEEEEECCCCHHHHHHHHHHH---HHCCCCEEEEEHHHHHCCCCCCHHCCCCCHHCCCCCCCCCCHHHHHCCCE
Q ss_conf             657874068861432003889999987---30477337720688612465301104780002564443100355515851
Q gi|254780163|r  502 DPNKPIGCYVFSGPTGVGKTEISKQLA---FALGVQLLRFDMSEYMERHAVSRLIGAPPGYVGFGQGGILADSVDQNPYS  578 (798)
Q Consensus       502 ~~~rP~g~flf~GptGvGKTelak~la---~~~~~~lir~dmsey~e~~~vs~LiGappGYvG~~egg~Lte~vr~~P~s  578 (798)
                      +|+||+|||||+||||||||||||+||   |+++++|||||||||||+||||||||||||||||+|||+|||+||++|||
T Consensus       534 ~~~rPigsFlf~GPTGvGKTElAK~LA~~LFg~e~~liR~DMSEy~E~hsvsrLIGaPPGYVGy~eGG~LTeaVrr~Pys  613 (823)
T CHL00095        534 NPNRPIASFIFCGPTGVGKTELTKALASYFFGSEEAMIRLDMSEYMEKHTVSKLIGSPPGYVGYNEGGQLTEAVRKKPYT  613 (823)
T ss_pred             CCCCCCEEEEEECCCCCCHHHHHHHHHHHHCCCCCCEEEECCCCCCCCCCHHHHCCCCCCCCCCCCCCCHHHHHHCCCCE
T ss_conf             89997468998789988779999999999747820258853510155420767458998766778788201988719986


Q ss_pred             EEEECCHHHCCHHHHHHHHHHHHHHHCCCCCCCEECCCCEEEEEECCCCHHHHHHC--CCCCCCCCC------------H
Q ss_conf             77740445502899999999877750217799776125429999424214553303--689882111------------4
Q gi|254780163|r  579 VVLLDEIEKSHPDVLNILLQIMDYGILTDQSGKKISFRNVILIMTTNAGALEMSKA--RIGFGSSRN------------D  644 (798)
Q Consensus       579 Vvl~DEiEKAh~~v~~~llqild~G~ltd~~Gr~vdf~n~iii~TsN~G~~~~~~~--~~g~~~~~~------------~  644 (798)
                      ||||||||||||||||+||||||+|+|||++||+|||+|||||||||+||+.+.+.  +.||.....            .
T Consensus       614 VvLfDEIEKAHpdV~nilLQvlDdG~LtD~~Gr~vdF~NtIIImTSNlGs~~i~~~~~~~gf~~~~~~~~~~~~~~~~~~  693 (823)
T CHL00095        614 VVLFDEIEKAHPDIFNLLLQILDDGRLTDSKGRTIDFKNTLIIMTSNLGSKVIEKGGGSLGFKLLEDGTKLDEKQYKRLS  693 (823)
T ss_pred             EEEECHHHHCCHHHHHHHHHHCCCCCCCCCCCCEEECEEEEEEECCCCCHHHHHHCCCCCCCCCCCCCCCCCHHHHHHHH
T ss_conf             99862131138899998876516884348999988431039997165055888741344343334454322023589999


Q ss_pred             HHHHHHHHHHCCHHHHCCCCEEEECCCCCHHHHHHHHHHHHHHHHHHHHHCCCEEEECHHHHHHHHHCCCCCCCCCHHHH
Q ss_conf             88999998728878817768289628899999999999999999999986698899988999999971898101532679
Q gi|254780163|r  645 DADKEALRNFLSPEFLNRLDSIIPFFPLSSDIIRQVVHKFIMKLELQLQEKGISFHFSEEVINWLVSHGYDVKMGARPLE  724 (798)
Q Consensus       645 ~~~~~~l~~~f~peflnRid~ii~F~~l~~~~~~~i~~~~l~~l~~~l~~~~i~l~~~~~~~~~l~~~~~~~~~GAR~l~  724 (798)
                      +.++++++++|+|||+||||+||+|+||+.+++.+|++++|.++.+||.+++|.|++++++++||+++||||.||||||+
T Consensus       694 ~~v~~~l~~~F~PEFlnRiDeii~F~~L~~~~l~~Iv~~~l~~l~~rl~~~~i~l~~~~~a~~~l~~~gy~~~~GARpl~  773 (823)
T CHL00095        694 NLVNEELKQYFRPEFLNRLDEIIVFRPLTKDEVWEIAEIMLKELFKRLNNQGIQLEVDERFKTLLAKEGYNPLYGARPLR  773 (823)
T ss_pred             HHHHHHHHHHCCHHHHHHCCEEEEECCCCHHHHHHHHHHHHHHHHHHHHHCCCEEEECHHHHHHHHHHCCCCCCCCHHHH
T ss_conf             99999998437987873278278618999999999999999999999996898599888999999995879776813688


Q ss_pred             HHHHHHHHHHHHHHHHCCCCCCCCEEEEEEEECCCC
Q ss_conf             999986235999999629676888489999607866
Q gi|254780163|r  725 RIIKEHVKVPLADEILFGKLKKGGGVVKVSLNPDKS  760 (798)
Q Consensus       725 r~i~~~i~~~la~~il~~~~~~g~~~~~v~~~~~~~  760 (798)
                      |+|+++|++|||++||+|.+.+|++ ++|+++.+..
T Consensus       774 R~I~~~i~~~ls~~il~g~~~~g~~-v~v~~~~~g~  808 (823)
T CHL00095        774 RAIMRLLEDPLAEEVLSFKIKPGDS-LVVDVDKEGK  808 (823)
T ss_pred             HHHHHHHHHHHHHHHHCCCCCCCCE-EEEEECCCCC
T ss_conf             9999998899999997488899698-9999758997


No 3  
>PRK11034 clpA ATP-dependent Clp protease ATP-binding subunit; Provisional
Probab=100.00  E-value=0  Score=1866.43  Aligned_cols=744  Identities=51%  Similarity=0.852  Sum_probs=703.4

Q ss_pred             CCCHHHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHCHHHHHHHHHCCCCHHHHHHHHHHHHHHCCCCCCCCCCCCCCCC
Q ss_conf             34389999999999999982899511999999982074689999985999899999999996413654577888677646
Q gi|254780163|r    3 FFSENLEKVLHQALVLANERNHEYATLEHLLLALIDDSDAAIVMLSCNVDLKVLKNNLLNYIDNDSSNKLKNGFRVECKP   82 (798)
Q Consensus         3 mfS~~a~~vL~~A~~lAk~~~H~~Vt~EHLLLaLL~d~~~~~iL~~~giD~~~Lk~~Le~~L~~~~~~~~~~~~~~ei~~   82 (798)
                      |||++++.+|+.|+++|++++|+||++||||++|++++.+..+|..||+|++.++++++.++.+..+..........+.+
T Consensus         1 m~s~~l~~~L~~A~~~A~~~~H~~v~~EHlLlaLl~~~~~~~~L~~~~~d~~~l~~~l~~~i~~~~~~~~~~~~~~~~~~   80 (758)
T PRK11034          1 MLNQELELSLNMAFARAREHRHEFMTVEHLLLALLSNPSAREALEACSVDLVALRQELEAFIEQTTPVLPASEEERDTQP   80 (758)
T ss_pred             CCCHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHCCCHHHHHHHHCCCCHHHHHHHHHHHHHHCCCCCCCCCCCCCCCC
T ss_conf             98979999999999999982998322999999998694189999985999999999999999725887788877567787


Q ss_pred             CHHHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHCCCCHHHHHHHHCCCCHHHHHHHHHHHCCCCHHHHHHHHHCCCCCC
Q ss_conf             98999999999999998099812599987878737742999999984999899999998300000001112110244321
Q gi|254780163|r   83 TSSFQRVVQRAVLHVQSTGRGIVTGANILVALFSEPDSHATYFLQEQEMTLYDAVNFISHGISKRKEFANFQSKLNVDGS  162 (798)
Q Consensus        83 S~~l~rVL~~A~~~A~~~G~~~I~~eHLLLALL~e~ds~a~~iL~~~gis~~~v~~~i~~~~~~~~~~~~~~~~~~~~~~  162 (798)
                      |..++++|++|..+++.+|+++|+++|+|+||+.+.++++.++|.+++++..++.+++.+............        
T Consensus        81 t~~~~rvl~~A~~~a~~~g~~~v~~~~lLlall~e~~~~a~~~L~~~~i~~~~~~~~i~~~~~~~~~~~~~~--------  152 (758)
T PRK11034         81 TLSFQRVLQRAVFHVQSSGRSEVTGANVLVAIFSEQESQAAYLLRKHEVSRLDVVNFISHGTRKDEPSQSSD--------  152 (758)
T ss_pred             CHHHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHCCCCCHHHHHHHHCCCCHHHHHHHHHHCCCCCCCCCCCC--------
T ss_conf             778999999999999983998304999999997178558999999779988999999972243344333445--------


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHCCCCCCEEEECCCCCHHHHHH
Q ss_conf             00000124444444555544553035654425887754861122217899999999862267787489667641166899
Q gi|254780163|r  163 SAGSDGEGFVNDYQAKTDLNLFPALSAYCVDLTEKVKKGKVDILVGRHEEINRTIQILCRRSKNNPLYVGDPGVGKTAIA  242 (798)
Q Consensus       163 ~~~~~~~~~~~~~~~~~~~~~~~~LdkFg~DLTe~AreGKLDPVIGRd~EI~riiqIL~RR~KNn~~lvG~~gvGktaiv  242 (798)
                              ..............+.|++||+|||++|++||||||||||+||+|+|||||||+||||||||||||||||||
T Consensus       153 --------~~~~~~~~~~~~~~~~L~ky~~dLt~~Ar~gklDPviGR~~Ei~r~i~iL~Rr~KNNpiLvGepGVGKTAIv  224 (758)
T PRK11034        153 --------PGSQPNSEEQAGGEERMENFTTNLNQLARVGGIDPLIGREKELERAIQVLCRRRKNNPLLVGESGVGKTAIA  224 (758)
T ss_pred             --------CCCCCCCCCCCCCHHHHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHHHHHHCCCCCEEECCCCCCHHHHH
T ss_conf             --------556766533444235899985647999982899987384899999999997632589602169998699999


Q ss_pred             HHHHHHHHCCCCCHHHHEEEEEEEEHHHHHCCCCCCCHHHHHHHHHHHHHCCCCCEEEEECCHHHHHCCCCCCCCCCCHH
Q ss_conf             99999985489883452014455404675306343123789999999872038983999736166301554443447778
Q gi|254780163|r  243 EGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIESYANAILYIDEIHTLVGAGSASGISVDAS  322 (798)
Q Consensus       243 e~la~~i~~~~vp~~l~~~~i~~ld~~~l~ag~~~rg~fe~r~~~~~~~~~~~~~~ilfideih~ligag~~~g~~~d~a  322 (798)
                      ||||++|++|+||+.|+|++||+||+++|+|||+||||||+|||.|++|+++.+++||||||||||||||+++|++||||
T Consensus       225 EGLA~rI~~g~VP~~L~~~~i~~Ldl~~LiAGtkyRGefEeRlk~vi~e~~~~~~~ILFIDEiH~ivGaG~~~gg~~Daa  304 (758)
T PRK11034        225 EGLAWRIVQGDVPEVMADCTIYSLDIGSLLAGTKYRGDFEKRFKALLKQLEQDTNSILFIDEIHTIIGAGAASGGQVDAA  304 (758)
T ss_pred             HHHHHHHHCCCCCHHHCCCEEEEEEHHHHHCCCCCCHHHHHHHHHHHHHHHHCCCEEEEEECHHHHCCCCCCCCCCCCHH
T ss_conf             99999997389976558988998458778616864154999999999999857985999804344226887677764678


Q ss_pred             HHHHHHHCCCCEEEEEECCHHHHHHHHHCCHHHHHHCEEEEECCCCHHHHHHHHHHHHHHHHHHCCCEECCHHHHHHHHH
Q ss_conf             88876630266038873048999998520111432001443068786899999986127665410351211178999998
Q gi|254780163|r  323 NLLKPALSSGAVRCIGSTTYSEYRQFFEKDKALVRRFQKIDVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQL  402 (798)
Q Consensus       323 n~lkP~L~rg~~~~IgatT~~ey~~~~e~d~al~rrF~~i~v~ep~~~~~~~iL~~~~~~ye~~h~v~~~~~al~~av~l  402 (798)
                      |+|||+|+||+|||||||||+|||||||||+||+||||+|.|+|||.++|+.||+|++++||.||+|+|+|+||++||+|
T Consensus       305 NlLKP~LarG~l~~IgaTT~~EYrk~iekD~AL~RRFq~V~V~EPs~e~t~~IL~gl~~~yE~~H~v~~~d~al~~av~L  384 (758)
T PRK11034        305 NLIKPLLSSGKIRVIGSTTYQEFSNIFEKDRALARRFQKIDITEPSIEETVQIINGLKPKYEAHHDVRYTAKAVRAAVEL  384 (758)
T ss_pred             HHHHHHHHCCCCEEEEECCHHHHHHCCCCCHHHHHCCCEEECCCCCHHHHHHHHHHHHHHHHHCCCCEECCHHHHHHHHH
T ss_conf             87457874697239994377998750321478884282653189998999999998999873236957743899999999


Q ss_pred             HHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHCCCCCCHHHHHCCHHHHHHHHCCHHHHHHHCH
Q ss_conf             65420155564679889986533332114432211365789998663102453101110011233421000024665345
Q gi|254780163|r  403 SVRHFTSRKLPDKAIDVIDEAGASQILQPLSKRRKFITEKDIKKTIASMNRSIHTTSFSRDDDSVLSNLEKNLGTVVYGQ  482 (798)
Q Consensus       403 s~ryi~~r~lPdkAidllDea~a~~~~~~~~~~~~~~~~~~i~~~~~~~~~gip~~~~~~~~~~~l~~l~~~l~~~v~GQ  482 (798)
                      |.|||++|+||||||||||||||+.++....++++.++..||..++++|+ |||+.+++.++.++|++|+..|+++||||
T Consensus       385 s~rYi~dr~lPDKAIdllDea~a~~~l~~~~~~~~~v~~~di~~vv~~~t-~ip~~~~~~~~~~~l~~le~~l~~~viGQ  463 (758)
T PRK11034        385 AVKYINDRHLPDKAIDVIDEAGARARLMPVSKRKKTVNVADIESVVARIA-RIPEKSVSQSDRDTLKNLGDRLKMLVFGQ  463 (758)
T ss_pred             HHHHHCCCCCCHHHHHHHHHHHHHHHCCHHHHHCCCCCHHHHHHHHHHHH-CCCHHHHHHHHHHHHHHHHHHHHHHHHCC
T ss_conf             97650268896199999999988875134566316589999999998750-36076776779999998999987787454


Q ss_pred             HHHHHHHHHHHHHHHCCCCCCCCCCCEEEEECCCCHHHHHHHHHHHHHCCCCEEEEEHHHHHCCCCCCHHCCCCCHHCCC
Q ss_conf             89999999998775204456578740688614320038899999873047733772068861246530110478000256
Q gi|254780163|r  483 EEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFALGVQLLRFDMSEYMERHAVSRLIGAPPGYVGF  562 (798)
Q Consensus       483 ~~ai~~v~~~i~~~~~gl~~~~rP~g~flf~GptGvGKTelak~la~~~~~~lir~dmsey~e~~~vs~LiGappGYvG~  562 (798)
                      ++||++|+++|+++|+||++|+||+|||||+||||||||||||+||..++.+|||||||||||+|+||||||||||||||
T Consensus       464 ~~Ai~~v~~ai~~~raGL~~~~rPigsFlf~GPTGVGKTElak~LA~~L~~~lir~DMSEy~e~hsvsrLiGaPPGYVGy  543 (758)
T PRK11034        464 DKAIEALTEAIKMSRAGLGHEHKPVGSFLFAGPTGVGKTEVTVQLSKALGIELLRFDMSEYMERHTVSRLIGAPPGYVGF  543 (758)
T ss_pred             HHHHHHHHHHHHHHHCCCCCCCCCCEEEEEECCCCCCHHHHHHHHHHHHHHHHHCCCHHHHCCHHHHHHHCCCCCCCCCC
T ss_conf             99999999999998638889999705899978998777999999999986677214266531201477744899866676


Q ss_pred             CCCCCCCHHHHHCCCEEEEECCHHHCCHHHHHHHHHHHHHHHCCCCCCCEECCCCEEEEEECCCCHHHHHHCCCCCCCCC
Q ss_conf             44431003555158517774044550289999999987775021779977612542999942421455330368988211
Q gi|254780163|r  563 GQGGILADSVDQNPYSVVLLDEIEKSHPDVLNILLQIMDYGILTDQSGKKISFRNVILIMTTNAGALEMSKARIGFGSSR  642 (798)
Q Consensus       563 ~egg~Lte~vr~~P~sVvl~DEiEKAh~~v~~~llqild~G~ltd~~Gr~vdf~n~iii~TsN~G~~~~~~~~~g~~~~~  642 (798)
                      +|||+|||+||++|||||||||||||||+|||+||||||+|+|||++||+|||+|||||||||+|++++.+.++||....
T Consensus       544 ~eGG~Lte~Vr~~PysVvL~DEIEKAhpdV~nilLQvlD~G~LtD~~Gr~vdF~NtiIImTSN~Ga~~~~~~~~gf~~~~  623 (758)
T PRK11034        544 DQGGLLTDAVIKHPHAVLLLDEIEKAHPDVFNLLLQVMDNGTLTDNNGRKADFRNVVLVMTTNAGVRETERKSIGLIHQD  623 (758)
T ss_pred             CCCCCCCHHHHHCCCEEEEEHHHHHHCHHHHHHHHHHCCCCCCCCCCCCEEECEEEEEEEECCCCHHHHHHHCCCCCCCC
T ss_conf             77770128787398779973367563989999887323778301799998844001999825617487864214755420


Q ss_pred             CHHHHHHHHHHHCCHHHHCCCCEEEECCCCCHHHHHHHHHHHHHHHHHHHHHCCCEEEECHHHHHHHHHCCCCCCCCCHH
Q ss_conf             14889999987288788177682896288999999999999999999999866988999889999999718981015326
Q gi|254780163|r  643 NDDADKEALRNFLSPEFLNRLDSIIPFFPLSSDIIRQVVHKFIMKLELQLQEKGISFHFSEEVINWLVSHGYDVKMGARP  722 (798)
Q Consensus       643 ~~~~~~~~l~~~f~peflnRid~ii~F~~l~~~~~~~i~~~~l~~l~~~l~~~~i~l~~~~~~~~~l~~~~~~~~~GAR~  722 (798)
                      .....+++++++|+|||+||||+||+|+||+.+++.+|++++|.++.++|++++|.+++++++++||+++||||.|||||
T Consensus       624 ~~~~~~~~l~~~F~PEFlNRiD~ii~F~~L~~~~l~~Iv~~~l~~l~~rL~~~~i~l~~~~~a~~~l~~~gyd~~~GARp  703 (758)
T PRK11034        624 NSTDAMEEIKKIFTPEFRNRLDNIIWFDHLSTDVIHQVVDKFIVELQAQLDQKGVSLEVSQEARDWLAEKGYDRAMGARP  703 (758)
T ss_pred             CHHHHHHHHHHHCCHHHHHHCCEEEEECCCCHHHHHHHHHHHHHHHHHHHHHCCCEEEECHHHHHHHHHHCCCCCCCCCH
T ss_conf             35999999995479867723674786388999999999999999999999978985998899999999848894537112


Q ss_pred             HHHHHHHHHHHHHHHHHHCCCCCCCCEEEEEEEECCCCCCCC
Q ss_conf             799999862359999996296768884899996078665542
Q gi|254780163|r  723 LERIIKEHVKVPLADEILFGKLKKGGGVVKVSLNPDKSASSP  764 (798)
Q Consensus       723 l~r~i~~~i~~~la~~il~~~~~~g~~~~~v~~~~~~~~~~~  764 (798)
                      |+|+|+++|++|||++||+|++++|++ ++|+++.++....+
T Consensus       704 l~R~I~~~i~~~La~~il~g~~~~g~~-v~v~~~~~~~~l~f  744 (758)
T PRK11034        704 MARVIQDNLKKPLANELLFGSLVDGGQ-VTVALDKEKNELTY  744 (758)
T ss_pred             HHHHHHHHHHHHHHHHHHCCCCCCCCE-EEEEEECCCCEEEE
T ss_conf             889999998899999997298889898-99999789987999


No 4  
>PRK10865 protein disaggregation chaperone; Provisional
Probab=100.00  E-value=0  Score=1860.06  Aligned_cols=727  Identities=40%  Similarity=0.688  Sum_probs=669.2

Q ss_pred             CCC--CCHHHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHCH--HHHHHHHHCCCCHHHHHHHHHHHHHHCCCCCCCCCC
Q ss_conf             973--4389999999999999982899511999999982074--689999985999899999999996413654577888
Q gi|254780163|r    1 MSF--FSENLEKVLHQALVLANERNHEYATLEHLLLALIDDS--DAAIVMLSCNVDLKVLKNNLLNYIDNDSSNKLKNGF   76 (798)
Q Consensus         1 M~m--fS~~a~~vL~~A~~lAk~~~H~~Vt~EHLLLaLL~d~--~~~~iL~~~giD~~~Lk~~Le~~L~~~~~~~~~~~~   76 (798)
                      |++  ||++++++|+.|+.+|++++|.||++||||++|+.++  .+..+|..+|+|...++++++.++...+...   +.
T Consensus         1 m~~~k~t~~~~~al~~A~~~A~~~~h~~v~~eHll~all~~~~~~~~~~l~~~~~d~~~l~~~l~~~l~~~~~~~---~~   77 (857)
T PRK10865          1 MRLDRLTNKFQLALADAQSLALGHDNQFIEPLHLMSALLNQEGGSVRPLLTSAGINAGQLRTDINQALNRLPQVE---GT   77 (857)
T ss_pred             CCHHHCCHHHHHHHHHHHHHHHHCCCCEEHHHHHHHHHHCCCCCHHHHHHHHCCCCHHHHHHHHHHHHHHCCCCC---CC
T ss_conf             981553999999999999999985988435999999997699747999999869999999999999986278878---98


Q ss_pred             CCCCCCCHHHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHCCCCHHHHHHHHCCCCHHHHHHHHHHHCCCCHHHHHHHHH
Q ss_conf             67764698999999999999998099812599987878737742999999984999899999998300000001112110
Q gi|254780163|r   77 RVECKPTSSFQRVVQRAVLHVQSTGRGIVTGANILVALFSEPDSHATYFLQEQEMTLYDAVNFISHGISKRKEFANFQSK  156 (798)
Q Consensus        77 ~~ei~~S~~l~rVL~~A~~~A~~~G~~~I~~eHLLLALL~e~ds~a~~iL~~~gis~~~v~~~i~~~~~~~~~~~~~~~~  156 (798)
                      ...+.+|+.+.++|+.|+..++.+++++|+++|+|+|++.+. +....+|...|++...+...+.......         
T Consensus        78 ~~~~~~s~~~~~~l~~a~~~a~~~~~~~i~~~~llla~l~~~-~~~~~~l~~~~~~~~~~~~~~~~~~~~~---------  147 (857)
T PRK10865         78 GGDVQPSQDLVRVLNLCDKLAQKRGDNFISSELFVLAALESR-GTLADILKAAGATTANITQAIEQMRGGE---------  147 (857)
T ss_pred             CCCCCCCHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHCCC-CHHHHHHHHCCCCHHHHHHHHHHHHCCC---------
T ss_conf             888087879999999999999985998242999999997188-7799999987999999999999871788---------


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHCCCCCCEEEECCCCC
Q ss_conf             24432100000124444444555544553035654425887754861122217899999999862267787489667641
Q gi|254780163|r  157 LNVDGSSAGSDGEGFVNDYQAKTDLNLFPALSAYCVDLTEKVKKGKVDILVGRHEEINRTIQILCRRSKNNPLYVGDPGV  236 (798)
Q Consensus       157 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LdkFg~DLTe~AreGKLDPVIGRd~EI~riiqIL~RR~KNn~~lvG~~gv  236 (798)
                                       ...........++|++||+|||++|++|+||||||||+||+|++||||||+||||||||||||
T Consensus       148 -----------------~~~~~~~~~~~~~L~~y~~dLt~~A~~gkldpvIGRd~EI~r~i~IL~RR~KNNpiLvGepGV  210 (857)
T PRK10865        148 -----------------SVNDQGAEDQRQALKKYTIDLTERAEQGKLDPVIGRDEEIRRTIQVLQRRTKNNPVLIGEPGV  210 (857)
T ss_pred             -----------------CCCCCCCCCCHHHHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHHHHCCCCCCCEEECCCCC
T ss_conf             -----------------887788664236899997888999982999988582999999999970257899758789998


Q ss_pred             HHHHHHHHHHHHHHCCCCCHHHHEEEEEEEEHHHHHCCCCCCCHHHHHHHHHHHHHC-CCCCEEEEECCHHHHHCCCCCC
Q ss_conf             166899999999854898834520144554046753063431237899999998720-3898399973616630155444
Q gi|254780163|r  237 GKTAIAEGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIE-SYANAILYIDEIHTLVGAGSAS  315 (798)
Q Consensus       237 Gktaive~la~~i~~~~vp~~l~~~~i~~ld~~~l~ag~~~rg~fe~r~~~~~~~~~-~~~~~ilfideih~ligag~~~  315 (798)
                      ||||||||||++|++|+||+.|+|++||+||+++|+|||+||||||+|||.|++++. +.+++||||||||||||||+++
T Consensus       211 GKTAIvEGLA~rI~~g~VP~~L~~~~I~~LDlg~L~AGakyRGeFEeRLk~il~ev~~~~~~iILFIDEiHtlvGaG~~~  290 (857)
T PRK10865        211 GKTAIVEGLAQRIINGEVPEGLKGRRVLALDMGALVAGAKYRGEFEERLKGVLNDLAKQEGNVILFIDELHTMVGAGKAD  290 (857)
T ss_pred             CHHHHHHHHHHHHHCCCCCHHHCCCCEEEEEHHHHHHCCCCCHHHHHHHHHHHHHHHHCCCCEEEEECCHHHHCCCCCCC
T ss_conf             89999999999998389997881690247338878614765211799999999999847898699973435433688777


Q ss_pred             CCCCCHHHHHHHHHCCCCEEEEEECCHHHHHHHHHCCHHHHHHCEEEEECCCCHHHHHHHHHHHHHHHHHHCCCEECCHH
Q ss_conf             34477788887663026603887304899999852011143200144306878689999998612766541035121117
Q gi|254780163|r  316 GISVDASNLLKPALSSGAVRCIGSTTYSEYRQFFEKDKALVRRFQKIDVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEA  395 (798)
Q Consensus       316 g~~~d~an~lkP~L~rg~~~~IgatT~~ey~~~~e~d~al~rrF~~i~v~ep~~~~~~~iL~~~~~~ye~~h~v~~~~~a  395 (798)
                      | ++||||||||+||||+|||||||||+|||||||||+||+||||+|.|+|||.++|+.||+|++++||.||+|+|+|+|
T Consensus       291 G-~~DaaNlLKPaLaRGelr~IGATT~~EYrk~iEkD~AL~RRFq~V~V~EPs~e~ti~ILrgl~~~yE~hH~V~itdeA  369 (857)
T PRK10865        291 G-AMDAGNMLKPALARGELHCVGATTLDEYRQYIEKDAALERRFQKVFVAEPSVEDTIAILRGLKERYELHHHVQITDPA  369 (857)
T ss_pred             C-CCCHHHHHHHHHHCCCCEEEEECCHHHHHHHCCCCHHHHHHCCCCCCCCCCHHHHHHHHHHHHHHHHHCCCCEECHHH
T ss_conf             7-534788867887379854999458999998713458899853710068998799999999888899873791587999


Q ss_pred             HHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHH-----------------------------------------
Q ss_conf             899999865420155564679889986533332114432-----------------------------------------
Q gi|254780163|r  396 IRAAVQLSVRHFTSRKLPDKAIDVIDEAGASQILQPLSK-----------------------------------------  434 (798)
Q Consensus       396 l~~av~ls~ryi~~r~lPdkAidllDea~a~~~~~~~~~-----------------------------------------  434 (798)
                      |.+||+||.|||++|+||||||||||||||++++.....                                         
T Consensus       370 l~aAV~LS~RYI~dR~LPDKAIDLLDeA~A~vr~~~~~~p~~l~~l~~~i~~l~~~~~~l~~~~~~~~~~~~~~~~~~~~  449 (857)
T PRK10865        370 IVAAATLSHRYIADRQLPDKAIDLIDEAASSIRMQIDSKPEELDRLDRRIIQLKLEQQALMKESDEASKKRLDMLNEELS  449 (857)
T ss_pred             HHHHHHHHHCCCCCCCCCHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHH
T ss_conf             99999986245666678148988999998888763246844689999999999999999884100778999999999999


Q ss_pred             -----------------------------------------------------------------------------HHC
Q ss_conf             -----------------------------------------------------------------------------211
Q gi|254780163|r  435 -----------------------------------------------------------------------------RRK  437 (798)
Q Consensus       435 -----------------------------------------------------------------------------~~~  437 (798)
                                                                                                   -+.
T Consensus       450 ~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~e~~~~~~~~~~~~el~~~~ip~~e~~l~~~~~~~~~~~~~~~~  529 (857)
T PRK10865        450 DKERQYSELEEEWKAEKASLSGTQTIKAELEQAKIAIEQARRVGDLARMSELQYGKIPELEKQLEAATQLEGKTMRLLRN  529 (857)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHCHHHHHHHHHHHHHHHHCCCCCHHHC
T ss_conf             99999999999999999999889999999999888899988641376677765220188999999998753001102223


Q ss_pred             CCCHHHHHHHHHHCCCCCCHHHHHCCHHHHHHHHCCHHHHHHHCHHHHHHHHHHHHHHHHCCCCCCCCCCCEEEEECCCC
Q ss_conf             36578999866310245310111001123342100002466534589999999998775204456578740688614320
Q gi|254780163|r  438 FITEKDIKKTIASMNRSIHTTSFSRDDDSVLSNLEKNLGTVVYGQEEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTG  517 (798)
Q Consensus       438 ~~~~~~i~~~~~~~~~gip~~~~~~~~~~~l~~l~~~l~~~v~GQ~~ai~~v~~~i~~~~~gl~~~~rP~g~flf~GptG  517 (798)
                      .|+..||+++++.|+ |||+.++..+|.++|++|+..|+++||||++||++|+++|+++|+||++|+||+|||||+||||
T Consensus       530 ~V~~~~ia~vvs~~T-gIPv~~l~~~e~~~L~~le~~L~~rViGQd~AI~~v~~aI~~sraGL~dp~rPiGsFLFlGPTG  608 (857)
T PRK10865        530 KVTDAEIAEVLARWT-GIPVSRMLESEREKLLRMEQELHHRVIGQNEAVEAVSNAIRRSRAGLSDPNRPIGSFLFLGPTG  608 (857)
T ss_pred             CCCHHHHHHHHHHHH-CCCCHHCCCCHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHCCCCCCCCCEEEEEEECCCC
T ss_conf             568999999999996-8983021310589999999999878528099999999999998638999999738999868987


Q ss_pred             HHHHHHHHHHH---HHCCCCEEEEEHHHHHCCCCCCHHCCCCCHHCCCCCCCCCCHHHHHCCCEEEEECCHHHCCHHHHH
Q ss_conf             03889999987---304773377206886124653011047800025644431003555158517774044550289999
Q gi|254780163|r  518 VGKTEISKQLA---FALGVQLLRFDMSEYMERHAVSRLIGAPPGYVGFGQGGILADSVDQNPYSVVLLDEIEKSHPDVLN  594 (798)
Q Consensus       518 vGKTelak~la---~~~~~~lir~dmsey~e~~~vs~LiGappGYvG~~egg~Lte~vr~~P~sVvl~DEiEKAh~~v~~  594 (798)
                      ||||||||+||   |+++.+|||||||||||+||||||||||||||||+|||+|||+||++|||||||||||||||||+|
T Consensus       609 VGKTElAK~LA~~LF~~e~~liriDMSEy~E~hsVSrLiGaPPGYVGy~eGG~LTeaVRr~PySVvLfDEIEKAHpdV~n  688 (857)
T PRK10865        609 VGKTELCKALANFMFDSDDAMVRIDMSEFMEKHSVSRLVGAPPGYVGYEEGGYLTEAVRRRPYSVILLDEVEKAHPDVFN  688 (857)
T ss_pred             CCHHHHHHHHHHHHHCCHHHEEEECCHHHCCCHHHHHHCCCCCCCCCCCCCCCHHHHHHHCCCEEEEEHHHHHHCHHHHH
T ss_conf             88899999999998389334256253321130127675589987667577881109998198778863257663858999


Q ss_pred             HHHHHHHHHHCCCCCCCEECCCCEEEEEECCCCHHHHHHCCCCCCCCCCHHHHHHHHHHHCCHHHHCCCCEEEECCCCCH
Q ss_conf             99998777502177997761254299994242145533036898821114889999987288788177682896288999
Q gi|254780163|r  595 ILLQIMDYGILTDQSGKKISFRNVILIMTTNAGALEMSKARIGFGSSRNDDADKEALRNFLSPEFLNRLDSIIPFFPLSS  674 (798)
Q Consensus       595 ~llqild~G~ltd~~Gr~vdf~n~iii~TsN~G~~~~~~~~~g~~~~~~~~~~~~~l~~~f~peflnRid~ii~F~~l~~  674 (798)
                      +||||||+|+|||++||+|||+|||||||||+||+.+.+..-........+.++++++++|+|||+||||+||+|+||+.
T Consensus       689 ilLQvlD~G~LtD~~Gr~vdF~NtIIImTSN~Gs~~i~~~~~~~~~~~~~~~~~~~l~~~F~PEFlnRiD~iv~F~pL~~  768 (857)
T PRK10865        689 ILLQVLDDGRLTDGQGRTVDFRNTVVIMTSNLGSDLIQERFGELDYAHMKELVLGVVSHNFRPEFINRIDEVVVFHPLGE  768 (857)
T ss_pred             HHHHHHCCCEEECCCCCEEEEEEEEEEECCCHHHHHHHHHCCCCCHHHHHHHHHHHHHHHCCHHHHHCCCEEEEECCCCH
T ss_conf             99987036832079998885133489964623369998650655668899999999986479888823784898278999


Q ss_pred             HHHHHHHHHHHHHHHHHHHHCCCEEEECHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHHHHHHHHHCCCCCCCCEEEEEE
Q ss_conf             99999999999999999986698899988999999971898101532679999986235999999629676888489999
Q gi|254780163|r  675 DIIRQVVHKFIMKLELQLQEKGISFHFSEEVINWLVSHGYDVKMGARPLERIIKEHVKVPLADEILFGKLKKGGGVVKVS  754 (798)
Q Consensus       675 ~~~~~i~~~~l~~l~~~l~~~~i~l~~~~~~~~~l~~~~~~~~~GAR~l~r~i~~~i~~~la~~il~~~~~~g~~~~~v~  754 (798)
                      +++.+|++++|.++.+||.+++|.+++++++++||+++||||+||||||+|+|+++|++|||++||+|++++|++ +.|+
T Consensus       769 ~~l~~Iv~~~l~~l~~rL~~~~i~l~~~~~a~~~l~~~gyd~~~GARpl~r~I~~~i~~~ls~~il~g~~~~g~~-i~v~  847 (857)
T PRK10865        769 QHIASIAQIQLQRLYKRLEERGYEIHISDEALKLLSENGYDPVYGARPLKRAIQQQIENPLAQQILSGELVPGKV-IRLE  847 (857)
T ss_pred             HHHHHHHHHHHHHHHHHHHHCCCEEEECHHHHHHHHHHCCCCCCCHHHHHHHHHHHHHHHHHHHHHCCCCCCCCE-EEEE
T ss_conf             999999999999999999977984998889999999848897747137899999998899999997288899698-9999


Q ss_pred             EECCCC
Q ss_conf             607866
Q gi|254780163|r  755 LNPDKS  760 (798)
Q Consensus       755 ~~~~~~  760 (798)
                      +..++.
T Consensus       848 ~~~~~~  853 (857)
T PRK10865        848 VNEDRI  853 (857)
T ss_pred             EECCEE
T ss_conf             779988


No 5  
>TIGR03346 chaperone_ClpB ATP-dependent chaperone ClpB. Members of this protein family are the bacterial ATP-dependent chaperone ClpB. This protein belongs to the AAA family, ATPases associated with various cellular activities (pfam00004). This molecular chaperone does not act as a protease, but rather serves to disaggregate misfolded and aggregated proteins.
Probab=100.00  E-value=0  Score=1859.72  Aligned_cols=725  Identities=42%  Similarity=0.701  Sum_probs=676.2

Q ss_pred             CCHHHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHCHH--HHHHHHHCCCCHHHHHHHHHHHHHHCCCCCCCCCCCCCCC
Q ss_conf             43899999999999999828995119999999820746--8999998599989999999999641365457788867764
Q gi|254780163|r    4 FSENLEKVLHQALVLANERNHEYATLEHLLLALIDDSD--AAIVMLSCNVDLKVLKNNLLNYIDNDSSNKLKNGFRVECK   81 (798)
Q Consensus         4 fS~~a~~vL~~A~~lAk~~~H~~Vt~EHLLLaLL~d~~--~~~iL~~~giD~~~Lk~~Le~~L~~~~~~~~~~~~~~ei~   81 (798)
                      ||++++++|+.|+++|++++|.||++||||++|++++.  +..+|..+|+|.+.++++++.++++.+..   .+....|.
T Consensus         1 ft~~a~~aL~~A~~~A~~~~h~~V~~eHlLlaLl~~~~~~~~~~L~~~gvd~~~l~~~l~~~l~~~~~~---~~~~~~~~   77 (852)
T TIGR03346         1 FTEKFQEALQAAQSLALGRDHQQIEPEHLLKALLDQEGGLARRLLQKAGVNVGALRQALEKELEKLPKV---SGPGGQVY   77 (852)
T ss_pred             CCHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHCCCCCHHHHHHHHCCCCHHHHHHHHHHHHHHCCCC---CCCCCCCC
T ss_conf             988999999999999998599902799999999739984799999985989999999999999737988---89988828


Q ss_pred             CCHHHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHCCCCHHHHHHHHCCCCHHHHHHHHHHHCCCCHHHHHHHHHCCCCC
Q ss_conf             69899999999999999809981259998787873774299999998499989999999830000000111211024432
Q gi|254780163|r   82 PTSSFQRVVQRAVLHVQSTGRGIVTGANILVALFSEPDSHATYFLQEQEMTLYDAVNFISHGISKRKEFANFQSKLNVDG  161 (798)
Q Consensus        82 ~S~~l~rVL~~A~~~A~~~G~~~I~~eHLLLALL~e~ds~a~~iL~~~gis~~~v~~~i~~~~~~~~~~~~~~~~~~~~~  161 (798)
                      +|+.++++|++|+.+|..+|+++|+++|||+||+.+.++ +..+|..+|++...+...+.......              
T Consensus        78 ~s~~~~~vL~~A~~~a~~~~~~~I~~~hlLlall~~~~~-~~~~l~~~gi~~~~l~~~l~~~~~~~--------------  142 (852)
T TIGR03346        78 LSPELNRLLNLAEKLAQKRGDEFISSEHLLLALLDDKGT-LGKLLKEAGATADALEAAINAVRGGQ--------------  142 (852)
T ss_pred             CCHHHHHHHHHHHHHHHHCCCCEECHHHHHHHHHCCCCH-HHHHHHHCCCCHHHHHHHHHHHHCCC--------------
T ss_conf             698999999999999998499977399999999709855-99999986999999999999871788--------------


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHCCCCCCEEEECCCCCHHHHH
Q ss_conf             10000012444444455554455303565442588775486112221789999999986226778748966764116689
Q gi|254780163|r  162 SSAGSDGEGFVNDYQAKTDLNLFPALSAYCVDLTEKVKKGKVDILVGRHEEINRTIQILCRRSKNNPLYVGDPGVGKTAI  241 (798)
Q Consensus       162 ~~~~~~~~~~~~~~~~~~~~~~~~~LdkFg~DLTe~AreGKLDPVIGRd~EI~riiqIL~RR~KNn~~lvG~~gvGktai  241 (798)
                                  ......+....++|++||+|||++|++|++|||||||+||+|+|||||||+|||||||||||||||||
T Consensus       143 ------------~~~~~~~~~~~~~L~~y~~dLT~~A~~gklDpviGRd~Ei~r~i~IL~Rr~KNNpiLVGepGVGKTAI  210 (852)
T TIGR03346       143 ------------KVTSANAEDQYEALEKYARDLTERAREGKLDPVIGRDEEIRRTIQVLSRRTKNNPVLIGEPGVGKTAI  210 (852)
T ss_pred             ------------CCCCCCCCCCHHHHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHHHHHHCCCCCCEECCCCCCHHHH
T ss_conf             ------------88888875435789999888999998289997738369999999999873248972127999879999


Q ss_pred             HHHHHHHHHCCCCCHHHHEEEEEEEEHHHHHCCCCCCCHHHHHHHHHHHHHCCC-CCEEEEECCHHHHHCCCCCCCCCCC
Q ss_conf             999999985489883452014455404675306343123789999999872038-9839997361663015544434477
Q gi|254780163|r  242 AEGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIESY-ANAILYIDEIHTLVGAGSASGISVD  320 (798)
Q Consensus       242 ve~la~~i~~~~vp~~l~~~~i~~ld~~~l~ag~~~rg~fe~r~~~~~~~~~~~-~~~ilfideih~ligag~~~g~~~d  320 (798)
                      |||||++|++|+||+.|+|++||+||+++|+|||+||||||+|||.|++|++++ +++||||||||||||||+++| ++|
T Consensus       211 vEGLA~rI~~g~VP~~L~~~~i~~LDlg~LvAGtkyRGeFEeRlk~ii~ev~~~~~~iILFIDEiHtliGaG~~~G-~~D  289 (852)
T TIGR03346       211 VEGLAQRIVNGDVPESLKNKRLLALDMGALIAGAKYRGEFEERLKAVLNEVTKSEGQIILFIDELHTLVGAGKAEG-AMD  289 (852)
T ss_pred             HHHHHHHHHCCCCCHHHHHCCCEEEEHHHHHCCCCCCHHHHHHHHHHHHHHHHCCCCEEEEEHHHHHHCCCCCCCC-CCC
T ss_conf             9999999866999978851851275288775215300789999999999998589987999612555326887666-410


Q ss_pred             HHHHHHHHHCCCCEEEEEECCHHHHHHHHHCCHHHHHHCEEEEECCCCHHHHHHHHHHHHHHHHHHCCCEECCHHHHHHH
Q ss_conf             78888766302660388730489999985201114320014430687868999999861276654103512111789999
Q gi|254780163|r  321 ASNLLKPALSSGAVRCIGSTTYSEYRQFFEKDKALVRRFQKIDVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAV  400 (798)
Q Consensus       321 ~an~lkP~L~rg~~~~IgatT~~ey~~~~e~d~al~rrF~~i~v~ep~~~~~~~iL~~~~~~ye~~h~v~~~~~al~~av  400 (798)
                      |||||||+||||+|||||||||+|||||||||+||+||||+|.|+|||.++|+.||+|++++||.||+|+|+|+||++||
T Consensus       290 AaNlLKPaLarGelr~IgATT~~EYrk~iEkD~AL~RRFq~I~V~EPs~e~t~~IL~gl~~~yE~hH~V~i~d~Ai~aav  369 (852)
T TIGR03346       290 AGNMLKPALARGELHCIGATTLDEYRKYIEKDAALERRFQPVFVDEPTVEDTISILRGLKERYEVHHGVRITDPAIVAAA  369 (852)
T ss_pred             HHHHHHHHHHCCCCEEEEECCHHHHHHHHHCCHHHHHHCCCCCCCCCCHHHHHHHHHHHHHHHHHCCCCEECHHHHHHHH
T ss_conf             67774378747985599827899999883226889973771204799868999999976999976279267399999999


Q ss_pred             HHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHH----------------------------------------------
Q ss_conf             9865420155564679889986533332114432----------------------------------------------
Q gi|254780163|r  401 QLSVRHFTSRKLPDKAIDVIDEAGASQILQPLSK----------------------------------------------  434 (798)
Q Consensus       401 ~ls~ryi~~r~lPdkAidllDea~a~~~~~~~~~----------------------------------------------  434 (798)
                      +||.|||++|+||||||||||||||++++.....                                              
T Consensus       370 ~LS~RYi~~R~LPDKAIDlLDeA~a~~~~~~~~~p~~l~~~~~~~~~l~~e~~~l~~e~d~~~~~~~~~~~~~~~~l~~~  449 (852)
T TIGR03346       370 TLSHRYITDRFLPDKAIDLIDEAAARIRMEIDSKPEELDELDRRIIQLEIEREALKKEKDEASKERLEDLEKELAELEEE  449 (852)
T ss_pred             HHHCCCCCCCCCCHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHCHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             97134667788961899999999998876237894679999999999999999998443066799999999999999999


Q ss_pred             --------------------------------------------------------------------------HHCCCC
Q ss_conf             --------------------------------------------------------------------------211365
Q gi|254780163|r  435 --------------------------------------------------------------------------RRKFIT  440 (798)
Q Consensus       435 --------------------------------------------------------------------------~~~~~~  440 (798)
                                                                                                -+..|+
T Consensus       450 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~V~  529 (852)
T TIGR03346       450 YADLEEQWKAEKAAIQGIQQIKEEIEQVRLELEQAEREGDLAKAAELQYGKLPELEKRLQAAEAKLGEETKPRLLREEVT  529 (852)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCC
T ss_conf             99999999999999999999999999999889999875047777775432279999999999987641123442336679


Q ss_pred             HHHHHHHHHHCCCCCCHHHHHCCHHHHHHHHCCHHHHHHHCHHHHHHHHHHHHHHHHCCCCCCCCCCCEEEEECCCCHHH
Q ss_conf             78999866310245310111001123342100002466534589999999998775204456578740688614320038
Q gi|254780163|r  441 EKDIKKTIASMNRSIHTTSFSRDDDSVLSNLEKNLGTVVYGQEEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGK  520 (798)
Q Consensus       441 ~~~i~~~~~~~~~gip~~~~~~~~~~~l~~l~~~l~~~v~GQ~~ai~~v~~~i~~~~~gl~~~~rP~g~flf~GptGvGK  520 (798)
                      ..||+++|++|+ |||+.+++.+|.++|++|++.|+++||||++||++|+++|+++++||++|+||+|||||+|||||||
T Consensus       530 ~~~ia~vvs~~t-gIPv~~~~~~e~~~L~~Le~~L~~rViGQd~AI~~I~~aI~~sraGL~dp~rP~GsFlf~GptGvGK  608 (852)
T TIGR03346       530 AEEIAEVVSRWT-GIPVSKMLEGEREKLLHMEEVLHERVVGQDEAVEAVSDAIRRSRAGLSDPNRPIGSFLFLGPTGVGK  608 (852)
T ss_pred             HHHHHHHHHHHH-CCCHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHCCCCCCCCCCEEEEEECCCCCCH
T ss_conf             999999999996-8866766654799998788889989717099999999999999718888999745899867887768


Q ss_pred             HHHHHHHH---HHCCCCEEEEEHHHHHCCCCCCHHCCCCCHHCCCCCCCCCCHHHHHCCCEEEEECCHHHCCHHHHHHHH
Q ss_conf             89999987---304773377206886124653011047800025644431003555158517774044550289999999
Q gi|254780163|r  521 TEISKQLA---FALGVQLLRFDMSEYMERHAVSRLIGAPPGYVGFGQGGILADSVDQNPYSVVLLDEIEKSHPDVLNILL  597 (798)
Q Consensus       521 Telak~la---~~~~~~lir~dmsey~e~~~vs~LiGappGYvG~~egg~Lte~vr~~P~sVvl~DEiEKAh~~v~~~ll  597 (798)
                      |||||+||   |+++++|||||||||||+||||||||||||||||++||+|||+||++|||||||||||||||+|+|+||
T Consensus       609 TELAKaLAe~Lfg~~~~LIriDMSEy~E~hsvsrLiGaPPGYVGy~egG~Lte~vr~~PysVvL~DEIEKAh~~V~~~lL  688 (852)
T TIGR03346       609 TELAKALAEFLFDDEDAMVRIDMSEYMEKHSVARLIGAPPGYVGYEEGGQLTEAVRRKPYSVVLFDEVEKAHPDVFNVLL  688 (852)
T ss_pred             HHHHHHHHHHHHCCCCCEEEECHHHHCCHHHHHHHCCCCCCCCCCCCCCEECHHHHHCCCEEEEECCHHHHCHHHHHHHH
T ss_conf             99999999998558520698430443012247785589997677687874239898198879985305430768999999


Q ss_pred             HHHHHHHCCCCCCCEECCCCEEEEEECCCCHHHHHHCCCCCCCCCCHHHHHHHHHHHCCHHHHCCCCEEEECCCCCHHHH
Q ss_conf             98777502177997761254299994242145533036898821114889999987288788177682896288999999
Q gi|254780163|r  598 QIMDYGILTDQSGKKISFRNVILIMTTNAGALEMSKARIGFGSSRNDDADKEALRNFLSPEFLNRLDSIIPFFPLSSDII  677 (798)
Q Consensus       598 qild~G~ltd~~Gr~vdf~n~iii~TsN~G~~~~~~~~~g~~~~~~~~~~~~~l~~~f~peflnRid~ii~F~~l~~~~~  677 (798)
                      ||||+|+|||+.||+|||+|||||||||+|++.+.+...++..+...+.++++++++|+|||+||||+||+|+||+.+++
T Consensus       689 QilD~G~ltD~~Gr~vdF~NtiiimTSN~Ga~~i~~~~~~~~~~~~~~~~~~~~~~~F~PEflnRid~ii~F~~L~~~~l  768 (852)
T TIGR03346       689 QVLDDGRLTDGQGRTVDFRNTVIIMTSNLGSQFIQELAGGDDYEEMREAVMEVLRAHFRPEFLNRIDEIVVFHPLGREQI  768 (852)
T ss_pred             HHHCCCEEECCCCCEEEEEEEEEEEECCCCHHHHHHHCCCCCHHHHHHHHHHHHHHHCCHHHHHHCCEEEEECCCCHHHH
T ss_conf             88236743079998885355689861540659997411455579999999999996589989963786898378999999


Q ss_pred             HHHHHHHHHHHHHHHHHCCCEEEECHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHHHHHHHHHCCCCCCCCEEEEEEEEC
Q ss_conf             99999999999999986698899988999999971898101532679999986235999999629676888489999607
Q gi|254780163|r  678 RQVVHKFIMKLELQLQEKGISFHFSEEVINWLVSHGYDVKMGARPLERIIKEHVKVPLADEILFGKLKKGGGVVKVSLNP  757 (798)
Q Consensus       678 ~~i~~~~l~~l~~~l~~~~i~l~~~~~~~~~l~~~~~~~~~GAR~l~r~i~~~i~~~la~~il~~~~~~g~~~~~v~~~~  757 (798)
                      .+|+++++.++.++|++++|.+.+++++++||+++|||+.||||||+|+|++.|++|||++||+|++++|++ ++|++..
T Consensus       769 ~~I~~~~l~~l~~~l~~~~i~l~~~~~~~~~l~~~g~~~~~GAR~l~r~i~~~i~~~la~~iL~g~~~~g~~-v~v~~~~  847 (852)
T TIGR03346       769 ARIVEIQLGRLRKRLAERKITLELSDAALDFLAEAGYDPVYGARPLKRAIQREIENPLAKKILAGEVADGDT-IVVDVEG  847 (852)
T ss_pred             HHHHHHHHHHHHHHHHHCCCEEEECHHHHHHHHHHCCCCCCCHHHHHHHHHHHHHHHHHHHHHCCCCCCCCE-EEEEEEC
T ss_conf             999999999999999977984998889999999848897747156999999998899999997488899598-9999779


Q ss_pred             CCCC
Q ss_conf             8665
Q gi|254780163|r  758 DKSA  761 (798)
Q Consensus       758 ~~~~  761 (798)
                      ++..
T Consensus       848 ~~~~  851 (852)
T TIGR03346       848 GRLV  851 (852)
T ss_pred             CEEE
T ss_conf             9975


No 6  
>COG0542 clpA ATP-binding subunits of Clp protease and DnaK/DnaJ chaperones [Posttranslational modification, protein turnover, chaperones]
Probab=100.00  E-value=0  Score=1854.19  Aligned_cols=722  Identities=49%  Similarity=0.790  Sum_probs=668.6

Q ss_pred             CCCHHHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHCHHHHHHHHHCCCCHHHHHHHHHHHHHHCCCCCCCCCCCCCCCC
Q ss_conf             34389999999999999982899511999999982074689999985999899999999996413654577888677646
Q gi|254780163|r    3 FFSENLEKVLHQALVLANERNHEYATLEHLLLALIDDSDAAIVMLSCNVDLKVLKNNLLNYIDNDSSNKLKNGFRVECKP   82 (798)
Q Consensus         3 mfS~~a~~vL~~A~~lAk~~~H~~Vt~EHLLLaLL~d~~~~~iL~~~giD~~~Lk~~Le~~L~~~~~~~~~~~~~~ei~~   82 (798)
                      |||++++++|..|+++|+.++|+||++||||++|++++....++..+|++++.++..++.++.+.+....     . +.+
T Consensus         1 ~~~~~~~~~l~~a~~~a~~~~h~~~~~eHll~~ll~~~~~~~~l~~~~~~~~~l~~~~~~~~~~~~~~~~-----~-~~~   74 (786)
T COG0542           1 KLTERAQKALELAQELARMRRHEYVTPEHLLLALLDQPKGDELLNLCGIDLDKLRQELEEFIDKLPKVLG-----S-PYL   74 (786)
T ss_pred             CCCHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHCCCCHHHHHHHCCCCHHHHHHHHHHHHHCCCCCCC-----C-CCC
T ss_conf             9488999999999999998579866599999999748631799987499999999999999842677777-----7-787


Q ss_pred             CHHHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHCCCCHHHHHHHHCCCCHHHHHHHHHHHCCCCHHHHHHHHHCCCCCC
Q ss_conf             98999999999999998099812599987878737742999999984999899999998300000001112110244321
Q gi|254780163|r   83 TSSFQRVVQRAVLHVQSTGRGIVTGANILVALFSEPDSHATYFLQEQEMTLYDAVNFISHGISKRKEFANFQSKLNVDGS  162 (798)
Q Consensus        83 S~~l~rVL~~A~~~A~~~G~~~I~~eHLLLALL~e~ds~a~~iL~~~gis~~~v~~~i~~~~~~~~~~~~~~~~~~~~~~  162 (798)
                      |+.+.++++.|+..++..++++|+++|+|+|++.++++++.++|...+++...+.+.+.......               
T Consensus        75 s~~~~~~~~~a~~~a~~~~~~~v~~~~llla~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~---------------  139 (786)
T COG0542          75 SPRLKRVLERAWLLAQSLGDEYVSTEHLLLALLNEPESVAAYILKKLGVTRKDVEELIEELRGGN---------------  139 (786)
T ss_pred             CHHHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHCCCCHHHHHHHHHCCCCHHHHHHHHHHHHCCC---------------
T ss_conf             87799999999999875157655589999998617622789999866577777999999973466---------------


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHCCCCCCEEEECCCCCHHHHHH
Q ss_conf             00000124444444555544553035654425887754861122217899999999862267787489667641166899
Q gi|254780163|r  163 SAGSDGEGFVNDYQAKTDLNLFPALSAYCVDLTEKVKKGKVDILVGRHEEINRTIQILCRRSKNNPLYVGDPGVGKTAIA  242 (798)
Q Consensus       163 ~~~~~~~~~~~~~~~~~~~~~~~~LdkFg~DLTe~AreGKLDPVIGRd~EI~riiqIL~RR~KNn~~lvG~~gvGktaiv  242 (798)
                                 ...........++|++||+|||+.|++||||||||||+||+|+|||||||+||||+|||||||||||||
T Consensus       140 -----------~~~~~~~~~~~~~L~~~~~dlt~~Ar~gklDPvIGRd~EI~r~iqIL~RR~KNNPvLiGEpGVGKTAIv  208 (786)
T COG0542         140 -----------EVDSKNAEEDQDALEKYTRDLTELAREGKLDPVIGRDEEIRRTIQILSRRTKNNPVLVGEPGVGKTAIV  208 (786)
T ss_pred             -----------CCCCCCCCCCHHHHHHHHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHHCCCCCCCEEECCCCCCHHHHH
T ss_conf             -----------667766653244699874114799865898877374799999999983568899847668988899999


Q ss_pred             HHHHHHHHCCCCCHHHHEEEEEEEEHHHHHCCCCCCCHHHHHHHHHHHHHCCCCCEEEEECCHHHHHCCCCCCCCCCCHH
Q ss_conf             99999985489883452014455404675306343123789999999872038983999736166301554443447778
Q gi|254780163|r  243 EGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIESYANAILYIDEIHTLVGAGSASGISVDAS  322 (798)
Q Consensus       243 e~la~~i~~~~vp~~l~~~~i~~ld~~~l~ag~~~rg~fe~r~~~~~~~~~~~~~~ilfideih~ligag~~~g~~~d~a  322 (798)
                      ||||+||++|+||+.|+|++||+||+++|+||||||||||+|||.|++|+++.+++||||||||||||||+++|++||||
T Consensus       209 EGLA~rIv~g~VP~~L~~~~i~sLD~g~LvAGakyRGeFEeRlk~vl~ev~~~~~vILFIDEiHtiVGAG~~~g~a~DAa  288 (786)
T COG0542         209 EGLAQRIVNGDVPESLKDKRIYSLDLGSLVAGAKYRGEFEERLKAVLKEVEKSKNVILFIDEIHTIVGAGATEGGAMDAA  288 (786)
T ss_pred             HHHHHHHHCCCCCHHHCCCEEEEECHHHHHCCCCCCCCHHHHHHHHHHHHHCCCCEEEEEECHHHHCCCCCCCCCCCCHH
T ss_conf             89999974699997875887997148767464653573899999999998517984999823554057776666651256


Q ss_pred             HHHHHHHCCCCEEEEEECCHHHHHHHHHCCHHHHHHCEEEEECCCCHHHHHHHHHHHHHHHHHHCCCEECCHHHHHHHHH
Q ss_conf             88876630266038873048999998520111432001443068786899999986127665410351211178999998
Q gi|254780163|r  323 NLLKPALSSGAVRCIGSTTYSEYRQFFEKDKALVRRFQKIDVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQL  402 (798)
Q Consensus       323 n~lkP~L~rg~~~~IgatT~~ey~~~~e~d~al~rrF~~i~v~ep~~~~~~~iL~~~~~~ye~~h~v~~~~~al~~av~l  402 (798)
                      |+|||+||||+|||||||||+|||||||||+||+||||+|.|.|||.++|+.||+|++++||.||+|+|+|+||++||.|
T Consensus       289 NiLKPaLARGeL~~IGATT~~EYRk~iEKD~AL~RRFQ~V~V~EPs~e~ti~ILrGlk~~yE~hH~V~i~D~Al~aAv~L  368 (786)
T COG0542         289 NLLKPALARGELRCIGATTLDEYRKYIEKDAALERRFQKVLVDEPSVEDTIAILRGLKERYEAHHGVRITDEALVAAVTL  368 (786)
T ss_pred             HHHHHHHHCCCEEEEEECCHHHHHHHHHHCHHHHHCCCEEECCCCCHHHHHHHHHHHHHHHHHCCCCEECHHHHHHHHHH
T ss_conf             64677874587379973558999887330667784675102799898999999987788887706964337999999999


Q ss_pred             HHHHCCCCCCHHHHHHHHHHHHHHHHHHHH---H------------------------HHHC------------------
Q ss_conf             654201555646798899865333321144---3------------------------2211------------------
Q gi|254780163|r  403 SVRHFTSRKLPDKAIDVIDEAGASQILQPL---S------------------------KRRK------------------  437 (798)
Q Consensus       403 s~ryi~~r~lPdkAidllDea~a~~~~~~~---~------------------------~~~~------------------  437 (798)
                      |.|||++|+||||||||+|||||+.+++..   .                        +.+.                  
T Consensus       369 S~RYI~dR~LPDKAIDLiDeA~A~~~l~~~~p~~l~~~~~~~~~l~~e~~~~~~e~~~~~~~~~~~~~~~~~~~~~~~~~  448 (786)
T COG0542         369 SDRYIPDRFLPDKAIDLLDEAGARVRLEIDKPEELDELERELAQLEIEKEALEREQDEKEKKLIDEIIKLKEGRIPELEK  448 (786)
T ss_pred             HHHHCCCCCCCCHHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             98645567899467778899999997203488405689999999888898874403688888877899875410056788


Q ss_pred             ----CCCHHHHHHHHHHCCCCCCHHHHHCCHHHHHHHHCCHHHHHHHCHHHHHHHHHHHHHHHHCCCCCCCCCCCEEEEE
Q ss_conf             ----3657899986631024531011100112334210000246653458999999999877520445657874068861
Q gi|254780163|r  438 ----FITEKDIKKTIASMNRSIHTTSFSRDDDSVLSNLEKNLGTVVYGQEEAIKKLSSSIKIARAGLSDPNKPIGCYVFS  513 (798)
Q Consensus       438 ----~~~~~~i~~~~~~~~~gip~~~~~~~~~~~l~~l~~~l~~~v~GQ~~ai~~v~~~i~~~~~gl~~~~rP~g~flf~  513 (798)
                          .|++++|++++++|+ |||+.+++.+|.++|++|++.|++||||||+||++|+++|+|+|+||++|+||+|||||+
T Consensus       449 ~~~~~v~~~~Ia~vv~~~T-gIPv~~l~~~e~~kll~le~~L~~rViGQd~AV~~v~~aIrraRaGL~dp~rPigsFlF~  527 (786)
T COG0542         449 ELEAEVDEDDIAEVVARWT-GIPVAKLLEDEKEKLLNLERRLKKRVIGQDEAVEAVSDAIRRARAGLGDPNRPIGSFLFL  527 (786)
T ss_pred             HHHHCCCHHHHHHHHHHHH-CCCHHHHCHHHHHHHHHHHHHHHCCEECHHHHHHHHHHHHHHHHCCCCCCCCCCEEEEEE
T ss_conf             8762267989999999987-898364133258899867999736501739999999999999856999999873578866


Q ss_pred             CCCCHHHHHHHHHHH---HHCCCCEEEEEHHHHHCCCCCCHHCCCCCHHCCCCCCCCCCHHHHHCCCEEEEECCHHHCCH
Q ss_conf             432003889999987---30477337720688612465301104780002564443100355515851777404455028
Q gi|254780163|r  514 GPTGVGKTEISKQLA---FALGVQLLRFDMSEYMERHAVSRLIGAPPGYVGFGQGGILADSVDQNPYSVVLLDEIEKSHP  590 (798)
Q Consensus       514 GptGvGKTelak~la---~~~~~~lir~dmsey~e~~~vs~LiGappGYvG~~egg~Lte~vr~~P~sVvl~DEiEKAh~  590 (798)
                      ||||||||||||+||   |+++.+|||||||||||+||||||||||||||||+|||+|||+||++|||||||||||||||
T Consensus       528 GPTGVGKTELAkaLA~~Lfg~e~aliR~DMSEy~EkHsVSrLIGaPPGYVGyeeGG~LTEaVRr~PySViLlDEIEKAHp  607 (786)
T COG0542         528 GPTGVGKTELAKALAEALFGDEQALIRIDMSEYMEKHSVSRLIGAPPGYVGYEEGGQLTEAVRRKPYSVILLDEIEKAHP  607 (786)
T ss_pred             CCCCCCHHHHHHHHHHHHCCCCCCCEEECHHHHHHHHHHHHHHCCCCCCCEECCCCCHHHHHHCCCCEEEEECHHHHCCH
T ss_conf             78865699999999999659974445545687777877998727999872006554003766069986888412644088


Q ss_pred             HHHHHHHHHHHHHHCCCCCCCEECCCCEEEEEECCCCHHHHHHCCCC---CCCCCCHHHHHHHHHHHCCHHHHCCCCEEE
Q ss_conf             99999999877750217799776125429999424214553303689---882111488999998728878817768289
Q gi|254780163|r  591 DVLNILLQIMDYGILTDQSGKKISFRNVILIMTTNAGALEMSKARIG---FGSSRNDDADKEALRNFLSPEFLNRLDSII  667 (798)
Q Consensus       591 ~v~~~llqild~G~ltd~~Gr~vdf~n~iii~TsN~G~~~~~~~~~g---~~~~~~~~~~~~~l~~~f~peflnRid~ii  667 (798)
                      ||||+||||||+|+|||++||+|||+|||||||||+|++.+.+...+   ...+...+.+++.++++|+|||+||||+||
T Consensus       608 dV~nilLQVlDdGrLTD~~Gr~VdFrNtiIImTSN~Gs~~i~~~~~~~~~~~~~~~~~~v~~~l~~~F~PEFLNRid~II  687 (786)
T COG0542         608 DVFNLLLQVLDDGRLTDGQGRTVDFRNTIIIMTSNAGSEEILRDADGDDFADKEALKEAVMEELKKHFRPEFLNRIDEII  687 (786)
T ss_pred             HHHHHHHHHHCCCCEECCCCCEEECCEEEEEEECCCCHHHHHHHCCCCCCCHHHHHHHHHHHHHHHHCCHHHHHHCCCEE
T ss_conf             99999999846780554899888430028998450265989753134321004678899999998538998985126178


Q ss_pred             ECCCCCHHHHHHHHHHHHHHHHHHHHHCCCEEEECHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHHHHHHHHHCCCCCCC
Q ss_conf             62889999999999999999999998669889998899999997189810153267999998623599999962967688
Q gi|254780163|r  668 PFFPLSSDIIRQVVHKFIMKLELQLQEKGISFHFSEEVINWLVSHGYDVKMGARPLERIIKEHVKVPLADEILFGKLKKG  747 (798)
Q Consensus       668 ~F~~l~~~~~~~i~~~~l~~l~~~l~~~~i~l~~~~~~~~~l~~~~~~~~~GAR~l~r~i~~~i~~~la~~il~~~~~~g  747 (798)
                      +|+||+.+++.+|++++|.++..+|+++++.+++++++++||+++||||.||||||+|+|+++|++|||++||+|.+.+|
T Consensus       688 ~F~~L~~~~l~~Iv~~~L~~l~~~L~~~~i~l~~s~~a~~~l~~~gyd~~~GARpL~R~Iq~~i~~~La~~iL~~~~~~~  767 (786)
T COG0542         688 PFNPLSKEVLERIVDLQLNRLAKRLAERGITLELSDEAKDFLAEKGYDPEYGARPLRRAIQQEIEDPLADEILFGKIEDG  767 (786)
T ss_pred             ECCCCCHHHHHHHHHHHHHHHHHHHHHCCCEEEECHHHHHHHHHHCCCCCCCCHHHHHHHHHHHHHHHHHHHHHCCCCCC
T ss_conf             50679989999999999999999998689559988899999999646877673679999999998999999984665799


Q ss_pred             CEEEEEEEECC
Q ss_conf             84899996078
Q gi|254780163|r  748 GGVVKVSLNPD  758 (798)
Q Consensus       748 ~~~~~v~~~~~  758 (798)
                      .+ +.|++..+
T Consensus       768 ~~-v~v~~~~~  777 (786)
T COG0542         768 GT-VKVDVDDE  777 (786)
T ss_pred             CE-EEEEECCC
T ss_conf             67-99995176


No 7  
>TIGR03345 VI_ClpV1 type VI secretion ATPase, ClpV1 family. Members of this protein family are homologs of ClpB, an ATPase associated with chaperone-related functions. These ClpB homologs, designated ClpV1, are a key component of the bacterial pathogenicity-associated type VI secretion system.
Probab=100.00  E-value=0  Score=1848.71  Aligned_cols=729  Identities=36%  Similarity=0.611  Sum_probs=655.8

Q ss_pred             CCHHHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHCH--HHHHHHHHCCCCHHHHHHHHHHHHHHCCCCCCCCCCCCCCC
Q ss_conf             4389999999999999982899511999999982074--68999998599989999999999641365457788867764
Q gi|254780163|r    4 FSENLEKVLHQALVLANERNHEYATLEHLLLALIDDS--DAAIVMLSCNVDLKVLKNNLLNYIDNDSSNKLKNGFRVECK   81 (798)
Q Consensus         4 fS~~a~~vL~~A~~lAk~~~H~~Vt~EHLLLaLL~d~--~~~~iL~~~giD~~~Lk~~Le~~L~~~~~~~~~~~~~~ei~   81 (798)
                      +||+++++|+.|+++|++++|+||++||||++|++++  .+..+|..+|+|++.++++++.++++.+     .+....+.
T Consensus         1 Lt~~~~~aL~~A~~~A~~~~H~~I~~eHLLlaLl~~~~~~~~~iL~~~gvd~~~l~~~l~~~l~~~~-----~~~~~~~~   75 (852)
T TIGR03345         1 LNPTSRRALEQAAALCVARGHPEVELEHWLLALLDQPDSDLAAILRHFGVDLGRLKADLARALDKLP-----RGNTRTPV   75 (852)
T ss_pred             CCHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHCCCCCHHHHHHHHCCCCHHHHHHHHHHHHHHCC-----CCCCCCCC
T ss_conf             9889999999999999985998138999999998399747999999869999999999999996389-----89999888


Q ss_pred             CCHHHHHHHHHHHHHHH-HCCCCCCCHHHHHHHHHHCCCCHHHHHHHH---CCCCHHHHHHHHHHHCCCCHHHHHHHHHC
Q ss_conf             69899999999999999-809981259998787873774299999998---49998999999983000000011121102
Q gi|254780163|r   82 PTSSFQRVVQRAVLHVQ-STGRGIVTGANILVALFSEPDSHATYFLQE---QEMTLYDAVNFISHGISKRKEFANFQSKL  157 (798)
Q Consensus        82 ~S~~l~rVL~~A~~~A~-~~G~~~I~~eHLLLALL~e~ds~a~~iL~~---~gis~~~v~~~i~~~~~~~~~~~~~~~~~  157 (798)
                      +|+.+.++|++|+..+. .+|+.+|+++|||+|++.+.+..+......   ..++...+...+............     
T Consensus        76 ~s~~l~~vl~~A~~~a~~~~g~~~I~~~hlLlall~~~~~~~~~~~~~~~l~~i~~~~l~~~~~~~~~~~~~~~~-----  150 (852)
T TIGR03345        76 FSPHLVELLQEAWLLASLELGDGRIRSGHLLLALLTDPELRRLLGSISPELAKIDREALREALPALVEGSAEASA-----  150 (852)
T ss_pred             CCHHHHHHHHHHHHHHHHHCCCCEECHHHHHHHHHCCCCHHHHHHHHHHHHCCCCHHHHHHHHHHHHCCCCCCCC-----
T ss_conf             787999999999999999859987739999999825962567899998885358999999999998356743333-----


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHCCCCCCEEEECCCCCH
Q ss_conf             44321000001244444445555445530356544258877548611222178999999998622677874896676411
Q gi|254780163|r  158 NVDGSSAGSDGEGFVNDYQAKTDLNLFPALSAYCVDLTEKVKKGKVDILVGRHEEINRTIQILCRRSKNNPLYVGDPGVG  237 (798)
Q Consensus       158 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LdkFg~DLTe~AreGKLDPVIGRd~EI~riiqIL~RR~KNn~~lvG~~gvG  237 (798)
                                ................+++|++||+|||++|++|++|||||||+||+|+|||||||+|||||||||||||
T Consensus       151 ----------~~~~~~~~~~~~~~~~~~~L~ky~~dLt~~A~~gklDPvIGRd~EI~r~iqIL~Rr~KNNPiLVGepGVG  220 (852)
T TIGR03345       151 ----------AAADAGPAAAAAGAAGTSALDQYTTDLTAQAREGKIDPVLGRDDEIRQMIDILLRRRQNNPILTGEAGVG  220 (852)
T ss_pred             ----------CCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHHHHHHCCCCCEEECCCCCC
T ss_conf             ----------3334566677777666448999978899999839999886949999999999986247997465799987


Q ss_pred             HHHHHHHHHHHHHCCCCCHHHHEEEEEEEEHHHHHCCCCCCCHHHHHHHHHHHHHCCCCC-EEEEECCHHHHHCCCCCCC
Q ss_conf             668999999998548988345201445540467530634312378999999987203898-3999736166301554443
Q gi|254780163|r  238 KTAIAEGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIESYAN-AILYIDEIHTLVGAGSASG  316 (798)
Q Consensus       238 ktaive~la~~i~~~~vp~~l~~~~i~~ld~~~l~ag~~~rg~fe~r~~~~~~~~~~~~~-~ilfideih~ligag~~~g  316 (798)
                      |||||||||+||++|+||+.|+|++||+||+++|+|||+||||||+|||.|++|++++++ +||||||||||||||+++|
T Consensus       221 KTAIvEGLA~rI~~g~VP~~L~~~~i~sLDlg~LvAGtkyRGeFEeRlk~ii~ei~~~~~~iILFIDEiHtlvGAG~~~G  300 (852)
T TIGR03345       221 KTAVVEGLALRIAAGDVPPALRNVRLLSLDLGLLQAGASVKGEFENRLKSVIDEVKASPQPIILFIDEAHTLIGAGGQAG  300 (852)
T ss_pred             HHHHHHHHHHHHHCCCCCHHHHCCEEEEEEHHHHHHCCCCCCHHHHHHHHHHHHHHHCCCCEEEEEEHHHHHCCCCCCCC
T ss_conf             99999999999976999867743856786788886403576359999999999998489976999634877528998888


Q ss_pred             CCCCHHHHHHHHHCCCCEEEEEECCHHHHHHHHHCCHHHHHHCEEEEECCCCHHHHHHHHHHHHHHHHHHCCCEECCHHH
Q ss_conf             44777888876630266038873048999998520111432001443068786899999986127665410351211178
Q gi|254780163|r  317 ISVDASNLLKPALSSGAVRCIGSTTYSEYRQFFEKDKALVRRFQKIDVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAI  396 (798)
Q Consensus       317 ~~~d~an~lkP~L~rg~~~~IgatT~~ey~~~~e~d~al~rrF~~i~v~ep~~~~~~~iL~~~~~~ye~~h~v~~~~~al  396 (798)
                       ++||||||||+||||+||||||||++|||||||||+||+||||+|.|+|||.++|+.||+|++++||.||+|+|+|+||
T Consensus       301 -~~DaaNiLKPaLarGelr~IGATT~~EYrk~iEkD~AL~RRFq~V~V~EPs~eeti~IL~glk~~yE~hH~V~i~d~Ai  379 (852)
T TIGR03345       301 -QGDAANLLKPALARGELRTIAATTWAEYKKYFEKDPALTRRFQVVKVEEPDEETAIRMLRGLAPVLEKHHGVLILDEAV  379 (852)
T ss_pred             -CCCHHHHHHHHHHCCCCEEEEECCHHHHHHHHHCCHHHHHHCCCCCCCCCCHHHHHHHHHHHHHHHHHCCCEEEEHHHH
T ss_conf             -6227887517873787349983578999888642688996247552799987999999998799985547968708999


Q ss_pred             HHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHH------------------------------------------
Q ss_conf             99999865420155564679889986533332114432------------------------------------------
Q gi|254780163|r  397 RAAVQLSVRHFTSRKLPDKAIDVIDEAGASQILQPLSK------------------------------------------  434 (798)
Q Consensus       397 ~~av~ls~ryi~~r~lPdkAidllDea~a~~~~~~~~~------------------------------------------  434 (798)
                      ++||+||.|||++|+||||||||||||||++++.....                                          
T Consensus       380 ~aAv~LS~RYI~dR~LPDKAIDLlDeA~A~~~~~~~~~p~~l~~~~~~~~~~~~e~~~l~~~~~~~~~~~~~~~~~~~~~  459 (852)
T TIGR03345       380 VAAVELSHRYIPGRQLPDKAVSLLDTACARVALSQNATPAALEDLRRRIAALELELDALEREAALGADHDERLAELRAEL  459 (852)
T ss_pred             HHHHHHHHHHCCCCCCCHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHH
T ss_conf             99999987215545584278999999999999860489568999999999999999998744522733299999999999


Q ss_pred             -----------------------------------------------------------------HHCCCCHHHHHHHHH
Q ss_conf             -----------------------------------------------------------------211365789998663
Q gi|254780163|r  435 -----------------------------------------------------------------RRKFITEKDIKKTIA  449 (798)
Q Consensus       435 -----------------------------------------------------------------~~~~~~~~~i~~~~~  449 (798)
                                                                                       -...|+..||+++|+
T Consensus       460 ~~~~~~~~~~~~~~~~e~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~l~~~~~~~~~~~~~V~~~~ia~vvs  539 (852)
T TIGR03345       460 AALEAELAALEARWQQEKELVEAILALRAELEADADAPADDDAALRAQLAELEAALASAQGEEPLVFPEVDAQAVAEVVA  539 (852)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCHHHHHHHHH
T ss_conf             99999999999999999999999999999999866514334577888999999999974045664435568999999999


Q ss_pred             HCCCCCCHHHHHCCHHHHHHHHCCHHHHHHHCHHHHHHHHHHHHHHHHCCCCCCCCCCCEEEEECCCCHHHHHHHHHHH-
Q ss_conf             1024531011100112334210000246653458999999999877520445657874068861432003889999987-
Q gi|254780163|r  450 SMNRSIHTTSFSRDDDSVLSNLEKNLGTVVYGQEEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLA-  528 (798)
Q Consensus       450 ~~~~gip~~~~~~~~~~~l~~l~~~l~~~v~GQ~~ai~~v~~~i~~~~~gl~~~~rP~g~flf~GptGvGKTelak~la-  528 (798)
                      .|+ |||+.++..+|.++|++|+..|+++||||++||++|+++|+++|+||++|+||+|||||+||||||||||||+|| 
T Consensus       540 ~~t-gIPv~~l~~~e~~~l~~le~~L~~~ViGQ~~Av~~v~~ai~~sraGl~d~~rPigsFLFlGPTGVGKTElAK~LA~  618 (852)
T TIGR03345       540 DWT-GIPVGRMVRDEIEAVLSLPDRLAERVIGQDHALEAIAERIRTARAGLEDPRKPLGVFLLVGPSGVGKTETALALAE  618 (852)
T ss_pred             HHH-CCCHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHCCCCCCCCCCEEEEEECCCCCCHHHHHHHHHH
T ss_conf             996-8987886178888888679999999728499999999999998717999999856899878998778999999999


Q ss_pred             --HHCCCCEEEEEHHHHHCCCCCCHHCCCCCHHCCCCCCCCCCHHHHHCCCEEEEECCHHHCCHHHHHHHHHHHHHHHCC
Q ss_conf             --304773377206886124653011047800025644431003555158517774044550289999999987775021
Q gi|254780163|r  529 --FALGVQLLRFDMSEYMERHAVSRLIGAPPGYVGFGQGGILADSVDQNPYSVVLLDEIEKSHPDVLNILLQIMDYGILT  606 (798)
Q Consensus       529 --~~~~~~lir~dmsey~e~~~vs~LiGappGYvG~~egg~Lte~vr~~P~sVvl~DEiEKAh~~v~~~llqild~G~lt  606 (798)
                        |+++++|||||||||||+||||||||||||||||+|||+|||+||++|||||||||||||||||||+||||||+|+||
T Consensus       619 ~LFg~e~~liR~DMSEy~E~hsvsrLiGaPPGYVGy~eGG~LTe~Vrr~PysVvLfDEIEKAHpdV~nilLQvlD~G~Lt  698 (852)
T TIGR03345       619 LLYGGEQNLITINMSEFQEAHTVSRLKGSPPGYVGYGEGGVLTEAVRRKPYSVVLLDEVEKAHPDVLELFYQVFDKGVME  698 (852)
T ss_pred             HHCCCCCCEEEECCHHHCCHHHHHHHCCCCCCCCCCCCCCHHHHHHHHCCCEEEEECHHHHCCHHHHHHHHHHHCCCEEE
T ss_conf             97198611478422432104368786389997667487772109888099868886113002889999999872467775


Q ss_pred             CCCCCEECCCCEEEEEECCCCHHHHHHCCCCCCCC----CCHHHHHHHHHHHCCHHHHCCCCEEEECCCCCHHHHHHHHH
Q ss_conf             77997761254299994242145533036898821----11488999998728878817768289628899999999999
Q gi|254780163|r  607 DQSGKKISFRNVILIMTTNAGALEMSKARIGFGSS----RNDDADKEALRNFLSPEFLNRLDSIIPFFPLSSDIIRQVVH  682 (798)
Q Consensus       607 d~~Gr~vdf~n~iii~TsN~G~~~~~~~~~g~~~~----~~~~~~~~~l~~~f~peflnRid~ii~F~~l~~~~~~~i~~  682 (798)
                      |++||+|||+|||||||||+|++.+.+...++...    ...+.++++++++|+|||+||| ++|+|+||+.+++.+|++
T Consensus       699 D~~Gr~vdF~NtIIImTSN~Gs~~i~~~~~~~~~~~~~~~~~~~v~~~l~~~F~PEFlnRi-~ii~F~~L~~~~l~~Iv~  777 (852)
T TIGR03345       699 DGEGREIDFKNTVILLTSNAGSDLIMALCADPETAPDPEALLEALRPELLKVFKPAFLGRM-TVIPYLPLDDDVLAAIVR  777 (852)
T ss_pred             CCCCCEEECEEEEEEECCCHHHHHHHHHHCCCCCCCCHHHHHHHHHHHHHHHCCHHHHCCE-EEEEECCCCHHHHHHHHH
T ss_conf             7999988452129997572447999864037655566899999999999834798886456-689736899999999999


Q ss_pred             HHHHHHHHHHHHC-CCEEEECHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHHHHHHHHHCCCCCCCCEEEEEEEE
Q ss_conf             9999999999866-9889998899999997189810153267999998623599999962967688848999960
Q gi|254780163|r  683 KFIMKLELQLQEK-GISFHFSEEVINWLVSHGYDVKMGARPLERIIKEHVKVPLADEILFGKLKKGGGVVKVSLN  756 (798)
Q Consensus       683 ~~l~~l~~~l~~~-~i~l~~~~~~~~~l~~~~~~~~~GAR~l~r~i~~~i~~~la~~il~~~~~~g~~~~~v~~~  756 (798)
                      ++|.++.+||.++ +|.|.+++++++||+++||||.||||||+|+|+++|++|||++||. ++++|+.+..|+++
T Consensus       778 ~~l~~l~~rL~~~~~i~l~~~~~~~~~l~~~g~~~~~GARpl~r~I~~~i~~~la~~iL~-~~~~g~~~~~i~~~  851 (852)
T TIGR03345       778 LKLDRIARRLKENHGAELVYSEALVEHIVARCTEVESGARNIDAILNQTLLPELSRQILE-RLAAGEPIERIHLD  851 (852)
T ss_pred             HHHHHHHHHHHHCCCCEEEECHHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHHHHHHHHH-HHHCCCCEEEEEEC
T ss_conf             999999999986289689988999999998289977686438999999988999999999-87089972488815


No 8  
>KOG1051 consensus
Probab=100.00  E-value=0  Score=1297.73  Aligned_cols=721  Identities=36%  Similarity=0.576  Sum_probs=646.4

Q ss_pred             CCHHHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHCHH--HHHHHHHCC-CCHHHHHHHHHHHHHHCCCCCCCCCCCCCC
Q ss_conf             43899999999999999828995119999999820746--899999859-998999999999964136545778886776
Q gi|254780163|r    4 FSENLEKVLHQALVLANERNHEYATLEHLLLALIDDSD--AAIVMLSCN-VDLKVLKNNLLNYIDNDSSNKLKNGFRVEC   80 (798)
Q Consensus         4 fS~~a~~vL~~A~~lAk~~~H~~Vt~EHLLLaLL~d~~--~~~iL~~~g-iD~~~Lk~~Le~~L~~~~~~~~~~~~~~ei   80 (798)
                      ||++++.+|.+|+.+|++++|.++||+|++.+||.+++  +..++...+ ++...+..-....+...+....|   ....
T Consensus        12 lT~~Aa~~L~~a~~~Arrrgh~qvtplH~~~~LLs~~t~~lr~ac~~~~~l~~ralelc~~v~l~rlpt~~~p---~~sn   88 (898)
T KOG1051          12 LTEEAATVLKQAVTEARRRGHAQVTPLHVASTLLSSPTGILRRACIKSHPLQCRALELCFNVSLNRLPTSYGP---PVSN   88 (898)
T ss_pred             HCHHHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHCCCCHHHHHHHHHCCCCCHHHHHHHHHHHHHHCCCCCCC---CCCH
T ss_conf             0799999999999999970888764699999997098317999999647521778998888998734688998---5413


Q ss_pred             CCCHHHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHCCCCHHHHHHHHCCCCHHHHHHHHHHHCCCCHHHHHHHHHCCCC
Q ss_conf             46989999999999999980998125999878787377429999999849998999999983000000011121102443
Q gi|254780163|r   81 KPTSSFQRVVQRAVLHVQSTGRGIVTGANILVALFSEPDSHATYFLQEQEMTLYDAVNFISHGISKRKEFANFQSKLNVD  160 (798)
Q Consensus        81 ~~S~~l~rVL~~A~~~A~~~G~~~I~~eHLLLALL~e~ds~a~~iL~~~gis~~~v~~~i~~~~~~~~~~~~~~~~~~~~  160 (798)
                      .++.++++++..+...+..++.++|.++|+.+.++-..+.....++...|++...++..+.+......          .+
T Consensus        89 ~l~aalkr~qa~qrr~~~~~~~~~vkvE~~qli~silDdp~vsrv~rEag~~s~~vK~~ve~~~g~~~----------~~  158 (898)
T KOG1051          89 ALMAALKRAQAHQRRGCEEQQQQAVKVELEQLILSILDDPSVSRVMREAGFSSSAVKSAVEQPVGQFR----------SP  158 (898)
T ss_pred             HHHHHHHHHHHHHHHCCHHHCCCHHHHHHHHHHHEECCCHHHHHHHHHHCCCHHHHHHHHHHCCCCCC----------CC
T ss_conf             76999998899987346242341344766746311305707999999955895899998863024457----------77


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCHHHHHH-HHHHHHHHHHHHCCCCCCEEEECCCCCHHH
Q ss_conf             2100000124444444555544553035654425887754861122217-899999999862267787489667641166
Q gi|254780163|r  161 GSSAGSDGEGFVNDYQAKTDLNLFPALSAYCVDLTEKVKKGKVDILVGR-HEEINRTIQILCRRSKNNPLYVGDPGVGKT  239 (798)
Q Consensus       161 ~~~~~~~~~~~~~~~~~~~~~~~~~~LdkFg~DLTe~AreGKLDPVIGR-d~EI~riiqIL~RR~KNn~~lvG~~gvGkt  239 (798)
                      .                ..+....++|.+||.|||.+|++||+|||||| |+||+|+|||||||+||||||||+||||||
T Consensus       159 ~----------------~~~~~~~~~L~~~~~dl~p~~~~gk~dPvigr~deeirRvi~iL~Rr~k~NPvLVG~~gvgkt  222 (898)
T KOG1051         159 S----------------RGPLWPLLFLENYGTDLTPRARQGKLDPVIGRHDEEIRRVIEILSRKTKNNPVLVGEPGVGKT  222 (898)
T ss_pred             C----------------CCCCCCHHHHHHCCCCCCHHHHCCCCCCCCCCCHHHHHHHHHHHHCCCCCCCEEEECCCCCCH
T ss_conf             7----------------677643467875064567244336878865885288999999981467899669836877721


Q ss_pred             HHHHHHHHHHHCCCCCHHHHEEEEEEEEHHHHHCCCCCCCHHHHHHHHHHHHHC-CCCCEEEEECCHHHHHCCCCCCCCC
Q ss_conf             899999999854898834520144554046753063431237899999998720-3898399973616630155444344
Q gi|254780163|r  240 AIAEGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIE-SYANAILYIDEIHTLVGAGSASGIS  318 (798)
Q Consensus       240 aive~la~~i~~~~vp~~l~~~~i~~ld~~~l~ag~~~rg~fe~r~~~~~~~~~-~~~~~ilfideih~ligag~~~g~~  318 (798)
                      ++++|+|+||+.|+||..|.+++++.||+++|+||++||||||+|++.+++++. ..+.|||||||+|+++|+|++.| +
T Consensus       223 aiv~gla~ri~~G~vp~~l~~~~l~~l~~g~l~aGa~~rge~E~rlk~l~k~v~~~~~gvILfigelh~lvg~g~~~~-~  301 (898)
T KOG1051         223 AIVEGLAQRIATGDVPETLKDKKLIALDFGSLVAGAKRRGEFEERLKELLKEVESGGGGVILFLGELHWLVGSGSNYG-A  301 (898)
T ss_pred             HHHHHHHHHHHCCCCCCCCCCCCEEEEEHHHCCCCCCCCHHHHHHHHHHHHHHHCCCCCEEEEECCEEEEECCCCCCH-H
T ss_conf             689999987661788853345524898700003586421278899999999985479868998321432204887411-8


Q ss_pred             CCHHHHHHHHHCCCCEEEEEECCHHHHHHHHHCCHHHHHHCEEEEECCCCHHHHHHHHHHHHHHHHHHCCCEECCHHHHH
Q ss_conf             77788887663026603887304899999852011143200144306878689999998612766541035121117899
Q gi|254780163|r  319 VDASNLLKPALSSGAVRCIGSTTYSEYRQFFEKDKALVRRFQKIDVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRA  398 (798)
Q Consensus       319 ~d~an~lkP~L~rg~~~~IgatT~~ey~~~~e~d~al~rrF~~i~v~ep~~~~~~~iL~~~~~~ye~~h~v~~~~~al~~  398 (798)
                      +|++|+|||+|+||+++||||||.+||+|||||||||+||||.+.|.+||.++|+.||+|++++||.|||++|+++++..
T Consensus       302 ~d~~nlLkp~L~rg~l~~IGatT~e~Y~k~iekdPalErrw~l~~v~~pS~~~~~~iL~~l~~~~e~~hg~~~s~~a~~~  381 (898)
T KOG1051         302 IDAANLLKPLLARGGLWCIGATTLETYRKCIEKDPALERRWQLVLVPIPSVENLSLILPGLSERYEVHHGVRISDESLFS  381 (898)
T ss_pred             HHHHHHHHHHHHCCCEEEEECCCHHHHHHHHHHCCCHHHCCCEEEECCCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCCC
T ss_conf             99998658888559748972250999999876382054185516713576553145655543420113477125433422


Q ss_pred             HHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHHHH------------------------------------------
Q ss_conf             99986542015556467988998653333211443221------------------------------------------
Q gi|254780163|r  399 AVQLSVRHFTSRKLPDKAIDVIDEAGASQILQPLSKRR------------------------------------------  436 (798)
Q Consensus       399 av~ls~ryi~~r~lPdkAidllDea~a~~~~~~~~~~~------------------------------------------  436 (798)
                      |+.+|.||++.||+||+|||+.|||||..+++....+.                                          
T Consensus       382 a~~~s~~~~t~r~lpd~aidl~dEa~a~~~~~~~~lP~wL~~~~~~~~~~~~e~~~L~kk~d~~~h~r~~~~~~~~~~~~  461 (898)
T KOG1051         382 AAQLSARYITLSFLPDCAIDLEDEAAALVKSQAESLPPWLQNLERVDIKLQDEISELQKKWNQALHKRPSLESLAPSKPT  461 (898)
T ss_pred             CCCHHHHHCCCCCCCHHCCCHHHHHHHHHHHHHHHCCHHHHHHHHCCCHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCC
T ss_conf             02101232123768331045889999998631232779887545300006789999998650532234332345654311


Q ss_pred             ----------------------C-----CC----------------------------------CHHHHHHHHHHCCCCC
Q ss_conf             ----------------------1-----36----------------------------------5789998663102453
Q gi|254780163|r  437 ----------------------K-----FI----------------------------------TEKDIKKTIASMNRSI  455 (798)
Q Consensus       437 ----------------------~-----~~----------------------------------~~~~i~~~~~~~~~gi  455 (798)
                                            .     .+                                  +..+|..+++. |+||
T Consensus       462 ~~~l~~~~~~~~s~~~~l~~~~~~~~~~~~~~k~~r~~d~~~~~~l~~~~~p~~~~~~~~~~~~~~~~i~~~~s~-~tgi  540 (898)
T KOG1051         462 QQPLSASVDSERSVIEELKLKKNSLDRNSLLAKAHRPNDYTRETDLRYGRIPDELSEKSNDNQGGESDISEVVSR-WTGI  540 (898)
T ss_pred             CCCCHHHHCCCHHHHHHHCCCCCCCCHHHHHHCCCCCCCCCHHHHCCCCCCCHHHHHHCCCCCCCCCCHHHHHHH-HCCC
T ss_conf             332134433535687664135687001023421468877632120123566505543201134776205554023-2178


Q ss_pred             CHHHHHCCHHHHHHHHCCHHHHHHHCHHHHHHHHHHHHHHHHCCCCCCCCCCCEEEEECCCCHHHHHHHHHHH---HHCC
Q ss_conf             1011100112334210000246653458999999999877520445657874068861432003889999987---3047
Q gi|254780163|r  456 HTTSFSRDDDSVLSNLEKNLGTVVYGQEEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLA---FALG  532 (798)
Q Consensus       456 p~~~~~~~~~~~l~~l~~~l~~~v~GQ~~ai~~v~~~i~~~~~gl~~~~rP~g~flf~GptGvGKTelak~la---~~~~  532 (798)
                      |+..+...|.++|..|++.|+++|+||++||.+|++||+++|+|+.+| +|.++|||+||||||||+|||+||   |+++
T Consensus       541 p~~~~~~~e~~~l~~L~~~L~~~V~gQ~eAv~aIa~AI~~sr~gl~~~-~~~awflflGpdgvGKt~lAkaLA~~~Fgse  619 (898)
T KOG1051         541 PVDRLAEAEAERLKKLEERLHERVIGQDEAVAAIAAAIRRSRAGLKDP-NPDAWFLFLGPDGVGKTELAKALAEYVFGSE  619 (898)
T ss_pred             CHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHCCCCCCCC-CCCEEEEEECCCCHHHHHHHHHHHHHHCCCC
T ss_conf             214431667899999999997544663778999999998432035788-8885899978884138999999999972886


Q ss_pred             CCEEEEEHHHHHCCCCCCHHCCCCCHHCCCCCCCCCCHHHHHCCCEEEEECCHHHCCHHHHHHHHHHHHHHHCCCCCCCE
Q ss_conf             73377206886124653011047800025644431003555158517774044550289999999987775021779977
Q gi|254780163|r  533 VQLLRFDMSEYMERHAVSRLIGAPPGYVGFGQGGILADSVDQNPYSVVLLDEIEKSHPDVLNILLQIMDYGILTDQSGKK  612 (798)
Q Consensus       533 ~~lir~dmsey~e~~~vs~LiGappGYvG~~egg~Lte~vr~~P~sVvl~DEiEKAh~~v~~~llqild~G~ltd~~Gr~  612 (798)
                      .+|||+|||||||   ||+|||+|||||||++||+|||+|||+|||||||||||||||+|+|.|||+||+|++||++||+
T Consensus       620 ~~~IriDmse~~e---vskligsp~gyvG~e~gg~LteavrrrP~sVvLfdeIEkAh~~v~n~llq~lD~GrltDs~Gr~  696 (898)
T KOG1051         620 ENFIRLDMSEFQE---VSKLIGSPPGYVGKEEGGQLTEAVKRRPYSVVLFEEIEKAHPDVLNILLQLLDRGRLTDSHGRE  696 (898)
T ss_pred             CCEEEECHHHHHH---HHHCCCCCCCCCCCHHHHHHHHHHHCCCCEEEEEECHHHCCHHHHHHHHHHHHCCCCCCCCCCE
T ss_conf             4268961455555---6530489955546305778889971699659998302222888999999998627400588867


Q ss_pred             ECCCCEEEEEECCCCHHHHHHCCC--CCCCC---------CCHHHHHHHHH----HHCCHHHHCCCCEEEECCCCCHHHH
Q ss_conf             612542999942421455330368--98821---------11488999998----7288788177682896288999999
Q gi|254780163|r  613 ISFRNVILIMTTNAGALEMSKARI--GFGSS---------RNDDADKEALR----NFLSPEFLNRLDSIIPFFPLSSDII  677 (798)
Q Consensus       613 vdf~n~iii~TsN~G~~~~~~~~~--g~~~~---------~~~~~~~~~l~----~~f~peflnRid~ii~F~~l~~~~~  677 (798)
                      |||+|||||||||+|+..+.....  ++-..         .....+++.++    .+|+|||+||+|++++|+||+.+++
T Consensus       697 Vd~kN~I~IMTsn~~~~~i~~~~~~~~~l~~~~~~~~~~~~~k~~v~~~~~~~~~~~~r~Ef~nrid~i~lf~~l~~~~~  776 (898)
T KOG1051         697 VDFKNAIFIMTSNVGSSAIANDASLEEKLLDMDEKRGSYRLKKVQVSDAVRIYNKQFFRKEFLNRIDELDLNLPLDRDEL  776 (898)
T ss_pred             EECCCEEEEEECCCCHHHHHCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHCCCCCCCCHHHHCCCCEEEEECCCCHHHH
T ss_conf             50464599994263166664045410001231000123320133333432013565568678555540554142555666


Q ss_pred             HHHHHHHHHHHHHHHHHCCCEEEECHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHHHHHHHHHCCCCCCCCEEEEEEEEC
Q ss_conf             99999999999999986698899988999999971898101532679999986235999999629676888489999607
Q gi|254780163|r  678 RQVVHKFIMKLELQLQEKGISFHFSEEVINWLVSHGYDVKMGARPLERIIKEHVKVPLADEILFGKLKKGGGVVKVSLNP  757 (798)
Q Consensus       678 ~~i~~~~l~~l~~~l~~~~i~l~~~~~~~~~l~~~~~~~~~GAR~l~r~i~~~i~~~la~~il~~~~~~g~~~~~v~~~~  757 (798)
                      .+|+..++.++.+++.++++.+.+++.+.++++.+|||+.|||||++|.|++.+++.++..++ +.+.++. +++|.+..
T Consensus       777 ~~i~~~~~~e~~~r~~~~~~~~~v~~~~~~~v~~~~~d~~ygAr~ikr~i~~~~~~~la~~~l-~ei~~~~-~~~i~~~~  854 (898)
T KOG1051         777 IEIVNKQLTEIEKRLEERELLLLVTDRVDDKVLFKGYDFDYGARPIKRSIEERFENRLAEALL-GEVEDGL-TERILVAD  854 (898)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHE-EEECCCC-EEEEEECC
T ss_conf             655566778888776666799998899976653057684777668999999998877765311-4326885-69997425


Q ss_pred             CCCC
Q ss_conf             8665
Q gi|254780163|r  758 DKSA  761 (798)
Q Consensus       758 ~~~~  761 (798)
                      ...+
T Consensus       855 ~~~~  858 (898)
T KOG1051         855 GWSQ  858 (898)
T ss_pred             CCCC
T ss_conf             4334


No 9  
>pfam07724 AAA_2 AAA domain (Cdc48 subfamily). This Pfam entry includes some of the AAA proteins not detected by the pfam00004 model.
Probab=100.00  E-value=0  Score=409.41  Aligned_cols=162  Identities=54%  Similarity=0.902  Sum_probs=148.5

Q ss_pred             CCCCEEEEECCCCHHHHHHHHHHH---HHCCCCEEEEEHHHHHCCCCCCHHCCCCCHHCCCCCCCCCCHHHHHCCCEEEE
Q ss_conf             874068861432003889999987---30477337720688612465301104780002564443100355515851777
Q gi|254780163|r  505 KPIGCYVFSGPTGVGKTEISKQLA---FALGVQLLRFDMSEYMERHAVSRLIGAPPGYVGFGQGGILADSVDQNPYSVVL  581 (798)
Q Consensus       505 rP~g~flf~GptGvGKTelak~la---~~~~~~lir~dmsey~e~~~vs~LiGappGYvG~~egg~Lte~vr~~P~sVvl  581 (798)
                      ||+|+|||+||||||||+|||+||   ++.+.+|+++|||||+++|++++|+|+|||||||+++|.||++|+++||||||
T Consensus         1 ~p~~~~l~~GPsGvGKT~lAk~la~~l~~~~~~~i~~dm~e~~~~~~v~~l~g~~~gyvg~~~~G~l~~~v~~~p~~Vil   80 (168)
T pfam07724         1 RPIGSFLFLGPTGVGKTELAKALAELLFGDERALIRIDMSEYMEEHSVSRLIGAPPGYVGYEEGGQLTEAVRRKPYSIVL   80 (168)
T ss_pred             CCCEEEEEECCCCCCHHHHHHHHHHHHCCCCCCEEEECCCCCCCHHHHHHHCCCCCCCCCCCCCCCHHHHHHHCCCCEEE
T ss_conf             98379998898998999999999999679853448855756542569998705899872624265078999838984898


Q ss_pred             ECCHHHCCHHHHHHHHHHHHHHHCCCCCCCEECCCCEEEEEECCCCHHHHHHC-CCC--CCCCCCHHHHHHHHHHHCCHH
Q ss_conf             40445502899999999877750217799776125429999424214553303-689--882111488999998728878
Q gi|254780163|r  582 LDEIEKSHPDVLNILLQIMDYGILTDQSGKKISFRNVILIMTTNAGALEMSKA-RIG--FGSSRNDDADKEALRNFLSPE  658 (798)
Q Consensus       582 ~DEiEKAh~~v~~~llqild~G~ltd~~Gr~vdf~n~iii~TsN~G~~~~~~~-~~g--~~~~~~~~~~~~~l~~~f~pe  658 (798)
                      |||||||||+|+++|||+||+|+++|+.||+|||+|||||||||+|++.+.+. ..+  ...........++++++|+||
T Consensus        81 lDEIeKa~~~V~~~LL~ild~g~~~d~~g~~v~~~n~i~i~Tsn~g~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~f~PE  160 (168)
T pfam07724        81 IDEIEKAHPGVQNDLLQILEGGTLTDKQGRKVDFRNTLFIMTGNFGSEKISDASRLGKSPDYELLKELVMDLLKKGFIPE  160 (168)
T ss_pred             EHHHHHHCHHHHHHHHHHCCCCCEECCCCCEEECCCEEEEECCCCCCHHHHHHHHCCCCCCHHHHHHHHHHHHHCCCCHH
T ss_conf             65776658999999998705870636999678446479997687372999986304678547999999999998698846


Q ss_pred             HHCCCCEE
Q ss_conf             81776828
Q gi|254780163|r  659 FLNRLDSI  666 (798)
Q Consensus       659 flnRid~i  666 (798)
                      |+||||.|
T Consensus       161 flnRid~i  168 (168)
T pfam07724       161 FLGRLPII  168 (168)
T ss_pred             HHCCCCCC
T ss_conf             73575839


No 10 
>PRK05342 clpX ATP-dependent protease ATP-binding subunit ClpX; Provisional
Probab=99.97  E-value=7.7e-29  Score=226.41  Aligned_cols=268  Identities=28%  Similarity=0.471  Sum_probs=198.4

Q ss_pred             HHCCHHHHHHHCHHHHHHHHHHHH----HHHHCCCCCCC---CCCCEEEEECCCCHHHHHHHHHHHHHCCCCEEEEEHHH
Q ss_conf             100002466534589999999998----77520445657---87406886143200388999998730477337720688
Q gi|254780163|r  470 NLEKNLGTVVYGQEEAIKKLSSSI----KIARAGLSDPN---KPIGCYVFSGPTGVGKTEISKQLAFALGVQLLRFDMSE  542 (798)
Q Consensus       470 ~l~~~l~~~v~GQ~~ai~~v~~~i----~~~~~gl~~~~---rP~g~flf~GptGvGKTelak~la~~~~~~lir~dmse  542 (798)
                      .+.+.|.+.||||++|-..++-|+    +|.+......+   =+-...|++||||+|||+||++||..++.+|+..|.+.
T Consensus        65 eI~~~LD~yVIGQ~~AKk~lsVAvyNHykRi~~~~~~~~~vei~KsNILliGPTG~GKTlla~tLAk~l~vPF~iaDAT~  144 (411)
T PRK05342         65 EIKAHLDQYVIGQERAKKVLSVAVYNHYKRLRQNGSKSDDVELQKSNILLIGPTGSGKTLLAQTLARILNVPFAIADATT  144 (411)
T ss_pred             HHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCEEEECCCCCCHHHHHHHHHHHHCCCEEEEEECE
T ss_conf             99998621402848888999999999999986021335665213453899899997788999999998699989986120


Q ss_pred             HHCCCCCCHHCCCCCHHCCCCCCCCCCHH-------HHHCCCEEEEECCHHHCC---------H-----HHHHHHHHHHH
Q ss_conf             61246530110478000256444310035-------551585177740445502---------8-----99999999877
Q gi|254780163|r  543 YMERHAVSRLIGAPPGYVGFGQGGILADS-------VDQNPYSVVLLDEIEKSH---------P-----DVLNILLQIMD  601 (798)
Q Consensus       543 y~e~~~vs~LiGappGYvG~~egg~Lte~-------vr~~P~sVvl~DEiEKAh---------~-----~v~~~llqild  601 (798)
                      |+|.           ||||-|-...|..-       |.+.-+.+|.+|||+|-.         +     .|+..||.+++
T Consensus       145 lTEa-----------GYVGeDVE~ii~~Llq~Ad~dve~Ae~GIV~IDEIDKIarks~~~s~trDVSgEGVQqaLLkiiE  213 (411)
T PRK05342        145 LTEA-----------GYVGEDVENILLKLLQAADYDVEKAQRGIVYIDEIDKIARKSENPSITRDVSGEGVQQALLKILE  213 (411)
T ss_pred             ECCC-----------CCCCCCHHHHHHHHHHHCCCCHHHHHCCEEEEEEHHHHHHCCCCCCCCCCCCCHHHHHHHHHHHC
T ss_conf             0126-----------74560799999999998288899883682888502345424788888777651248999999875


Q ss_pred             HHHCCC---CCCC--------EECCCCEEEEEECCCCHH---------HHHHCCCCCCCCCCHHHH------------HH
Q ss_conf             750217---7997--------761254299994242145---------533036898821114889------------99
Q gi|254780163|r  602 YGILTD---QSGK--------KISFRNVILIMTTNAGAL---------EMSKARIGFGSSRNDDAD------------KE  649 (798)
Q Consensus       602 ~G~ltd---~~Gr--------~vdf~n~iii~TsN~G~~---------~~~~~~~g~~~~~~~~~~------------~~  649 (798)
                       |+...   ..||        .||-+|.++|+.   ||-         .+.+.++||+........            .+
T Consensus       214 -Gt~v~vp~~ggrkhp~~~~~~idT~nILFI~g---GAF~GL~~II~~R~~~~~iGF~~~~~~~~~~~~~~~l~~v~p~D  289 (411)
T PRK05342        214 -GTVASVPPQGGRKHPQQEFIQVDTTNILFICG---GAFDGLEKIIKQRLGKSGIGFGAEVKSKDEKDLGELLAQVEPED  289 (411)
T ss_pred             -CCEECCCCCCCCCCCCCCEEEEECCCEEEEEC---CCCCCHHHHHHHHCCCCCCCCCCCCCCCCCCCHHHHHHHCCHHH
T ss_conf             -87141188877778776516761471799911---55335899998635788767788766411000567876279878


Q ss_pred             HHHHHCCHHHHCCCCEEEECCCCCHHHHHHHHH----HHHHHHHHHHHHCCCEEEECHHHHHHHHHCCCCCCCCCHHHHH
Q ss_conf             998728878817768289628899999999999----9999999999866988999889999999718981015326799
Q gi|254780163|r  650 ALRNFLSPEFLNRLDSIIPFFPLSSDIIRQVVH----KFIMKLELQLQEKGISFHFSEEVINWLVSHGYDVKMGARPLER  725 (798)
Q Consensus       650 ~l~~~f~peflnRid~ii~F~~l~~~~~~~i~~----~~l~~l~~~l~~~~i~l~~~~~~~~~l~~~~~~~~~GAR~l~r  725 (798)
                      -++--|=|||++|+.-++.+++|+.+++.+|+.    -.+++..+.++..|+.|+|+++|++.+|++......|||.|+.
T Consensus       290 Li~fGlIPEfiGRlPViv~L~~L~~~~L~~ILtePkNaLikQY~~LF~~dgV~L~Ft~~AL~~IA~~A~~~~tGARgLRs  369 (411)
T PRK05342        290 LVKFGLIPEFIGRLPVVATLEELDEEALVRILTEPKNALVKQYQKLFEMDGVELEFTDDALEAIAKKAIERKTGARGLRS  369 (411)
T ss_pred             HHHCCCCHHHHCCCCEEEECCCCCHHHHHHHHCCCCCHHHHHHHHHHHHCCCEEEECHHHHHHHHHHHHHHCCCHHHHHH
T ss_conf             88738837761466405462447999999996587415999999999754967998689999999999984757457799


Q ss_pred             HHHHHHHHHHHHHHHCCCCCCCCEEEEEEEECC
Q ss_conf             999862359999996296768884899996078
Q gi|254780163|r  726 IIKEHVKVPLADEILFGKLKKGGGVVKVSLNPD  758 (798)
Q Consensus       726 ~i~~~i~~~la~~il~~~~~~g~~~~~v~~~~~  758 (798)
                      ++++.+.+     ++| ++++-..+.+|.++.+
T Consensus       370 IlE~iLld-----~MF-elPs~~~v~~v~It~~  396 (411)
T PRK05342        370 ILEEVLLD-----VMF-ELPSREDVEKVVITEE  396 (411)
T ss_pred             HHHHHHHH-----HHC-CCCCCCCCCEEEECHH
T ss_conf             99999788-----754-4889899709998879


No 11 
>TIGR00382 clpX ATP-dependent Clp protease, ATP-binding subunit ClpX; InterPro: IPR004487   ClpX is a member of the HSP (heat-shock protein) 100 family. Gel filtration and electron microscopy showed that ClpX subunits associate to form a six-membered ring that is stabilized by binding of ATP or nonhydrolyzable analogs of ATP . It functions as an ATP-depedent  molecular chaperone and is the regulatory subunit of the ClpXP protease .   ClpXP is involved in DNA damage repair, stationary-phase gene expression, and ssrA-mediated protein quality control. To date more than 50 proteins include transcription factors, metabolic enzymes, and proteins involved in the starvation and oxidative stress responses have been identified as substrates .    The N-terminal domain of ClpX is a C4-type zinc binding domain (ZBD) involved in substrate recognition. ZBD forms a very stable dimer that is essential for promoting the degradation of some typical ClpXP substrates such as lO and MuA .  ; GO: 0005515 protein binding, 0005524 ATP binding, 0016887 ATPase activity, 0015031 protein transport.
Probab=99.96  E-value=7.2e-29  Score=226.60  Aligned_cols=278  Identities=29%  Similarity=0.422  Sum_probs=214.9

Q ss_pred             CCCCHHHHHCCHHHHHHHHCCHHHHHHHCHHHHHHHHHHH----HHHHHC--CCC--CCC-C------------CCCEEE
Q ss_conf             4531011100112334210000246653458999999999----877520--445--657-8------------740688
Q gi|254780163|r  453 RSIHTTSFSRDDDSVLSNLEKNLGTVVYGQEEAIKKLSSS----IKIARA--GLS--DPN-K------------PIGCYV  511 (798)
Q Consensus       453 ~gip~~~~~~~~~~~l~~l~~~l~~~v~GQ~~ai~~v~~~----i~~~~~--gl~--~~~-r------------P~g~fl  511 (798)
                      ..+|.-+          .+.+.|..+|||||+|-+.++-|    ++|.+.  -..  |+. .            --...|
T Consensus        87 ~~lP~P~----------eik~~LD~YVIGQe~AKKVLsVAVYNHYKRl~~~~~n~~~d~~D~nvelehleeVEL~KSNIL  156 (452)
T TIGR00382        87 SELPTPK----------EIKAHLDEYVIGQEQAKKVLSVAVYNHYKRLNLKEKNKKSDNGDSNVELEHLEEVELSKSNIL  156 (452)
T ss_pred             HCCCCCH----------HHHHHHCCCCCCCCCCCEEEEEEEHHHHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHHCCCEE
T ss_conf             2478827----------999972136123101052543241124666532430455588400023544444333006624


Q ss_pred             EECCCCHHHHHHHHHHHHHCCCCEEEEEHHHHHCCCCCCHHCCCCCHHCCCCCCCCCCHHHHHCCC-------EEEEECC
Q ss_conf             614320038899999873047733772068861246530110478000256444310035551585-------1777404
Q gi|254780163|r  512 FSGPTGVGKTEISKQLAFALGVQLLRFDMSEYMERHAVSRLIGAPPGYVGFGQGGILADSVDQNPY-------SVVLLDE  584 (798)
Q Consensus       512 f~GptGvGKTelak~la~~~~~~lir~dmsey~e~~~vs~LiGappGYvG~~egg~Lte~vr~~P~-------sVvl~DE  584 (798)
                      ++||||+|||-||++||..++.+|---|-...+|+           ||||=|=--.|++-+...-|       .+|..||
T Consensus       157 LiGPTGSGKTLLAqTLA~~L~VPfAiADATtLTEA-----------GYVGEDVENIL~~Llq~ad~DV~kA~kGIiYIDE  225 (452)
T TIGR00382       157 LIGPTGSGKTLLAQTLARILNVPFAIADATTLTEA-----------GYVGEDVENILLKLLQAADYDVEKAQKGIIYIDE  225 (452)
T ss_pred             EECCCCCCHHHHHHHHHHHCCCCEEECCHHHHHCC-----------CCCCCCHHHHHHHHHHHCCCCHHHHCCCEEEEEC
T ss_conf             54688852689999999873887421111102006-----------6424228899999987414552452785089842


Q ss_pred             HHHCCH--------------HHHHHHHHHHHHHHCCC---CCCCEECCCCEEEEEECCC-----CH----HH-----HHH
Q ss_conf             455028--------------99999999877750217---7997761254299994242-----14----55-----330
Q gi|254780163|r  585 IEKSHP--------------DVLNILLQIMDYGILTD---QSGKKISFRNVILIMTTNA-----GA----LE-----MSK  633 (798)
Q Consensus       585 iEKAh~--------------~v~~~llqild~G~ltd---~~Gr~vdf~n~iii~TsN~-----G~----~~-----~~~  633 (798)
                      |+|-.+              -|++.||.+++ |++..   --||+----++|=|=|||+     ||    +.     +.+
T Consensus       226 IDKIaRkSEN~SITRDVSGEGVQQALLKi~E-GTvA~vPPqGGRKHP~~~~iqiDTs~ILFICGGAF~GL~~iI~~R~~~  304 (452)
T TIGR00382       226 IDKIARKSENPSITRDVSGEGVQQALLKIIE-GTVANVPPQGGRKHPQQEFIQIDTSNILFICGGAFVGLEKIIKKRTEK  304 (452)
T ss_pred             CCCHHHHCCCCEEEEEECCCHHHHHHHHHHH-CCEEEECCCCCCCCCCCCEEEECCCCEEEEECCHHHHHHHHHHHHHCC
T ss_conf             2310121577801122175549999998760-323431754488688657688647640011054344489999887455


Q ss_pred             CC-CCCCCCCCHHHHHH----HHHH---------HCCHHHHCCCCEEEECCCCCHHHHHHHHHHHHHHHHHHHH----HC
Q ss_conf             36-89882111488999----9987---------2887881776828962889999999999999999999998----66
Q gi|254780163|r  634 AR-IGFGSSRNDDADKE----ALRN---------FLSPEFLNRLDSIIPFFPLSSDIIRQVVHKFIMKLELQLQ----EK  695 (798)
Q Consensus       634 ~~-~g~~~~~~~~~~~~----~l~~---------~f~peflnRid~ii~F~~l~~~~~~~i~~~~l~~l~~~l~----~~  695 (798)
                      ++ +||+.........+    .|++         -+=|||++||..+-..++|+.++|.+|+..-=+.|.++++    --
T Consensus       305 ~~~iGF~~~~~~~~~~~~~~~~L~~v~~~DL~kFGLIPEfIGRLPV~a~L~~L~~eAL~~IL~~PkNAlvKQY~~lf~ld  384 (452)
T TIGR00382       305 KSSIGFGAEVKKKSKEKSEEELLRQVEPEDLVKFGLIPEFIGRLPVIATLEKLDEEALIAILTKPKNALVKQYQALFKLD  384 (452)
T ss_pred             CCCCCCCCCHHHHHHHHHHHHHHHHHCHHHHHHHCCCCCCCCCCCCEECCCCCCHHHHHHHHHCCCHHHHHHHHHHHCCC
T ss_conf             53335455210045787899999751711122105551011053402027878878999985254444889999971645


Q ss_pred             CCEEEECHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHHHHHHHHHCCCCCCCCEEEEEEEECC
Q ss_conf             988999889999999718981015326799999862359999996296768884899996078
Q gi|254780163|r  696 GISFHFSEEVINWLVSHGYDVKMGARPLERIIKEHVKVPLADEILFGKLKKGGGVVKVSLNPD  758 (798)
Q Consensus       696 ~i~l~~~~~~~~~l~~~~~~~~~GAR~l~r~i~~~i~~~la~~il~~~~~~g~~~~~v~~~~~  758 (798)
                      +|.|.|.++|++.+|++...++.|||.||-+|+..+.+     ++| +|++=..+-+|.++.+
T Consensus       385 ~VeL~F~~eAl~~IA~~A~~RkTGARGLRsI~E~~lLD-----vMf-eLPs~~~~~kv~it~~  441 (452)
T TIGR00382       385 NVELEFEEEALKAIAKKALERKTGARGLRSIVEGLLLD-----VMF-ELPSLEDLEKVVITKE  441 (452)
T ss_pred             CCCCCCCHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHH-----HCC-CCCCHHCCCEEEEEHH
T ss_conf             61134558889999999985076751578999999875-----314-7886115756787077


No 12 
>COG1219 ClpX ATP-dependent protease Clp, ATPase subunit [Posttranslational modification, protein turnover, chaperones]
Probab=99.94  E-value=2.1e-25  Score=201.66  Aligned_cols=271  Identities=30%  Similarity=0.438  Sum_probs=198.6

Q ss_pred             HHCCHHHHHHHCHHHHHHHHHHH----HHHHHCCCCCCCCC--CCEEEEECCCCHHHHHHHHHHHHHCCCCEEEEEHHHH
Q ss_conf             10000246653458999999999----87752044565787--4068861432003889999987304773377206886
Q gi|254780163|r  470 NLEKNLGTVVYGQEEAIKKLSSS----IKIARAGLSDPNKP--IGCYVFSGPTGVGKTEISKQLAFALGVQLLRFDMSEY  543 (798)
Q Consensus       470 ~l~~~l~~~v~GQ~~ai~~v~~~----i~~~~~gl~~~~rP--~g~flf~GptGvGKTelak~la~~~~~~lir~dmsey  543 (798)
                      .+...|.++||||+.|-..++-|    .+|.+..-.+.+--  -...|++||||+|||.||++||..+..+|.--|....
T Consensus        54 eik~~Ld~YVIGQe~AKKvLsVAVYNHYKRl~~~~~~~dvEL~KSNILLiGPTGsGKTlLAqTLAk~LnVPFaiADATtL  133 (408)
T COG1219          54 EIKAHLDEYVIGQEQAKKVLSVAVYNHYKRLNNKEDNDDVELSKSNILLIGPTGSGKTLLAQTLAKILNVPFAIADATTL  133 (408)
T ss_pred             HHHHHHHHHEECCHHHHCEEEEEEEHHHHHHHCCCCCCCEEEEECCEEEECCCCCCHHHHHHHHHHHHCCCEEECCCCCH
T ss_conf             99998652432625431034664106889986048877635320317998889975779999999984898475144412


Q ss_pred             HCCCCCCHHCCCCCHHCCCCCCCCCCHH-------HHHCCCEEEEECCHHHCC-----H---------HHHHHHHHHHHH
Q ss_conf             1246530110478000256444310035-------551585177740445502-----8---------999999998777
Q gi|254780163|r  544 MERHAVSRLIGAPPGYVGFGQGGILADS-------VDQNPYSVVLLDEIEKSH-----P---------DVLNILLQIMDY  602 (798)
Q Consensus       544 ~e~~~vs~LiGappGYvG~~egg~Lte~-------vr~~P~sVvl~DEiEKAh-----~---------~v~~~llqild~  602 (798)
                      +|           +||||-|-...|..-       |.+.-..+|..|||+|-.     |         .|+..||.|++ 
T Consensus       134 TE-----------AGYVGEDVENillkLlqaadydV~rAerGIIyIDEIDKIarkSen~SITRDVSGEGVQQALLKiiE-  201 (408)
T COG1219         134 TE-----------AGYVGEDVENILLKLLQAADYDVERAERGIIYIDEIDKIARKSENPSITRDVSGEGVQQALLKIIE-  201 (408)
T ss_pred             HH-----------CCCCCHHHHHHHHHHHHHCCCCHHHHHCCEEEEECHHHHHCCCCCCCCCCCCCCHHHHHHHHHHHC-
T ss_conf             10-----------663550089999999987645888882885998510254205789872343673589999999970-


Q ss_pred             HHCC---CCCCCEECCCCEEEEEECCC-----CH----HH-----HHHCCCCCCCCCCHHHH----H---------HHHH
Q ss_conf             5021---77997761254299994242-----14----55-----33036898821114889----9---------9998
Q gi|254780163|r  603 GILT---DQSGKKISFRNVILIMTTNA-----GA----LE-----MSKARIGFGSSRNDDAD----K---------EALR  652 (798)
Q Consensus       603 G~lt---d~~Gr~vdf~n~iii~TsN~-----G~----~~-----~~~~~~g~~~~~~~~~~----~---------~~l~  652 (798)
                      |+..   -.-||+-.--..|-|-|||+     ||    +.     +...++||+.+..+...    .         +-++
T Consensus       202 GTvasVPPqGGRKHP~Qe~iqvDT~NILFIcgGAF~GlekiI~~R~~~~~iGF~a~~~~~~~~~~~~~~l~~vepeDLvk  281 (408)
T COG1219         202 GTVASVPPQGGRKHPQQEFIQVDTSNILFICGGAFAGLEKIIKKRLGKKGIGFGAEVKSKSKKKEEGELLKQVEPEDLVK  281 (408)
T ss_pred             CCEECCCCCCCCCCCCCCEEEECCCCEEEEECCCCCCHHHHHHHHCCCCCCCCCCCCCCHHHHHHHHHHHHHCCHHHHHH
T ss_conf             75102399988879842048873763467824401039999998626874245664453444412889987548687887


Q ss_pred             HHCCHHHHCCCCEEEECCCCCHHHHHHHHHHHHHHHH----HHHHHCCCEEEECHHHHHHHHHCCCCCCCCCHHHHHHHH
Q ss_conf             7288788177682896288999999999999999999----999866988999889999999718981015326799999
Q gi|254780163|r  653 NFLSPEFLNRLDSIIPFFPLSSDIIRQVVHKFIMKLE----LQLQEKGISFHFSEEVINWLVSHGYDVKMGARPLERIIK  728 (798)
Q Consensus       653 ~~f~peflnRid~ii~F~~l~~~~~~~i~~~~l~~l~----~~l~~~~i~l~~~~~~~~~l~~~~~~~~~GAR~l~r~i~  728 (798)
                      --.=|||++|+..|....+|+.+++.+|+..--+.|.    +.+...++.|+|+++|+..++++...++.|||.||.+++
T Consensus       282 FGLIPEfIGRlPvia~L~~Lde~aLv~ILtePkNAlvKQYq~Lf~~d~V~L~F~~~AL~~IA~~A~~rkTGARGLRsI~E  361 (408)
T COG1219         282 FGLIPEFIGRLPVIATLEELDEDALVQILTEPKNALVKQYQKLFEMDGVELEFTEEALKAIAKKAIERKTGARGLRSIIE  361 (408)
T ss_pred             CCCCHHHHCCCCEEEEHHHCCHHHHHHHHHCCCHHHHHHHHHHHCCCCCEEEECHHHHHHHHHHHHHHCCCHHHHHHHHH
T ss_conf             08838872666326461015999999997265178999999996446916997489999999999984335357999999


Q ss_pred             HHHHHHHHHHHHCCCCCCCCEEEEEEEECC
Q ss_conf             862359999996296768884899996078
Q gi|254780163|r  729 EHVKVPLADEILFGKLKKGGGVVKVSLNPD  758 (798)
Q Consensus       729 ~~i~~~la~~il~~~~~~g~~~~~v~~~~~  758 (798)
                      ..+.+     +++ ++++-..+.+|.++.+
T Consensus       362 ~~lld-----~Mf-elPs~~~v~~v~I~~~  385 (408)
T COG1219         362 ELLLD-----VMF-ELPSLEDVEKVVITEE  385 (408)
T ss_pred             HHHHH-----HHH-HCCCCCCCEEEEEEHH
T ss_conf             99999-----885-2788678508997688


No 13 
>PRK05201 hslU ATP-dependent protease ATP-binding subunit; Provisional
Probab=99.93  E-value=4.1e-24  Score=192.43  Aligned_cols=240  Identities=23%  Similarity=0.445  Sum_probs=167.3

Q ss_pred             HHCCHHHHHHHCHHHHHHHHHHHHH----HHH--CCCCCCCCCCCEEEEECCCCHHHHHHHHHHHHHCCCCEEEEEHHHH
Q ss_conf             1000024665345899999999987----752--0445657874068861432003889999987304773377206886
Q gi|254780163|r  470 NLEKNLGTVVYGQEEAIKKLSSSIK----IAR--AGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFALGVQLLRFDMSEY  543 (798)
Q Consensus       470 ~l~~~l~~~v~GQ~~ai~~v~~~i~----~~~--~gl~~~~rP~g~flf~GptGvGKTelak~la~~~~~~lir~dmsey  543 (798)
                      .+.+.|.+.||||++|-.+|+-|++    |.+  ..+++.--|- ..|++|||||||||+|+.||...+.+|+..|.+-|
T Consensus         8 eIv~~LD~yIIGQ~~AKkavAVAlrNr~RR~~l~~~lr~Ei~pk-NILmIGPTGvGKTeIARrLAkl~~aPFvkveATk~   86 (442)
T PRK05201          8 EIVSELDKYIIGQDDAKRAVAIALRNRWRRMQLPEELRDEVTPK-NILMIGPTGVGKTEIARRLAKLANAPFIKVEATKF   86 (442)
T ss_pred             HHHHHHCCCCCCCHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCC-CEEEECCCCCCHHHHHHHHHHHHCCCEEEEECCCC
T ss_conf             99998536010827766787778877787531662212334643-16887888866789999999984898587521310


Q ss_pred             HCCCCC----------------------------------------CHHCCCCCHHCCCCCC-----------------C
Q ss_conf             124653----------------------------------------0110478000256444-----------------3
Q gi|254780163|r  544 MERHAV----------------------------------------SRLIGAPPGYVGFGQG-----------------G  566 (798)
Q Consensus       544 ~e~~~v----------------------------------------s~LiGappGYvG~~eg-----------------g  566 (798)
                      +|..-|                                        ..|+|++++..+-+.+                 |
T Consensus        87 TEvGYvGrDVEsiIrdLv~~a~~~~k~~~~~~v~~~A~~~a~~ril~~L~~~~~~~~~~~~~~~~~~~tre~~r~~Lr~G  166 (442)
T PRK05201         87 TEVGYVGRDVESIIRDLVEIAVKMVREEKREKVREKAEEAAEERILDALLPPAKNNWGEEEEEEESSATRQKFRKKLREG  166 (442)
T ss_pred             CCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCHHHHHHHHHHHHHHCC
T ss_conf             00343564378899999999999999999999999999999999999855865555555454202367899999998658


Q ss_pred             -----------------------------------------------------------------------CCCHHHHHC
Q ss_conf             -----------------------------------------------------------------------100355515
Q gi|254780163|r  567 -----------------------------------------------------------------------ILADSVDQN  575 (798)
Q Consensus       567 -----------------------------------------------------------------------~Lte~vr~~  575 (798)
                                                                                             ..-+|+++-
T Consensus       167 ~Ldd~~IeIev~~~~~~~~~~~~g~~~~~~~l~~~~~~~~~~~~kkr~~tVkeA~~iL~~eEa~klid~d~v~~eAi~~a  246 (442)
T PRK05201        167 ELDDKEIEIEVADAPGVEIMGPPGMEEMGNQLQDMFGNLGPKKKKKRKLKVKEARKLLIEEEAAKLVDQEEIKQEAIERV  246 (442)
T ss_pred             CCCCCEEEEEECCCCCCCCCCCCCHHHHHHHHHHHHHCCCCCCCCEEEEEHHHHHHHHHHHHHHHCCCHHHHHHHHHHHH
T ss_conf             86655578861577777777887515566679987640278887404646999999999999986248899999999988


Q ss_pred             -CCEEEEECCHHHCC------------HHHHHHHHHHHHHHHCC-CCCCCEECCCCEEEEEECCCCHHHHHHCCCCCCCC
Q ss_conf             -85177740445502------------89999999987775021-77997761254299994242145533036898821
Q gi|254780163|r  576 -PYSVVLLDEIEKSH------------PDVLNILLQIMDYGILT-DQSGKKISFRNVILIMTTNAGALEMSKARIGFGSS  641 (798)
Q Consensus       576 -P~sVvl~DEiEKAh------------~~v~~~llqild~G~lt-d~~Gr~vdf~n~iii~TsN~G~~~~~~~~~g~~~~  641 (798)
                       -+.+|++|||+|--            -.|+.-||.+++ |+-- --.| .|+..|.++|+   .||-..+++       
T Consensus       247 Eq~GIVFIDEIDKIa~~~~~~g~DVS~EGVQrdLLpivE-Gt~V~tK~G-~V~TdhILFIa---sGAFh~sKP-------  314 (442)
T PRK05201        247 EQNGIVFIDEIDKIAKRGEGSGPDVSREGVQRDLLPLVE-GSTVSTKYG-MVKTDHILFIA---SGAFHVAKP-------  314 (442)
T ss_pred             HHCCCEEECHHHHHHCCCCCCCCCCCCHHHHHHHHHHHC-CCCCCCCCC-CCCCCEEEEEC---CCCCCCCCC-------
T ss_conf             761704511465653035788989773307888788753-885556777-60255034550---450014782-------


Q ss_pred             CCHHHHHHHHHHHCCHHHHCCCCEEEECCCCCHHHHHHHHHH----HHHHHHHHHHHCCCEEEECHHHHHHHHHCCCC--
Q ss_conf             114889999987288788177682896288999999999999----99999999986698899988999999971898--
Q gi|254780163|r  642 RNDDADKEALRNFLSPEFLNRLDSIIPFFPLSSDIIRQVVHK----FIMKLELQLQEKGISFHFSEEVINWLVSHGYD--  715 (798)
Q Consensus       642 ~~~~~~~~~l~~~f~peflnRid~ii~F~~l~~~~~~~i~~~----~l~~l~~~l~~~~i~l~~~~~~~~~l~~~~~~--  715 (798)
                        ++         +=|||.+|+.-++.+++|+.+++.+|+.-    .+++....+.-.|+.|+|++++++.+|+..+.  
T Consensus       315 --SD---------LIPEl~GRlPv~v~L~~L~~~dl~~ILtepknsL~kQy~~Lf~~egv~L~Ft~~Al~~IA~~A~~~n  383 (442)
T PRK05201        315 --SD---------LIPELQGRFPIRVELDALTEEDFVRILTEPKASLIKQYQALLATEGVTLEFTDDAIRRIAEIAYQVN  383 (442)
T ss_pred             --CH---------HHHHHCCCCEEEEECCCCCHHHHHHHHCCCCHHHHHHHHHHHHHCCCEEEECHHHHHHHHHHHHHHC
T ss_conf             --02---------2498717550588824499999999967861578999999986249679984799999999999851


Q ss_pred             ---CCCCCHHHHHHHHHHHHH
Q ss_conf             ---101532679999986235
Q gi|254780163|r  716 ---VKMGARPLERIIKEHVKV  733 (798)
Q Consensus       716 ---~~~GAR~l~r~i~~~i~~  733 (798)
                         ...|||.|+-++++.+++
T Consensus       384 ~~~~~iGAR~L~tI~E~vl~d  404 (442)
T PRK05201        384 EKTENIGARRLHTVMEKLLED  404 (442)
T ss_pred             CCCCCCCHHHHHHHHHHHHHH
T ss_conf             447667737889999999898


No 14 
>KOG0730 consensus
Probab=99.91  E-value=1.3e-21  Score=174.46  Aligned_cols=401  Identities=26%  Similarity=0.409  Sum_probs=252.6

Q ss_pred             CEEEECCCCCHHHHHHHHHHHHHHCCCCCHHHHEEEEEEEEHHHHHCCCCCCCHHHHHHHHHHHHHCCCC-CEEEEECCH
Q ss_conf             7489667641166899999999854898834520144554046753063431237899999998720389-839997361
Q gi|254780163|r  227 NPLYVGDPGVGKTAIAEGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIESYA-NAILYIDEI  305 (798)
Q Consensus       227 n~~lvG~~gvGktaive~la~~i~~~~vp~~l~~~~i~~ld~~~l~ag~~~rg~fe~r~~~~~~~~~~~~-~~ilfidei  305 (798)
                      ++++.|+||+|||-+++.+|+.-          +..++.++...++.  +|-||-|..++..+.++.+.. +.|+|||||
T Consensus       220 g~Ll~gppg~Gkt~l~~aVa~e~----------~a~~~~i~~peli~--k~~gEte~~LR~~f~~a~k~~~psii~IdEl  287 (693)
T KOG0730         220 GLLLYGPPGTGKTFLVRAVANEY----------GAFLFLINGPELIS--KFPGETESNLRKAFAEALKFQVPSIIFIDEL  287 (693)
T ss_pred             CCCCCCCCCCCHHHHHHHHHHHH----------CCEEEECCCHHHHH--HCCCCHHHHHHHHHHHHHCCCCCEEEEHHHH
T ss_conf             74443899998189999999973----------72257406289998--5246317789999999866599807758767


Q ss_pred             HHHHCCCCCCCCCCC-----HHH---HHHHHHCCCCEEEEEECCHHHHHHHHHCCHHHHH-HCEE-EEECCCCHHHHHHH
Q ss_conf             663015544434477-----788---8876630266038873048999998520111432-0014-43068786899999
Q gi|254780163|r  306 HTLVGAGSASGISVD-----ASN---LLKPALSSGAVRCIGSTTYSEYRQFFEKDKALVR-RFQK-IDVSEPSIEDAIEI  375 (798)
Q Consensus       306 h~ligag~~~g~~~d-----~an---~lkP~L~rg~~~~IgatT~~ey~~~~e~d~al~r-rF~~-i~v~ep~~~~~~~i  375 (798)
                      +.|.+-  ..+ .-+     .+.   +++-..+++.+-||++|--.     -.-|+||.| ||.. |.|.-|+......|
T Consensus       288 d~l~p~--r~~-~~~~e~Rv~sqlltL~dg~~~~~~vivl~atnrp-----~sld~alRRgRfd~ev~IgiP~~~~RldI  359 (693)
T KOG0730         288 DALCPK--REG-ADDVESRVVSQLLTLLDGLKPDAKVIVLAATNRP-----DSLDPALRRGRFDREVEIGIPGSDGRLDI  359 (693)
T ss_pred             HHHCCC--CCC-CCHHHHHHHHHHHHHHHHCCCCCCEEEEEECCCC-----CCCCHHHHCCCCCCEEEECCCCCHHHHHH
T ss_conf             623776--433-3248889999999998527676746999715885-----55685652478853157448983358899


Q ss_pred             HHHHHHHHHHHCCCEECCHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHCCCCC
Q ss_conf             98612766541035121117899999865420155564679889986533332114432211365789998663102453
Q gi|254780163|r  376 VKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLPDKAIDVIDEAGASQILQPLSKRRKFITEKDIKKTIASMNRSI  455 (798)
Q Consensus       376 L~~~~~~ye~~h~v~~~~~al~~av~ls~ryi~~r~lPdkAidllDea~a~~~~~~~~~~~~~~~~~~i~~~~~~~~~gi  455 (798)
                      |+-+-..++-    . ++.-+..+....+-|.-.     ..-.++-+|    .++....     +.+++.....    +|
T Consensus       360 l~~l~k~~~~----~-~~~~l~~iA~~thGyvGa-----DL~~l~~ea----~~~~~r~-----~~~~~~~A~~----~i  416 (693)
T KOG0730         360 LRVLTKKMNL----L-SDVDLEDIAVSTHGYVGA-----DLAALCREA----SLQATRR-----TLEIFQEALM----GI  416 (693)
T ss_pred             HHHHHHHCCC----C-CHHHHHHHHHHCCCHHHH-----HHHHHHHHH----HHHHHHH-----HHHHHHHHHH----CC
T ss_conf             9999861688----7-255689999873461478-----799999998----7776655-----5777899870----68


Q ss_pred             CHHHHHCCHHHHHHHHCCHHHHHHH-CHHHHHHHHHHHH--------HHHHCCCCCCCCCCCEEEEECCCCHHHHHHHHH
Q ss_conf             1011100112334210000246653-4589999999998--------775204456578740688614320038899999
Q gi|254780163|r  456 HTTSFSRDDDSVLSNLEKNLGTVVY-GQEEAIKKLSSSI--------KIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQ  526 (798)
Q Consensus       456 p~~~~~~~~~~~l~~l~~~l~~~v~-GQ~~ai~~v~~~i--------~~~~~gl~~~~rP~g~flf~GptGvGKTelak~  526 (798)
                      -...+    ++.+..+. +..-.-| |+++--..+-++|        .-.+.|+..|   -|+ ||-||+|+|||-+||+
T Consensus       417 ~psa~----Re~~ve~p-~v~W~dIGGlE~lK~elq~~V~~p~~~pe~F~r~Gi~pp---kGV-LlyGPPGC~KT~lAka  487 (693)
T KOG0730         417 RPSAL----REILVEMP-NVSWDDIGGLEELKRELQQAVEWPLKHPEKFARFGISPP---KGV-LLYGPPGCGKTLLAKA  487 (693)
T ss_pred             CCHHH----HHEECCCC-CCCHHHCCCHHHHHHHHHHHHHHHHHCHHHHHHHCCCCC---CEE-EEECCCCCCHHHHHHH
T ss_conf             70223----32002478-878220457899999999998616656599987257887---547-7778998624789999


Q ss_pred             HHHHCCCCEEEEEHHHHHCCCCCCHHCCCCCHHCCCCCC--CCCCHHHHHCCCEEEEECCHHH-----------CCHHHH
Q ss_conf             873047733772068861246530110478000256444--3100355515851777404455-----------028999
Q gi|254780163|r  527 LAFALGVQLLRFDMSEYMERHAVSRLIGAPPGYVGFGQG--GILADSVDQNPYSVVLLDEIEK-----------SHPDVL  593 (798)
Q Consensus       527 la~~~~~~lir~dmsey~e~~~vs~LiGappGYvG~~eg--g~Lte~vr~~P~sVvl~DEiEK-----------Ah~~v~  593 (798)
                      +|.....+|+.+-..|.+.+            |||-.|-  ..+..+-|+.+-||++||||+-           +.-.|+
T Consensus       488 lAne~~~nFlsvkgpEL~sk------------~vGeSEr~ir~iF~kAR~~aP~IiFfDEiDsi~~~R~g~~~~v~~RVl  555 (693)
T KOG0730         488 LANEAGMNFLSVKGPELFSK------------YVGESERAIREVFRKARQVAPCIIFFDEIDALAGSRGGSSSGVTDRVL  555 (693)
T ss_pred             HHHHHCCCEEECCCHHHHHH------------HCCCHHHHHHHHHHHHHHCCCEEEEHHHHHHHHHCCCCCCCCHHHHHH
T ss_conf             86463587264157899877------------518258999999999862698377446666666304787551489999


Q ss_pred             HHHHHHHHHHHCCCCCCCEECCCCEEEEEECCCCHHHHHHCCCCCCCCCCHHHHHHHHHHHCCHHHHCCCCEEEECCCCC
Q ss_conf             99999877750217799776125429999424214553303689882111488999998728878817768289628899
Q gi|254780163|r  594 NILLQIMDYGILTDQSGKKISFRNVILIMTTNAGALEMSKARIGFGSSRNDDADKEALRNFLSPEFLNRLDSIIPFFPLS  673 (798)
Q Consensus       594 ~~llqild~G~ltd~~Gr~vdf~n~iii~TsN~G~~~~~~~~~g~~~~~~~~~~~~~l~~~f~peflnRid~ii~F~~l~  673 (798)
                      +-||.-|| |....        +|.+||--+|--                 +....   ...+|   +|+|.+|.+-+-+
T Consensus       556 sqLLtEmD-G~e~~--------k~V~ViAATNRp-----------------d~ID~---ALlRP---GRlD~iiyVplPD  603 (693)
T KOG0730         556 SQLLTEMD-GLEAL--------KNVLVIAATNRP-----------------DMIDP---ALLRP---GRLDRIIYVPLPD  603 (693)
T ss_pred             HHHHHHCC-CCCCC--------CCEEEEECCCCH-----------------HHCCH---HHCCC---CCCCEEEEECCCC
T ss_conf             99998700-41014--------708999505881-----------------01269---77598---6533057515834


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHCCCEEEECHH-HHHHHHH--CCCCCCCCCHHHHHHHHHHHHHHHHHH
Q ss_conf             9999999999999999999866988999889-9999997--189810153267999998623599999
Q gi|254780163|r  674 SDIIRQVVHKFIMKLELQLQEKGISFHFSEE-VINWLVS--HGYDVKMGARPLERIIKEHVKVPLADE  738 (798)
Q Consensus       674 ~~~~~~i~~~~l~~l~~~l~~~~i~l~~~~~-~~~~l~~--~~~~~~~GAR~l~r~i~~~i~~~la~~  738 (798)
                      .+.-..|+...+++.         .  +.+. -++.|++  .||+   | +.|..+++.--...+.+-
T Consensus       604 ~~aR~~Ilk~~~kkm---------p--~~~~vdl~~La~~T~g~S---G-Ael~~lCq~A~~~a~~e~  656 (693)
T KOG0730         604 LEARLEILKQCAKKM---------P--FSEDVDLEELAQATEGYS---G-AEIVAVCQEAALLALRES  656 (693)
T ss_pred             HHHHHHHHHHHHHCC---------C--CCCCCCHHHHHHHHCCCC---H-HHHHHHHHHHHHHHHHHH
T ss_conf             788999999997339---------9--986556999999854677---3-899999999999999875


No 15 
>KOG0733 consensus
Probab=99.90  E-value=1.4e-20  Score=166.96  Aligned_cols=452  Identities=22%  Similarity=0.327  Sum_probs=251.6

Q ss_pred             CCHHHHHHHHHHHHHHHHHHCC-C-----------CCCEEEECCCCCHHHHHHHHHHHHHHCCCCCHHHHEEEEEEEEHH
Q ss_conf             6112221789999999986226-7-----------787489667641166899999999854898834520144554046
Q gi|254780163|r  202 KVDILVGRHEEINRTIQILCRR-S-----------KNNPLYVGDPGVGKTAIAEGFAKQIVDGMVPDILLGARIFSLDMG  269 (798)
Q Consensus       202 KLDPVIGRd~EI~riiqIL~RR-~-----------KNn~~lvG~~gvGktaive~la~~i~~~~vp~~l~~~~i~~ld~~  269 (798)
                      ++.-+=|-|+++..+.+++.-- +           -..++|-|+||.|||.++..+|..          .+.-++++...
T Consensus       188 ~f~diGG~d~~~~el~~li~~i~~Pe~~~~lGv~PprGvLlHGPPGCGKT~lA~AiAge----------l~vPf~~isAp  257 (802)
T KOG0733         188 SFSDIGGLDKTLAELCELIIHIKHPEVFSSLGVRPPRGVLLHGPPGCGKTSLANAIAGE----------LGVPFLSISAP  257 (802)
T ss_pred             CHHHCCCHHHHHHHHHHHHHHHCCCHHHHHCCCCCCCCEEEECCCCCCHHHHHHHHHHH----------CCCCEEEECCH
T ss_conf             36541673899999999998852811686628779975164489986478999997521----------28854851414


Q ss_pred             HHHCCCCCCCHHHHHHHHHHHHHCCCCCEEEEECCHHHHHCCCCCCCCCCC---HHHHHHHH--HC-----CCCEEEEEE
Q ss_conf             753063431237899999998720389839997361663015544434477---78888766--30-----266038873
Q gi|254780163|r  270 NLIAGTRYRGDFEERIKKIVKEIESYANAILYIDEIHTLVGAGSASGISVD---ASNLLKPA--LS-----SGAVRCIGS  339 (798)
Q Consensus       270 ~l~ag~~~rg~fe~r~~~~~~~~~~~~~~ilfideih~ligag~~~g~~~d---~an~lkP~--L~-----rg~~~~Iga  339 (798)
                      .+|+|.+  ||-|++++.++++++...+.|+|||||..|-+.-...+--|.   +|.+|--+  |.     .-.+-+|||
T Consensus       258 eivSGvS--GESEkkiRelF~~A~~~aPcivFiDeIDAI~pkRe~aqreMErRiVaQLlt~mD~l~~~~~~g~~VlVIgA  335 (802)
T KOG0733         258 EIVSGVS--GESEKKIRELFDQAKSNAPCIVFIDEIDAITPKREEAQREMERRIVAQLLTSMDELSNEKTKGDPVLVIGA  335 (802)
T ss_pred             HHHCCCC--CCCHHHHHHHHHHHHCCCCEEEEEECCCCCCCCHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCEEEEEC
T ss_conf             6531557--52289999999987366975998511001364404578899999999999851002566668997699824


Q ss_pred             CC-HHHHHHHHHCCHHHHH--HCEE-EEECCCCHHHHHHHHHHHHHHH--------H----HHCCCEECCHHHHHHHHHH
Q ss_conf             04-8999998520111432--0014-4306878689999998612766--------5----4103512111789999986
Q gi|254780163|r  340 TT-YSEYRQFFEKDKALVR--RFQK-IDVSEPSIEDAIEIVKGIKPYF--------E----EHHQLRYSKEAIRAAVQLS  403 (798)
Q Consensus       340 tT-~~ey~~~~e~d~al~r--rF~~-i~v~ep~~~~~~~iL~~~~~~y--------e----~~h~v~~~~~al~~av~ls  403 (798)
                      |+ |+      .-|+||.|  ||.. |-+.-|+...--+||+-+...+        +    ..||..  -.-|.+.+..+
T Consensus       336 TnRPD------slDpaLRRaGRFdrEI~l~vP~e~aR~~IL~~~~~~lrl~g~~d~~qlA~lTPGfV--GADL~AL~~~A  407 (802)
T KOG0733         336 TNRPD------SLDPALRRAGRFDREICLGVPSETAREEILRIICRGLRLSGDFDFKQLAKLTPGFV--GADLMALCREA  407 (802)
T ss_pred             CCCCC------CCCHHHHCCCCCCCEEEECCCCHHHHHHHHHHHHHHCCCCCCCCHHHHHHCCCCCC--CHHHHHHHHHH
T ss_conf             78976------55877732565532353068966889999999986277787768999975188752--14199999999


Q ss_pred             -----HHHCCCCCCHHHHHHHHHH-----H---HHHHHHHHHHH-------------------------HHCCCCHHHHH
Q ss_conf             -----5420155564679889986-----5---33332114432-------------------------21136578999
Q gi|254780163|r  404 -----VRHFTSRKLPDKAIDVIDE-----A---GASQILQPLSK-------------------------RRKFITEKDIK  445 (798)
Q Consensus       404 -----~ryi~~r~lPdkAidllDe-----a---~a~~~~~~~~~-------------------------~~~~~~~~~i~  445 (798)
                           +|.+..+.-|-...+.-..     +   -+..++.....                         ..-.|.-.|..
T Consensus       408 a~vAikR~ld~~~~p~~~~~~~ed~~~~~~~~d~S~i~~~~~~~~~~~ld~v~~~~i~~~~d~~S~E~~~~L~i~~eDF~  487 (802)
T KOG0733         408 AFVAIKRILDQSSSPLTKVPISEDSSNKDAEEDQSSIKITSNAERPLELDRVVQDAILNNPDPLSKELLEGLSIKFEDFE  487 (802)
T ss_pred             HHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCHHHHHHCCCCCCCCCCHHHHHHHHHHHCCCCCCHHHHCCCEECHHHHH
T ss_conf             99999998621357665687545666777530135540577644654478999999971899868677356610199999


Q ss_pred             HHHHHCC-----CCC-CHHHHHCCHHHHHHHHCCHHHHHHHCHHHHHHHHHHHH--------HHHHCCCCCCCCCCCEEE
Q ss_conf             8663102-----453-10111001123342100002466534589999999998--------775204456578740688
Q gi|254780163|r  446 KTIASMN-----RSI-HTTSFSRDDDSVLSNLEKNLGTVVYGQEEAIKKLSSSI--------KIARAGLSDPNKPIGCYV  511 (798)
Q Consensus       446 ~~~~~~~-----~gi-p~~~~~~~~~~~l~~l~~~l~~~v~GQ~~ai~~v~~~i--------~~~~~gl~~~~rP~g~fl  511 (798)
                      ..+..+.     .|+ -+-.++-++              |=|+++.-..+-.+|        .-.+.|+..   |-| +|
T Consensus       488 ~Al~~iQPSakREGF~tVPdVtW~d--------------IGaL~~vR~eL~~aI~~PiK~pd~~k~lGi~~---PsG-vL  549 (802)
T KOG0733         488 EALSKIQPSAKREGFATVPDVTWDD--------------IGALEEVRLELNMAILAPIKRPDLFKALGIDA---PSG-VL  549 (802)
T ss_pred             HHHHHCCCCHHCCCCEECCCCCHHH--------------CCCHHHHHHHHHHHHHHHCCCHHHHHHHCCCC---CCC-EE
T ss_conf             9998559302036513269987664--------------12499999999999860023888999828889---872-38


Q ss_pred             EECCCCHHHHHHHHHHHHHCCCCEEEEEHHHHHCCCCCCHHCCCCCHHCCCCCCC--CCCHHHHHCCCEEEEECCHHHCC
Q ss_conf             6143200388999998730477337720688612465301104780002564443--10035551585177740445502
Q gi|254780163|r  512 FSGPTGVGKTEISKQLAFALGVQLLRFDMSEYMERHAVSRLIGAPPGYVGFGQGG--ILADSVDQNPYSVVLLDEIEKSH  589 (798)
Q Consensus       512 f~GptGvGKTelak~la~~~~~~lir~dmsey~e~~~vs~LiGappGYvG~~egg--~Lte~vr~~P~sVvl~DEiEKAh  589 (798)
                      ++||+|+|||.|||+.|-..+-+||.+--.|...+            |||-.|--  ++...-|..--|||+||||+---
T Consensus       550 L~GPPGCGKTLlAKAVANEag~NFisVKGPELlNk------------YVGESErAVR~vFqRAR~saPCVIFFDEiDaL~  617 (802)
T KOG0733         550 LCGPPGCGKTLLAKAVANEAGANFISVKGPELLNK------------YVGESERAVRQVFQRARASAPCVIFFDEIDALV  617 (802)
T ss_pred             EECCCCCCHHHHHHHHHHHCCCCEEEECCHHHHHH------------HHHHHHHHHHHHHHHHHCCCCEEEEECCHHHCC
T ss_conf             75799861889999985030475476238899987------------742378999999998623898389851112027


Q ss_pred             -----------HHHHHHHHHHHHHHHCCCCCCCEECCCCEEEEEECCCCHHHHHHCCCCCCCCCCHHHHHHHHHHHCCHH
Q ss_conf             -----------899999999877750217799776125429999424214553303689882111488999998728878
Q gi|254780163|r  590 -----------PDVLNILLQIMDYGILTDQSGKKISFRNVILIMTTNAGALEMSKARIGFGSSRNDDADKEALRNFLSPE  658 (798)
Q Consensus       590 -----------~~v~~~llqild~G~ltd~~Gr~vdf~n~iii~TsN~G~~~~~~~~~g~~~~~~~~~~~~~l~~~f~pe  658 (798)
                                 ..|.|-||-=|| | |.+       =++..||-.+|-       .          +.+.+   ..+|| 
T Consensus       618 p~R~~~~s~~s~RvvNqLLtElD-G-l~~-------R~gV~viaATNR-------P----------DiIDp---AiLRP-  667 (802)
T KOG0733         618 PRRSDEGSSVSSRVVNQLLTELD-G-LEE-------RRGVYVIAATNR-------P----------DIIDP---AILRP-  667 (802)
T ss_pred             CCCCCCCCHHHHHHHHHHHHHHC-C-CCC-------CCCEEEEEECCC-------C----------CCCCH---HHCCC-
T ss_conf             65577775058999999998731-6-211-------142599950689-------7----------65556---55187-


Q ss_pred             HHCCCCEEEECCCCCHHHHHHHHHHHHHHHHHHHHHCCCEEEECHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHHHHHHH
Q ss_conf             81776828962889999999999999999999998669889998899999997189810153267999998623599999
Q gi|254780163|r  659 FLNRLDSIIPFFPLSSDIIRQVVHKFIMKLELQLQEKGISFHFSEEVINWLVSHGYDVKMGARPLERIIKEHVKVPLADE  738 (798)
Q Consensus       659 flnRid~ii~F~~l~~~~~~~i~~~~l~~l~~~l~~~~i~l~~~~~~~~~l~~~~~~~~~GAR~l~r~i~~~i~~~la~~  738 (798)
                        +|+|.+..-..-..++-..|+....+.       .+..|.-+- -++-|+..---..|-.-.|.-.+++--...|-..
T Consensus       668 --GRlDk~LyV~lPn~~eR~~ILK~~tkn-------~k~pl~~dV-dl~eia~~~~c~gftGADLaaLvreAsi~AL~~~  737 (802)
T KOG0733         668 --GRLDKLLYVGLPNAEERVAILKTITKN-------TKPPLSSDV-DLDEIARNTKCEGFTGADLAALVREASILALRES  737 (802)
T ss_pred             --CCCCCEEEECCCCHHHHHHHHHHHHCC-------CCCCCCCCC-CHHHHHHCCCCCCCCHHHHHHHHHHHHHHHHHHH
T ss_conf             --755742450699878899999998535-------799887545-8999851232268753659999999999999999


Q ss_pred             HHCCC
Q ss_conf             96296
Q gi|254780163|r  739 ILFGK  743 (798)
Q Consensus       739 il~~~  743 (798)
                      +....
T Consensus       738 ~~~~~  742 (802)
T KOG0733         738 LFEID  742 (802)
T ss_pred             HHHCC
T ss_conf             86111


No 16 
>KOG0745 consensus
Probab=99.90  E-value=3.2e-22  Score=178.89  Aligned_cols=231  Identities=24%  Similarity=0.468  Sum_probs=168.4

Q ss_pred             EEEEECCCCHHHHHHHHHHHHHCCCCEEEEEHHHHHCCCCCCHHCCCCCHHCCCCCCC----CCCHH---HHHCCCEEEE
Q ss_conf             6886143200388999998730477337720688612465301104780002564443----10035---5515851777
Q gi|254780163|r  509 CYVFSGPTGVGKTEISKQLAFALGVQLLRFDMSEYMERHAVSRLIGAPPGYVGFGQGG----ILADS---VDQNPYSVVL  581 (798)
Q Consensus       509 ~flf~GptGvGKTelak~la~~~~~~lir~dmsey~e~~~vs~LiGappGYvG~~egg----~Lte~---vr~~P~sVvl  581 (798)
                      ..|++||||+|||.||++||.-+..++.--|+...+.           +||||-|-..    +|++|   |.+.--.+|+
T Consensus       228 NvLllGPtGsGKTllaqTLAr~ldVPfaIcDcTtLTQ-----------AGYVGeDVEsvi~KLl~~A~~nVekAQqGIVf  296 (564)
T KOG0745         228 NVLLLGPTGSGKTLLAQTLARVLDVPFAICDCTTLTQ-----------AGYVGEDVESVIQKLLQEAEYNVEKAQQGIVF  296 (564)
T ss_pred             CEEEECCCCCCHHHHHHHHHHHHCCCEEEECCCCHHH-----------CCCCCCCHHHHHHHHHHHCCCCHHHHHCCEEE
T ss_conf             4799778887643899999997088768732552200-----------55345429999999999725789988267388


Q ss_pred             ECCHHHCC---H-----------HHHHHHHHHHHHHHCCC---------CCCC--EECCCCEEEEEE---CCCC---HHH
Q ss_conf             40445502---8-----------99999999877750217---------7997--761254299994---2421---455
Q gi|254780163|r  582 LDEIEKSH---P-----------DVLNILLQIMDYGILTD---------QSGK--KISFRNVILIMT---TNAG---ALE  630 (798)
Q Consensus       582 ~DEiEKAh---~-----------~v~~~llqild~G~ltd---------~~Gr--~vdf~n~iii~T---sN~G---~~~  630 (798)
                      +|||+|-.   +           .|+..||.+++ |++..         ..|.  .||.+|.++|..   +|+-   ++.
T Consensus       297 lDEvDKi~~~~~~i~~~RDVsGEGVQQaLLKllE-GtvVnVpeK~~~~~~rgd~vqiDTtnILFiasGAF~~Ldk~I~rR  375 (564)
T KOG0745         297 LDEVDKITKKAESIHTSRDVSGEGVQQALLKLLE-GTVVNVPEKGSRRKPRGDTVQIDTTNILFIASGAFVGLDKIISRR  375 (564)
T ss_pred             EEHHHHHCCCCCCCCCCCCCCCHHHHHHHHHHHC-CCEECCCCCCCCCCCCCCEEEEECCCEEEEECCCCCCHHHHHHHH
T ss_conf             7601244136765454445662669999999852-627702677877789998589713666888034323569898876


Q ss_pred             HHHCCCCCCCCCCH------------HH---HHH-HHHH---------HCCHHHHCCCCEEEECCCCCHHHHHHHHHHH-
Q ss_conf             33036898821114------------88---999-9987---------2887881776828962889999999999999-
Q gi|254780163|r  631 MSKARIGFGSSRND------------DA---DKE-ALRN---------FLSPEFLNRLDSIIPFFPLSSDIIRQVVHKF-  684 (798)
Q Consensus       631 ~~~~~~g~~~~~~~------------~~---~~~-~l~~---------~f~peflnRid~ii~F~~l~~~~~~~i~~~~-  684 (798)
                      +.+.++||+.....            +.   ..+ .|++         -+=|||++|+.-+|+|++|++.++.+|+.-- 
T Consensus       376 ~~d~slGFg~~s~~~vr~~~~~~s~~~~~~~~~~~lL~~~~~~DLisfGmIPEfVGRfPVlVplh~L~~~~Lv~VLtEPk  455 (564)
T KOG0745         376 LDDKSLGFGAPSSKGVRANMATKSGVENDAEKRDELLEKVESGDLISFGMIPEFVGRFPVLVPLHSLDEDQLVRVLTEPK  455 (564)
T ss_pred             HCCHHCCCCCCCCCCCHHHCCCCCCCCHHHHHHHHHHHHCCCCCHHHHCCCHHHHCCCCEEEECCCCCHHHHHHHHHCCH
T ss_conf             30000156788874200110346673046778899986346321355267287716652576524268888999873554


Q ss_pred             ---HHHHHHHHHHCCCEEEECHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHHHHHHHHHCCCCCCCCEEEEEEEECC
Q ss_conf             ---99999999866988999889999999718981015326799999862359999996296768884899996078
Q gi|254780163|r  685 ---IMKLELQLQEKGISFHFSEEVINWLVSHGYDVKMGARPLERIIKEHVKVPLADEILFGKLKKGGGVVKVSLNPD  758 (798)
Q Consensus       685 ---l~~l~~~l~~~~i~l~~~~~~~~~l~~~~~~~~~GAR~l~r~i~~~i~~~la~~il~~~~~~g~~~~~v~~~~~  758 (798)
                         +.+....+...++.|.|+++|++.+++.......|||.||-++++.+.++.     + . .||..+..|.++.+
T Consensus       456 naL~~Qyk~lf~~~nV~L~fTe~Al~~IAq~Al~r~TGARgLRsIlE~~Lleam-----f-e-vPGSdI~~V~Vdee  525 (564)
T KOG0745         456 NALGKQYKKLFGMDNVELHFTEKALEAIAQLALKRKTGARGLRSILESLLLEAM-----F-E-VPGSDIKAVLVDEE  525 (564)
T ss_pred             HHHHHHHHHHHCCCCEEEEECHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHC-----C-C-CCCCCEEEEEECHH
T ss_conf             668999999855577469866999999999987614346789999999976401-----4-5-78875479996178


No 17 
>PRK10787 DNA-binding ATP-dependent protease La; Provisional
Probab=99.86  E-value=2.2e-19  Score=158.52  Aligned_cols=293  Identities=22%  Similarity=0.355  Sum_probs=211.8

Q ss_pred             CCCCCCHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHCCCCCCHHHHHCCHHHHHHHHCCHHHHHHHCHHHHH
Q ss_conf             01555646798899865333321144322113657899986631024531011100112334210000246653458999
Q gi|254780163|r  407 FTSRKLPDKAIDVIDEAGASQILQPLSKRRKFITEKDIKKTIASMNRSIHTTSFSRDDDSVLSNLEKNLGTVVYGQEEAI  486 (798)
Q Consensus       407 i~~r~lPdkAidllDea~a~~~~~~~~~~~~~~~~~~i~~~~~~~~~gip~~~~~~~~~~~l~~l~~~l~~~v~GQ~~ai  486 (798)
                      |....||+.+-.-++.-     +..++.-...-.+--|......|-..+|-...+.+. .-+...++.|.+--+|-+..-
T Consensus       258 i~~~~~p~~~~~~~~~E-----l~rl~~~~~~s~E~~v~r~YLd~l~~LPW~~~t~d~-~dl~~A~~iLd~dHyGL~~vK  331 (784)
T PRK10787        258 IDAAKMPKEAKEKAEAE-----LQKLKMMSPMSAEATVVRGYIDWMVQVPWNARSKVK-KDLRQAQEILDTDHYGLERVK  331 (784)
T ss_pred             HHHCCCCHHHHHHHHHH-----HHHHHHCCCCCCHHHHHHHHHHHHHCCCCCCCCCCC-CCHHHHHHHHHHHHCCHHHHH
T ss_conf             98779998999999999-----999971899894188999999999759988887875-699999998765430657799


Q ss_pred             HHHHHHHHHHHCCCCCCCCCCCEEEEECCCCHHHHHHHHHHHHHCCCCEEEEEHHHHHCCCCCCHHCCCCCHHCCCCCCC
Q ss_conf             99999987752044565787406886143200388999998730477337720688612465301104780002564443
Q gi|254780163|r  487 KKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFALGVQLLRFDMSEYMERHAVSRLIGAPPGYVGFGQGG  566 (798)
Q Consensus       487 ~~v~~~i~~~~~gl~~~~rP~g~flf~GptGvGKTelak~la~~~~~~lir~dmsey~e~~~vs~LiGappGYvG~~egg  566 (798)
                      +.|.+.+-..+.. .+..-||  ++|+||+|||||-+||..|..++..++|+-+.--.+   -+-+-|----|||.- .|
T Consensus       332 eRile~lAv~~~~-~~~kg~I--lclvGpPGvGKTSl~~sIA~al~r~f~rislGGv~D---eaeirGHrrTYvgam-pG  404 (784)
T PRK10787        332 DRILEYLAVQSRV-NKIKGPI--LCLVGPPGVGKTSLGQSIAKATGRKYVRMALGGVRD---EAEIRGHRRTYIGSM-PG  404 (784)
T ss_pred             HHHHHHHHHHHHC-CCCCCCE--EEEECCCCCCHHHHHHHHHHHHCCCEEEEECCCCCC---HHHHCCCCCCCCCCC-CH
T ss_conf             9999999999862-4677877--996469987724699999998589869980688788---888256433434436-83


Q ss_pred             CCCHHHHH--CCCEEEEECCHHHCCH----HHHHHHHHHHHH---HHCCCCC-CCEECCCCEEEEEECCCCHHHHHHCCC
Q ss_conf             10035551--5851777404455028----999999998777---5021779-977612542999942421455330368
Q gi|254780163|r  567 ILADSVDQ--NPYSVVLLDEIEKSHP----DVLNILLQIMDY---GILTDQS-GKKISFRNVILIMTTNAGALEMSKARI  636 (798)
Q Consensus       567 ~Lte~vr~--~P~sVvl~DEiEKAh~----~v~~~llqild~---G~ltd~~-Gr~vdf~n~iii~TsN~G~~~~~~~~~  636 (798)
                      ....++++  ..+.|+|||||+|-..    |-...||.|||-   -..+|.. +--.|++++++|.|.|-          
T Consensus       405 rii~~l~~a~~~nPv~llDEiDK~~~~~~Gdp~salLEvLDpeQN~~F~Dhyl~~~~DlS~v~Fi~TaN~----------  474 (784)
T PRK10787        405 KLIQKMAKVGVKNPLFLLDEIDKMSSDMRGDPASALLEVLDPEQNVAFSDHYLEVDYDLSDVMFVATSNS----------  474 (784)
T ss_pred             HHHHHHHHHCCCCCEEEEHHHHHHCCCCCCCHHHHHHHHCCHHHCCCCCCCEEECCCCHHHEEEEEECCC----------
T ss_conf             8999999748988566500355522455899889999845976556400032204645222589973276----------


Q ss_pred             CCCCCCCHHHHHHHHHHHCCHHHHCCCCEEEECCCCCHHHHHHHHHHHHHHHHHHHHHCCC---EEEECHHHHHHHHHCC
Q ss_conf             9882111488999998728878817768289628899999999999999999999986698---8999889999999718
Q gi|254780163|r  637 GFGSSRNDDADKEALRNFLSPEFLNRLDSIIPFFPLSSDIIRQVVHKFIMKLELQLQEKGI---SFHFSEEVINWLVSHG  713 (798)
Q Consensus       637 g~~~~~~~~~~~~~l~~~f~peflnRid~ii~F~~l~~~~~~~i~~~~l~~l~~~l~~~~i---~l~~~~~~~~~l~~~~  713 (798)
                                    + . .++.++.|+ +||-+...+.++-..|+..+|  +-+++.+.|+   ++.++++++.+|.+ .
T Consensus       475 --------------~-~-ip~pLlDRm-E~i~~~gYt~~eK~~Ia~~~l--~p~~~~~~gl~~~~~~~~~~~~~~ii~-~  534 (784)
T PRK10787        475 --------------M-N-IPAPLLDRM-EVIRLSGYTEDEKLNIAKRHL--LPKQIERNALKKGELTVDDSAIIGIIR-Y  534 (784)
T ss_pred             --------------C-C-CCHHHHHHE-EEEEECCCCHHHHHHHHHHHC--HHHHHHHHCCCCCCCCCCHHHHHHHHH-H
T ss_conf             --------------7-7-876776312-155411676788999999745--399999828996567439999999875-3


Q ss_pred             CCCCCCCHHHHHHHHHHHHHHHHHHHHCCC
Q ss_conf             981015326799999862359999996296
Q gi|254780163|r  714 YDVKMGARPLERIIKEHVKVPLADEILFGK  743 (798)
Q Consensus       714 ~~~~~GAR~l~r~i~~~i~~~la~~il~~~  743 (798)
                      |..+.|-|.|+|.|.+-.-. .+..++.++
T Consensus       535 ytrEaGvR~ler~i~~i~rk-~~~~~~~~~  563 (784)
T PRK10787        535 YTREAGVRSLEREISKLCRK-AVKQLLLDK  563 (784)
T ss_pred             CCCCCCCCCHHHHHHHHHHH-HHHHHHCCC
T ss_conf             36544425168899999999-999997078


No 18 
>TIGR00763 lon ATP-dependent protease La; InterPro: IPR004815   Proteolytic enzymes that exploit serine in their catalytic activity are ubiquitous, being found in viruses, bacteria and eukaryotes . They include a wide range of peptidase activity, including exopeptidase, endopeptidase, oligopeptidase and omega-peptidase activity. Over 20 families (denoted S1 - S66) of serine protease have been identified, these being grouped into clans on the basis of structural similarity and other functional evidence . Structures are known for members of the clans and the structures indicate that some appear to be totally unrelated, suggesting different evolutionary origins for the serine peptidases .   Not withstanding their different evolutionary origins, there are similarities in the reaction mechanisms of several peptidases. Chymotrypsin, subtilisin and carboxypeptidase C have a catalytic triad of serine, aspartate and histidine in common: serine acts as a nucleophile, aspartate as an electrophile, and histidine as a base . The geometric orientations of the catalytic residues are similar between families, despite different protein folds . The linear arrangements of the catalytic residues commonly reflect clan relationships. For example the catalytic triad in the chymotrypsin clan (PA) is ordered HDS, but is ordered DHS in the subtilisin clan (SB) and SDH in the carboxypeptidase clan (SC) , .   Peptidases are grouped into clans and families. Clans are groups of families for which there is evidence of common ancestry. Each clan is identified with two letters, the first representing the catalytic type of the families included in the clan (with the letter 'P' being used for a clan containing families of more than one of the catalytic types serine, threonine and cysteine). Some families cannot yet be assigned to clans, and when a formal assignment is required, such a family is described as belonging to clan A-, C-, M-, S-, T- or U-, according to the catalytic type. Some clans are divided into subclans because there is evidence of a very ancient divergence within the clan, for example MA(E), the gluzincins, and MA(M), the metzincins.   Families are grouped by their catalytic type, the first character representing the catalytic type: A, aspartic; C, cysteine; G, glutamic acid; M, metallo; S, serine; T, threonine; and U, unknown. The serine, threonine and cysteine peptidases utilise the amino acid as a nucleophile and form an acyl intermediate - these peptidases can also readily act as transferases. In the case of aspartic, glutamic and metallopeptidases, the nucleophile is an activated water molecule.    This signature defines the bacterial and eukaryotic lon proteases, which are ATP-dependent serine peptidases belonging to the MEROPS peptidase family S16 (lon protease family, clan SF). This family of sequences does not include the archaeal lon homologs, IPR004663 from INTERPRO. In the eukaryotes the majority of the proteins are located in the mitochondrial matrix , . In yeast, Pim1, is located in the mitochondrial matrix, is required for mitochondrial function, is constitutively expressed but is increased after thermal stress, suggesting that Pim1 may play a role in the heat shock response .; GO: 0004176 ATP-dependent peptidase activity, 0005524 ATP binding, 0006510 ATP-dependent proteolysis.
Probab=99.86  E-value=1.4e-20  Score=166.99  Aligned_cols=315  Identities=22%  Similarity=0.353  Sum_probs=229.8

Q ss_pred             HCCCEECCHHHHHH-HHHHHHHCCCC-CCHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHCCCCCCHHHHHCC
Q ss_conf             10351211178999-99865420155-56467988998653333211443221136578999866310245310111001
Q gi|254780163|r  386 HHQLRYSKEAIRAA-VQLSVRHFTSR-KLPDKAIDVIDEAGASQILQPLSKRRKFITEKDIKKTIASMNRSIHTTSFSRD  463 (798)
Q Consensus       386 ~h~v~~~~~al~~a-v~ls~ryi~~r-~lPdkAidllDea~a~~~~~~~~~~~~~~~~~~i~~~~~~~~~gip~~~~~~~  463 (798)
                      ||-.=..++.=... -.|-.|.=... ++|+-+...+++     -+..++.-...=.+-.|......|-+.+|-.+.+.+
T Consensus       322 yhELG~~~d~~~~~~~~~~~kle~~~e~~P~~~~k~~~~-----El~kL~~l~~~SsE~~v~RnYLDwl~~lPW~~~S~~  396 (941)
T TIGR00763       322 YHELGIEKDDKDELIEKLKEKLEELKEFLPEEVKKVIEK-----ELTKLELLEPSSSEFTVTRNYLDWLTDLPWGKYSKE  396 (941)
T ss_pred             HHHCCCCCCCHHHHHHHHHHHHHHCCCCCCHHHHHHHHH-----HHHHHHCCCCCCCCHHHHHHHHHHHHHCCCCCCCCH
T ss_conf             752589998647899999999874057477468999999-----998750588335304679999999983772214702


Q ss_pred             -HHHHHHHHCCHHHHHHHCHHHHHHHHHHHHHHH---------HCCCC-CCCCC-CCEEEEECCCCHHHHHHHHHHHHHC
Q ss_conf             -123342100002466534589999999998775---------20445-65787-4068861432003889999987304
Q gi|254780163|r  464 -DDSVLSNLEKNLGTVVYGQEEAIKKLSSSIKIA---------RAGLS-DPNKP-IGCYVFSGPTGVGKTEISKQLAFAL  531 (798)
Q Consensus       464 -~~~~l~~l~~~l~~~v~GQ~~ai~~v~~~i~~~---------~~gl~-~~~rP-~g~flf~GptGvGKTelak~la~~~  531 (798)
                       ++-.|.+..+.|-+-=+|=+.--+.|.+.|-..         +--|. +-.-| |  ++|+||+|||||=||+..|..+
T Consensus       397 f~n~Dl~~A~~~LD~DHYGL~~VK~RIlEYlAV~qllemrrkkkPkL~~~~~GpqI--lClvGPPGVGKTSlg~SIA~AL  474 (941)
T TIGR00763       397 FDNLDLKRAKEILDEDHYGLKKVKERILEYLAVQQLLEMRRKKKPKLRGKMKGPQI--LCLVGPPGVGKTSLGKSIAKAL  474 (941)
T ss_pred             HHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCEE--EEEECCCCCCHHHHHHHHHHHH
T ss_conf             66521899999831678888773034135888989998764036444778888767--8720726954222789999996


Q ss_pred             CCCEEEEEHHHHHCCCCCCHHCCCCCHHCCCCCCCCCCHHHHH--CCCEEEEECCHHHCC--HH----HHHHHHHHHH--
Q ss_conf             7733772068861246530110478000256444310035551--585177740445502--89----9999999877--
Q gi|254780163|r  532 GVQLLRFDMSEYMERHAVSRLIGAPPGYVGFGQGGILADSVDQ--NPYSVVLLDEIEKSH--PD----VLNILLQIMD--  601 (798)
Q Consensus       532 ~~~lir~dmsey~e~~~vs~LiGappGYvG~~egg~Lte~vr~--~P~sVvl~DEiEKAh--~~----v~~~llqild--  601 (798)
                      +..|+||=..=-.   .+|-.-|====|||. =.|.+..++++  .-+=|+|+|||+|-.  .+    =...||-|||  
T Consensus       475 nRkFvR~SlGG~~---DeAEIrGHRRTYvGA-MPGriiQ~lk~~~t~NPl~LlDEIDK~~~~~~~~GDPaSALLEvLDPE  550 (941)
T TIGR00763       475 NRKFVRFSLGGVR---DEAEIRGHRRTYVGA-MPGRIIQGLKKAKTKNPLILLDEIDKIGLKSSFRGDPASALLEVLDPE  550 (941)
T ss_pred             CCEEEEEEECCCE---EHHHCCCCCCCCCCC-CHHHHHHHHHHCCCCCCEEEEEEEEEECCCCCCCCCHHHHHHHHCCHH
T ss_conf             8804999526722---031127864320346-725789998760415880686202200167886556378886412864


Q ss_pred             -HHHCCCCC-CCEECCCCEE--EEEECCCCHHHHHHCCCCCCCCCCHHHHHHHHHHHCCHHHHCCCCEEEECCCCCHHHH
Q ss_conf             -75021779-9776125429--9994242145533036898821114889999987288788177682896288999999
Q gi|254780163|r  602 -YGILTDQS-GKKISFRNVI--LIMTTNAGALEMSKARIGFGSSRNDDADKEALRNFLSPEFLNRLDSIIPFFPLSSDII  677 (798)
Q Consensus       602 -~G~ltd~~-Gr~vdf~n~i--ii~TsN~G~~~~~~~~~g~~~~~~~~~~~~~l~~~f~peflnRid~ii~F~~l~~~~~  677 (798)
                       +-...|.. +-.+|.|+++  +|+|+|-    +                     ..=++.+|+|+ +||-.--.+.++-
T Consensus       551 QN~~F~DHYldvp~DLS~V~CyFi~TAN~----~---------------------d~IP~PLLDRM-EvI~lsGY~~~EK  604 (941)
T TIGR00763       551 QNNAFSDHYLDVPFDLSKVLCYFIATANS----I---------------------DTIPRPLLDRM-EVIELSGYTEEEK  604 (941)
T ss_pred             HCCCCCCCCCCCCCCHHHHHHHEEECCCC----C---------------------CCCCCCCCCCE-EEEECCCCCHHHH
T ss_conf             36042553002340042002100024475----7---------------------67772213740-2452388876789


Q ss_pred             HHHHHHHHHHHHHHHHHC---CCEEEECHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHHHHHHHHHC
Q ss_conf             999999999999999866---9889998899999997189810153267999998623599999962
Q gi|254780163|r  678 RQVVHKFIMKLELQLQEK---GISFHFSEEVINWLVSHGYDVKMGARPLERIIKEHVKVPLADEILF  741 (798)
Q Consensus       678 ~~i~~~~l~~l~~~l~~~---~i~l~~~~~~~~~l~~~~~~~~~GAR~l~r~i~~~i~~~la~~il~  741 (798)
                      ..|++.+|=-  +.+...   .=+|.++|+++..|++ .|.++.|-|+|+|-|++-+ ...|-.++.
T Consensus       605 ~~IA~~yLiP--~~~~~~GL~~~~l~~~d~al~~lI~-~YtREaGVRNL~r~I~~i~-RK~A~~~~~  667 (941)
T TIGR00763       605 LEIAKKYLIP--KALEDHGLKPDELKISDEALLLLIK-YYTREAGVRNLERQIEKIC-RKAAVKLVE  667 (941)
T ss_pred             HHHHHHCCHH--HHHHHHCCCCCCEEECHHHHHHHHH-HHHHHHCCHHHHHHHHHHH-HHHHHHHHH
T ss_conf             9999854713--6798708881322126899999998-7513202133899999999-999999987


No 19 
>TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily; InterPro: IPR005938    The ATPase Cdc48 is required for membrane fusion and protein degradation. It possesses chaperone-like activities and can functionally interact with Hsc70. Yeast CDC48 plays a role in cell division control whereas eukaryotic homologues are involved in the budding and transfer of membrane from the transitional endoplasmic reticulum to the Golgi apparatus.; GO: 0016787 hydrolase activity.
Probab=99.85  E-value=5.1e-18  Score=148.63  Aligned_cols=388  Identities=24%  Similarity=0.394  Sum_probs=224.9

Q ss_pred             CEEEECCCCCHHHHHHHHHHHHHHCCCCCHHHHEEEEEEEEHHHHHCCCCCCCHHHHHHHHHHHHHCCCCCEEEEECCHH
Q ss_conf             74896676411668999999998548988345201445540467530634312378999999987203898399973616
Q gi|254780163|r  227 NPLYVGDPGVGKTAIAEGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIESYANAILYIDEIH  306 (798)
Q Consensus       227 n~~lvG~~gvGktaive~la~~i~~~~vp~~l~~~~i~~ld~~~l~ag~~~rg~fe~r~~~~~~~~~~~~~~ilfideih  306 (798)
                      ..+|+|+||.|||-++..+|..+          +..++.++...+  -+||.||-|+||+.+++|++.+.+.|+|||||.
T Consensus       242 G~ll~GPPGtGktllaka~ane~----------~a~f~~inGPei--msky~Ge~e~~lr~if~eaeenaP~iifideid  309 (980)
T TIGR01243       242 GVLLYGPPGTGKTLLAKAVANEA----------GAYFIAINGPEI--MSKYYGESEERLREIFKEAEENAPSIIFIDEID  309 (980)
T ss_pred             CEEEECCCCCCHHHHHHHHHHHC----------CCEEEEECCCHH--HHHHCCCCHHHHHHHHHHHHHCCCCEEEEECHH
T ss_conf             35875589861789999987530----------551788506034--433136307899999986530587078741211


Q ss_pred             HHHCCCCCCCCCCC-----HHHHH---HHHHCCCCEEEEEECCHHHHHHHHHCCHHHHH--HCEE-EEECCCCHHHHHHH
Q ss_conf             63015544434477-----78888---76630266038873048999998520111432--0014-43068786899999
Q gi|254780163|r  307 TLVGAGSASGISVD-----ASNLL---KPALSSGAVRCIGSTTYSEYRQFFEKDKALVR--RFQK-IDVSEPSIEDAIEI  375 (798)
Q Consensus       307 ~ligag~~~g~~~d-----~an~l---kP~L~rg~~~~IgatT~~ey~~~~e~d~al~r--rF~~-i~v~ep~~~~~~~i  375 (798)
                      .|-  .+.+.....     ++.+|   -..-.||.+-+||||.-..     .-||||.|  ||.. |.|..|+...-.+|
T Consensus       310 aia--Pkr~e~~Geve~r~v~qlltlmdGlk~rG~v~viGatnrP~-----a~dPalrrPGrfdrei~~~~Pd~~~r~ei  382 (980)
T TIGR01243       310 AIA--PKREEVTGEVEKRVVAQLLTLMDGLKGRGKVIVIGATNRPD-----ALDPALRRPGRFDREIEIGVPDKEGRKEI  382 (980)
T ss_pred             HCC--CCCCCHHHHHHHHHHHHHHHHHHHHCCCCEEEEEECCCCCC-----CCCHHHCCCCCCCCEEEECCCCHHHHHHH
T ss_conf             007--64100001688999999999974002487289981468850-----02622427886443357418854567888


Q ss_pred             HHHHHHHHHHHCCCEECCHHH-HHHHHHHHHHCCCCCC-HHHHHHHHHHH---HHHHHHHHHHHHHC-------------
Q ss_conf             986127665410351211178-9999986542015556-46798899865---33332114432211-------------
Q gi|254780163|r  376 VKGIKPYFEEHHQLRYSKEAI-RAAVQLSVRHFTSRKL-PDKAIDVIDEA---GASQILQPLSKRRK-------------  437 (798)
Q Consensus       376 L~~~~~~ye~~h~v~~~~~al-~~av~ls~ryi~~r~l-PdkAidllDea---~a~~~~~~~~~~~~-------------  437 (798)
                      |+--..      +..+..+.= .+.+......-.+..+ -.|.-.+++..   .+...+...-+...             
T Consensus       383 l~~htr------~mP~~~d~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  456 (980)
T TIGR01243       383 LQIHTR------NMPLAEDVDKDAVIKVLKDLEKDERFEKEKIEKIIEKVSKANSEDEIKEILKEDGNVYVEVRNRLIDK  456 (980)
T ss_pred             HHHHHC------CCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHH
T ss_conf             876414------78750110057899999876665566788999999988631026789999750121246789999999


Q ss_pred             ----------CCCHHHHHHHH-----HHC------------CCCCCHHHH-----HCCH-------------HHHHHHHC
Q ss_conf             ----------36578999866-----310------------245310111-----0011-------------23342100
Q gi|254780163|r  438 ----------FITEKDIKKTI-----ASM------------NRSIHTTSF-----SRDD-------------DSVLSNLE  472 (798)
Q Consensus       438 ----------~~~~~~i~~~~-----~~~------------~~gip~~~~-----~~~~-------------~~~l~~l~  472 (798)
                                -....|++...     ..+            ...||...+     +..+             ++.+....
T Consensus       457 ~l~~la~~thG~~Gadlaal~~eaam~~lrr~~~eg~i~~ea~~iP~~vl~~lkvt~~df~ealk~~~P~~~re~~~evP  536 (980)
T TIGR01243       457 LLDKLAEVTHGFVGADLAALAKEAAMAALRRLIREGKINLEAEEIPKEVLEELKVTMKDFKEALKMVEPSALREVLVEVP  536 (980)
T ss_pred             HHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHEEEEECC
T ss_conf             99988654236203559999899999999987402774502677579999873222899999985106234110002337


Q ss_pred             CHHHHHHHCHHHHHHHHHHHHHH--------HHCCCCCCCCCCCEEEEECCCCHHHHHHHHHHHHHCCCCEEEEEHHHHH
Q ss_conf             00246653458999999999877--------5204456578740688614320038899999873047733772068861
Q gi|254780163|r  473 KNLGTVVYGQEEAIKKLSSSIKI--------ARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFALGVQLLRFDMSEYM  544 (798)
Q Consensus       473 ~~l~~~v~GQ~~ai~~v~~~i~~--------~~~gl~~~~rP~g~flf~GptGvGKTelak~la~~~~~~lir~dmsey~  544 (798)
                      .---.-+=|-+++-..+-+++.+        .+.|+.+|   -|++|| ||+|+|||-|||++|..++-++|.+--.|- 
T Consensus       537 ~v~W~diGGlee~kq~lreaveWPlk~~~~f~k~G~~PP---~Gvll~-GPPGtGktllakava~es~anfi~v~GPe~-  611 (980)
T TIGR01243       537 NVKWEDIGGLEEVKQELREAVEWPLKAPEVFEKLGIRPP---KGVLLF-GPPGTGKTLLAKAVATESGANFIAVRGPEI-  611 (980)
T ss_pred             CCCCCCCCCHHHHHHHHHHHHHCCCCHHHHHHHCCCCCC---CCEEEE-CCCCCCHHHHHHHHHHCCCCCEEEECCCHH-
T ss_conf             511001466789999998775234440589986078899---734874-689861688888774014564677407312-


Q ss_pred             CCCCCCHHCCCCCHHCCCCCC--CCCCHHHHHCCCEEEEECCHHHCCH-------------HHHHHHHHHHHHHHCCCCC
Q ss_conf             246530110478000256444--3100355515851777404455028-------------9999999987775021779
Q gi|254780163|r  545 ERHAVSRLIGAPPGYVGFGQG--GILADSVDQNPYSVVLLDEIEKSHP-------------DVLNILLQIMDYGILTDQS  609 (798)
Q Consensus       545 e~~~vs~LiGappGYvG~~eg--g~Lte~vr~~P~sVvl~DEiEKAh~-------------~v~~~llqild~G~ltd~~  609 (798)
                          .|+-+|       -.|-  -.+.++-|+.--+||+||||+--.|             .|.|-||.=||        
T Consensus       612 ----lskWvG-------ese~~ir~if~~arq~aP~~~f~deidaiaP~rG~~~~~~~vtd~~~nqll~e~d--------  672 (980)
T TIGR01243       612 ----LSKWVG-------ESEKAIREIFRKARQAAPAIIFFDEIDAIAPARGASLDEKGVTDRIVNQLLTELD--------  672 (980)
T ss_pred             ----HHHHHC-------HHHHHHHHHHHHHHHCCCEEEEEECHHHHCCCCCCCCCCCCHHHHHHHHHHHHHH--------
T ss_conf             ----234403-------2479999999986412873787302111054124421001026899999998640--------


Q ss_pred             CCEECCCCEEEEEECCCCHHHHHHCCCCCCCCCCHHHHHHHHHHHCCHHHHCCCCEEEECCCCCHHHHHHHHHHHHHH
Q ss_conf             977612542999942421455330368988211148899999872887881776828962889999999999999999
Q gi|254780163|r  610 GKKISFRNVILIMTTNAGALEMSKARIGFGSSRNDDADKEALRNFLSPEFLNRLDSIIPFFPLSSDIIRQVVHKFIMK  687 (798)
Q Consensus       610 Gr~vdf~n~iii~TsN~G~~~~~~~~~g~~~~~~~~~~~~~l~~~f~peflnRid~ii~F~~l~~~~~~~i~~~~l~~  687 (798)
                      | ....++.++|-.+|--                 +...+   ..++|   +|+|.+|..-+-+.+.-..|...+-+.
T Consensus       673 G-~~~~~~vvvi~atnrP-----------------di~dP---allrP---Gr~dr~i~vP~Pd~~ar~~ifk~ht~~  726 (980)
T TIGR01243       673 G-LEELSDVVVIAATNRP-----------------DILDP---ALLRP---GRLDRLILVPAPDEEARLEIFKIHTRS  726 (980)
T ss_pred             C-CCCCCCEEEEEECCCC-----------------CCCCC---CCCCC---CCCCEEEEECCCCHHHHHHHHHHHHCC
T ss_conf             4-4343665898615887-----------------42361---00488---741216860598556767676553111


No 20 
>COG0466 Lon ATP-dependent Lon protease, bacterial type [Posttranslational modification, protein turnover, chaperones]
Probab=99.80  E-value=1.5e-17  Score=145.26  Aligned_cols=292  Identities=25%  Similarity=0.376  Sum_probs=204.8

Q ss_pred             CCCCCCHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHCCCCCCHHHHHCCHHHHHHHHCCHHHHHHHCHHHHH
Q ss_conf             01555646798899865333321144322113657899986631024531011100112334210000246653458999
Q gi|254780163|r  407 FTSRKLPDKAIDVIDEAGASQILQPLSKRRKFITEKDIKKTIASMNRSIHTTSFSRDDDSVLSNLEKNLGTVVYGQEEAI  486 (798)
Q Consensus       407 i~~r~lPdkAidllDea~a~~~~~~~~~~~~~~~~~~i~~~~~~~~~gip~~~~~~~~~~~l~~l~~~l~~~v~GQ~~ai  486 (798)
                      |....||+-|-+..+.     .++.++.-...-.+.-|......|...+|-.+-+.+ ..-|...++.|.+.-+|=++.-
T Consensus       259 ie~~~~p~evkek~~~-----El~kL~~m~~~SaE~~ViRnYlDwll~lPW~~~sk~-~~Dl~~a~~iLd~dHYGLekVK  332 (782)
T COG0466         259 IEKLKLPKEAKEKAEK-----ELKKLETMSPMSAEATVIRNYLDWLLDLPWGKRSKD-KLDLKKAEKILDKDHYGLEKVK  332 (782)
T ss_pred             HHHCCCCHHHHHHHHH-----HHHHHHCCCCCCCHHHHHHHHHHHHHHCCCCCCCCH-HHHHHHHHHHHCCCCCCCHHHH
T ss_conf             7516999899999999-----999985079999168899899999982887655421-3229999987443556711689


Q ss_pred             HHHHHHHHHHHCCCCCCCCCCCEEEEECCCCHHHHHHHHHHHHHCCCCEEEEEHHHHHCCCCC----CHHCCCCCHHCCC
Q ss_conf             999999877520445657874068861432003889999987304773377206886124653----0110478000256
Q gi|254780163|r  487 KKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFALGVQLLRFDMSEYMERHAV----SRLIGAPPGYVGF  562 (798)
Q Consensus       487 ~~v~~~i~~~~~gl~~~~rP~g~flf~GptGvGKTelak~la~~~~~~lir~dmsey~e~~~v----s~LiGappGYvG~  562 (798)
                      +.|.+.+-..+. .+.-.-||  ++|+||+|||||-|+|..|..++..++||-..--.+...+    -.-|||=||    
T Consensus       333 eRIlEyLAV~~l-~~~~kGpI--LcLVGPPGVGKTSLgkSIA~al~RkfvR~sLGGvrDEAEIRGHRRTYIGaMPG----  405 (782)
T COG0466         333 ERILEYLAVQKL-TKKLKGPI--LCLVGPPGVGKTSLGKSIAKALGRKFVRISLGGVRDEAEIRGHRRTYIGAMPG----  405 (782)
T ss_pred             HHHHHHHHHHHH-HCCCCCCE--EEEECCCCCCCHHHHHHHHHHHCCCEEEEECCCCCCHHHHCCCCCCCCCCCCH----
T ss_conf             999999999986-14678857--99978998870118999999958977999547654277753553123356872----


Q ss_pred             CCCCCCCHHHHH--CCCEEEEECCHHHCCHH----HHHHHHHHHHH---HHCCCCC-CCEECCCCEEEEEECCCCHHHHH
Q ss_conf             444310035551--58517774044550289----99999998777---5021779-97761254299994242145533
Q gi|254780163|r  563 GQGGILADSVDQ--NPYSVVLLDEIEKSHPD----VLNILLQIMDY---GILTDQS-GKKISFRNVILIMTTNAGALEMS  632 (798)
Q Consensus       563 ~egg~Lte~vr~--~P~sVvl~DEiEKAh~~----v~~~llqild~---G~ltd~~-Gr~vdf~n~iii~TsN~G~~~~~  632 (798)
                          .+..++++  .-+-|+|+|||+|-..+    =-..||.|||-   -...|.. .-..|.++.++|.|+|-=     
T Consensus       406 ----rIiQ~mkka~~~NPv~LLDEIDKm~ss~rGDPaSALLEVLDPEQN~~F~DhYLev~yDLS~VmFiaTANsl-----  476 (782)
T COG0466         406 ----KIIQGMKKAGVKNPVFLLDEIDKMGSSFRGDPASALLEVLDPEQNNTFSDHYLEVPYDLSKVMFIATANSL-----  476 (782)
T ss_pred             ----HHHHHHHHHCCCCCEEEEECHHHCCCCCCCCHHHHHHHHCCHHHCCCHHHCCCCCCCCHHHEEEEEECCCC-----
T ss_conf             ----89999998677687478640333167777886888886269765676122201676644325888603751-----


Q ss_pred             HCCCCCCCCCCHHHHHHHHHHHCCHHHHCCCCEEEECCCCCHHHHHHHHHHHHHHHHHHHHHCC---CEEEECHHHHHHH
Q ss_conf             0368988211148899999872887881776828962889999999999999999999998669---8899988999999
Q gi|254780163|r  633 KARIGFGSSRNDDADKEALRNFLSPEFLNRLDSIIPFFPLSSDIIRQVVHKFIMKLELQLQEKG---ISFHFSEEVINWL  709 (798)
Q Consensus       633 ~~~~g~~~~~~~~~~~~~l~~~f~peflnRid~ii~F~~l~~~~~~~i~~~~l~~l~~~l~~~~---i~l~~~~~~~~~l  709 (798)
                                          ..-+..++.|+ +||-+...+.++-..|+..+|  +-+.+.+.|   -.+.++|+++.+|
T Consensus       477 --------------------~tIP~PLlDRM-EiI~lsgYt~~EKl~IAk~~L--iPk~~~~~gL~~~el~i~d~ai~~i  533 (782)
T COG0466         477 --------------------DTIPAPLLDRM-EVIRLSGYTEDEKLEIAKRHL--IPKQLKEHGLKKGELTITDEAIKDI  533 (782)
T ss_pred             --------------------CCCCHHHHCCE-EEEEECCCCHHHHHHHHHHHC--CHHHHHHCCCCCCCEEECHHHHHHH
T ss_conf             --------------------32986784303-056426888699999999844--5689997599823355658999999


Q ss_pred             HHCCCCCCCCCHHHHHHHHHHHHHHHHHHHHCCCCC
Q ss_conf             971898101532679999986235999999629676
Q gi|254780163|r  710 VSHGYDVKMGARPLERIIKEHVKVPLADEILFGKLK  745 (798)
Q Consensus       710 ~~~~~~~~~GAR~l~r~i~~~i~~~la~~il~~~~~  745 (798)
                      .+ .|..+.|-|.|+|.|.+.. ...+..++.++.+
T Consensus       534 I~-~YTREAGVR~LeR~i~ki~-RK~~~~i~~~~~k  567 (782)
T COG0466         534 IR-YYTREAGVRNLEREIAKIC-RKAAKKILLKKEK  567 (782)
T ss_pred             HH-HHHHHHHHHHHHHHHHHHH-HHHHHHHHHCCCC
T ss_conf             99-8767621038999999999-9999999725756


No 21 
>COG0464 SpoVK ATPases of the AAA+ class [Posttranslational modification, protein turnover, chaperones]
Probab=99.77  E-value=2.8e-16  Score=136.10  Aligned_cols=429  Identities=22%  Similarity=0.289  Sum_probs=230.1

Q ss_pred             HHHHHCCCCCCEEEECCCCCHHHHHHHHHHHHHHCCCCCHHHHEEEEEEEEHHHHHCCCCCCCHHHHHHHHHHHHHCCCC
Q ss_conf             99862267787489667641166899999999854898834520144554046753063431237899999998720389
Q gi|254780163|r  217 IQILCRRSKNNPLYVGDPGVGKTAIAEGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIESYA  296 (798)
Q Consensus       217 iqIL~RR~KNn~~lvG~~gvGktaive~la~~i~~~~vp~~l~~~~i~~ld~~~l~ag~~~rg~fe~r~~~~~~~~~~~~  296 (798)
                      .+.+....-..+++-|+||.|||.++.++|..   +..+        +.++...  -.++|.|+-|.++..++.+++...
T Consensus        10 ~~~~~~~~~~~v~~~g~~~~~~t~~~~~~a~~---~~~~--------~~~~~~~--~~~~~~~~~~~~~~~~~~~a~~~~   76 (494)
T COG0464          10 FKKLGIEPPKGVLLHGPPGTGKTLLARALANE---GAEF--------LSINGPE--ILSKYVGESELRLRELFEEAEKLA   76 (494)
T ss_pred             HHHHCCCCCCCCCCCCCCCCCHHHHHHHHHHC---CCCC--------CCCCCCH--HHHHHCCHHHHHHHHHHHHHHHCC
T ss_conf             98706676421000368876503665676512---5410--------1356522--432220510899999989998639


Q ss_pred             CEEEEECCHHHHHCCCCCCCCCCC---HHHH--HHHHHCCCCEEEEEECCHHHHHHHHHCCHHHHH--HCEE-EEECCCC
Q ss_conf             839997361663015544434477---7888--876630266038873048999998520111432--0014-4306878
Q gi|254780163|r  297 NAILYIDEIHTLVGAGSASGISVD---ASNL--LKPALSSGAVRCIGSTTYSEYRQFFEKDKALVR--RFQK-IDVSEPS  368 (798)
Q Consensus       297 ~~ilfideih~ligag~~~g~~~d---~an~--lkP~L~rg~~~~IgatT~~ey~~~~e~d~al~r--rF~~-i~v~ep~  368 (798)
                      ..|+|+|+++.+.+.-.+..+...   ++.+  +...+.++.+-++|+|     .....-|+|+.|  ||.. +.+.-|.
T Consensus        77 ~~ii~~d~~~~~~~~~~~~~~~~~~~v~~~l~~~~d~~~~~~v~~~~~~-----~~~~~~~~a~~~~~~~~~~~~~~~~~  151 (494)
T COG0464          77 PSIIFIDEIDALAPKRSSDQGEVERRVVAQLLALMDGLKRGQVIVIGAT-----NRPDGLDPAKRRPGRFDREIEVNLPD  151 (494)
T ss_pred             CCEEEECCCCCCCCCCCCCCCHHHHHHHHHHHHHHHCCCCCCEEEEECC-----CCCCCHHHHHHCCHHHHHHHHHCCCC
T ss_conf             7636404433212344444210457899989987642465634674134-----45321127775313767887633654


Q ss_pred             HHHHHHHHHHHHHHHHHHCCCEEC-CHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHH--HHHHHHCCCCHHHHH
Q ss_conf             689999998612766541035121-11789999986542015556467988998653333211--443221136578999
Q gi|254780163|r  369 IEDAIEIVKGIKPYFEEHHQLRYS-KEAIRAAVQLSVRHFTSRKLPDKAIDVIDEAGASQILQ--PLSKRRKFITEKDIK  445 (798)
Q Consensus       369 ~~~~~~iL~~~~~~ye~~h~v~~~-~~al~~av~ls~ryi~~r~lPdkAidllDea~a~~~~~--~~~~~~~~~~~~~i~  445 (798)
                      ......|+...      .|.+.+. +..+...+..+.-|....     .-.+..++.......  ........++..+..
T Consensus       152 ~~~~~~i~~~~------~~~~~~~~~~~~~~~a~~~~~~~~~~-----~~~l~~~~~~~~~~r~~~~~~~~~~~~~~~~~  220 (494)
T COG0464         152 EAGRLEILQIH------TRLMFLGPPGTGKTLAARTVGKSGAD-----LGALAKEAALRELRRAIDLVGEYIGVTEDDFE  220 (494)
T ss_pred             HHCCHHHHHHH------HHCCCCCCCCCHHHHHHHHCCHHHHH-----HHHHHHHHHHHHHHHCCCCCHHHHHCCHHHHH
T ss_conf             10142465101------11012578642788998732321324-----88774178888875002333033202199999


Q ss_pred             HHHHHCCCCCCHHHHHCCHHHHHHHHCCHHHHHHHCHHHHHHHHHHHHHH----HHCCCCC-CCCCCCEEEEECCCCHHH
Q ss_conf             86631024531011100112334210000246653458999999999877----5204456-578740688614320038
Q gi|254780163|r  446 KTIASMNRSIHTTSFSRDDDSVLSNLEKNLGTVVYGQEEAIKKLSSSIKI----ARAGLSD-PNKPIGCYVFSGPTGVGK  520 (798)
Q Consensus       446 ~~~~~~~~gip~~~~~~~~~~~l~~l~~~l~~~v~GQ~~ai~~v~~~i~~----~~~gl~~-~~rP~g~flf~GptGvGK  520 (798)
                      +.+.... +- ......++...+.        .+.|-+.+...+-+++..    ... +.. ..+|...+||.||+|+||
T Consensus       221 ~~l~~~~-~~-~~~~~~~~~v~~~--------diggl~~~k~~l~e~v~~~~~~~e~-~~~~~~~~~~giLl~GpPGtGK  289 (494)
T COG0464         221 EALKKVL-PS-RGVLFEDEDVTLD--------DIGGLEEAKEELKEAIETPLKRPEL-FRKLGLRPPKGVLLYGPPGTGK  289 (494)
T ss_pred             HHHHHCC-CC-CCCEECCCCCEEE--------EECCHHHHHHHHHHHHHHHHHHHHH-HHHCCCCCCCEEEEECCCCCCH
T ss_conf             9998612-45-5630036885145--------3236377999999999999970887-6325898883699988999758


Q ss_pred             HHHHHHHHHHCCCCEEEEEHHHHHCCCCCCHHCCCCCHHCCCCCC--CCCCHHHHHCCCEEEEECCHHHCC---------
Q ss_conf             899999873047733772068861246530110478000256444--310035551585177740445502---------
Q gi|254780163|r  521 TEISKQLAFALGVQLLRFDMSEYMERHAVSRLIGAPPGYVGFGQG--GILADSVDQNPYSVVLLDEIEKSH---------  589 (798)
Q Consensus       521 Telak~la~~~~~~lir~dmsey~e~~~vs~LiGappGYvG~~eg--g~Lte~vr~~P~sVvl~DEiEKAh---------  589 (798)
                      |.|||++|..+..+++.+++++|+.+            |||--+-  -.+.+..++..-|||+||||++--         
T Consensus       290 T~lAkava~~~~~~fi~v~~~~l~sk------------~vGesek~ir~~F~~A~~~~p~iifiDEiDs~~~~r~~~~~~  357 (494)
T COG0464         290 TLLAKAVALESRSRFISVKGSELLSK------------WVGESEKNIRELFEKARKLAPSIIFIDEIDSLASGRGPSEDG  357 (494)
T ss_pred             HHHHHHHHHHCCCCEEEECCHHHHHH------------HHHHHHHHHHHHHHHHHHCCCCEEEHHHHHHHHCCCCCCCCC
T ss_conf             99999987544982488433555407------------765999999999999996699889748866674128998763


Q ss_pred             --HHHHHHHHHHHHHHHCCCCCCCEECCCCEEEEEECCCCHHHHHHCCCCCCCCCCHHHHHHHHHHHCCHHHHCCCCEEE
Q ss_conf             --899999999877750217799776125429999424214553303689882111488999998728878817768289
Q gi|254780163|r  590 --PDVLNILLQIMDYGILTDQSGKKISFRNVILIMTTNAGALEMSKARIGFGSSRNDDADKEALRNFLSPEFLNRLDSII  667 (798)
Q Consensus       590 --~~v~~~llqild~G~ltd~~Gr~vdf~n~iii~TsN~G~~~~~~~~~g~~~~~~~~~~~~~l~~~f~peflnRid~ii  667 (798)
                        ..|.+-||..+|.  +.       +.+++++|.++|--.             ..    .++   ..+|   +|+|.++
T Consensus       358 ~~~rv~~~ll~~~d~--~e-------~~~~v~vi~aTN~p~-------------~l----d~a---~lR~---gRfd~~i  405 (494)
T COG0464         358 SGRRVVGQLLTELDG--IE-------KAEGVLVIAATNRPD-------------DL----DPA---LLRP---GRFDRLI  405 (494)
T ss_pred             HHHHHHHHHHHHHHC--CC-------CCCCEEEEECCCCCC-------------CC----CHH---HHCC---CCCEEEE
T ss_conf             799999999999747--54-------437648996479833-------------26----875---6243---6630378


Q ss_pred             ECCCCCHHHHHHHHHHHHHHHHHHHHHCCCEEEECHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHHHHHHHH
Q ss_conf             628899999999999999999999986698899988999999971898101532679999986235999999
Q gi|254780163|r  668 PFFPLSSDIIRQVVHKFIMKLELQLQEKGISFHFSEEVINWLVSHGYDVKMGARPLERIIKEHVKVPLADEI  739 (798)
Q Consensus       668 ~F~~l~~~~~~~i~~~~l~~l~~~l~~~~i~l~~~~~~~~~l~~~~~~~~~GAR~l~r~i~~~i~~~la~~i  739 (798)
                      .|.+-+..+..+|+...+.+....        -.++-..+.+++..  ..|-...+..+++.-....+.+.+
T Consensus       406 ~v~~pd~~~r~~i~~~~~~~~~~~--------~~~~~~~~~l~~~t--~~~sgadi~~i~~ea~~~~~~~~~  467 (494)
T COG0464         406 YVPLPDLEERLEIFKIHLRDKKPP--------LAEDVDLEELAEIT--EGYSGADIAALVREAALEALREAR  467 (494)
T ss_pred             EECCCCHHHHHHHHHHHHCCCCCC--------HHHHHHHHHHHHHH--CCCCHHHHHHHHHHHHHHHHHHCC
T ss_conf             717989899999999985415651--------15564199999875--277899999999999998998545


No 22 
>PRK13342 recombination factor protein RarA; Reviewed
Probab=99.77  E-value=2.7e-17  Score=143.42  Aligned_cols=245  Identities=24%  Similarity=0.370  Sum_probs=167.6

Q ss_pred             HHHHHCCCCHHHHHHHHH------HHHHHHHHHCCCCCCEEEECCCCCHHHHHHHHHHHHHHCCCCCHHHHEEEEEEEEH
Q ss_conf             887754861122217899------99999986226778748966764116689999999985489883452014455404
Q gi|254780163|r  195 TEKVKKGKVDILVGRHEE------INRTIQILCRRSKNNPLYVGDPGVGKTAIAEGFAKQIVDGMVPDILLGARIFSLDM  268 (798)
Q Consensus       195 Te~AreGKLDPVIGRd~E------I~riiqIL~RR~KNn~~lvG~~gvGktaive~la~~i~~~~vp~~l~~~~i~~ld~  268 (798)
                      -++-|=..||-|||-+.=      ++++|   ...+-.+.||-|+||||||++++-+|...          +..+++|+.
T Consensus         4 Aer~RP~~lde~vGQ~hllg~~~~L~~~i---~~~~~~s~Il~GPPG~GKTTlA~iiA~~~----------~~~f~~lnA   70 (417)
T PRK13342          4 AERMRPKTLDEVVGQEHLLGPGKPLRRMI---EAGRLSSMILWGPPGTGKTTLARIIAGAT----------DAEFEALSA   70 (417)
T ss_pred             HHHHCCCCHHHHCCCHHHHCCCHHHHHHH---HCCCCCEEEEECCCCCCHHHHHHHHHHHH----------CCCEEEEEC
T ss_conf             16449998888579877608971999999---76999759988969998999999999986----------898899614


Q ss_pred             HHHHCCCCCCCHHHHHHHHHHHHHCCC---CCEEEEECCHHHHHCCCCCCCCCCCHHHHHHHHHCCCCEEEEEECCHHHH
Q ss_conf             675306343123789999999872038---98399973616630155444344777888876630266038873048999
Q gi|254780163|r  269 GNLIAGTRYRGDFEERIKKIVKEIESY---ANAILYIDEIHTLVGAGSASGISVDASNLLKPALSSGAVRCIGSTTYSEY  345 (798)
Q Consensus       269 ~~l~ag~~~rg~fe~r~~~~~~~~~~~---~~~ilfideih~ligag~~~g~~~d~an~lkP~L~rg~~~~IgatT~~ey  345 (798)
                      ..  +|.       ..++.++++++..   +..||||||||.+         +-+.-+.|.|++.+|.+.+|||||..-|
T Consensus        71 ~~--~gv-------~dir~ii~~a~~~~~~~~tilfiDEIHRf---------nK~QQD~LLp~vE~g~iiLIgATTENP~  132 (417)
T PRK13342         71 VT--SGV-------KDLREVIEEAKQSRLGRRTILFIDEIHRF---------NKAQQDALLPHVEDGTITLIGATTENPS  132 (417)
T ss_pred             CC--CCH-------HHHHHHHHHHHHHHCCCCEEEEEECHHHC---------CHHHHHHHHHHHHCCCEEEEEECCCCCH
T ss_conf             10--388-------99999999988631489659999782005---------8899999987511265699974157922


Q ss_pred             HHHHHCCHHHHHHCEEEEECCCCHHHHHHHHHHHHHHHH--HHCCCEECCHHHHHHHHHHHHHCCCCCCHHHHHHHHHHH
Q ss_conf             998520111432001443068786899999986127665--410351211178999998654201555646798899865
Q gi|254780163|r  346 RQFFEKDKALVRRFQKIDVSEPSIEDAIEIVKGIKPYFE--EHHQLRYSKEAIRAAVQLSVRHFTSRKLPDKAIDVIDEA  423 (798)
Q Consensus       346 ~~~~e~d~al~rrF~~i~v~ep~~~~~~~iL~~~~~~ye--~~h~v~~~~~al~~av~ls~ryi~~r~lPdkAidllDea  423 (798)
                         |+-.+||-.|-+.+.++..+.++-..||+..... |  ..+++.++++|+...+..|.==      -.+|+.+|+-|
T Consensus       133 ---f~in~aLlSRc~vf~l~~L~~~di~~iL~ral~~-e~~~~~~i~i~~~al~~i~~~s~GD------aR~aLN~LE~a  202 (417)
T PRK13342        133 ---FEVNPALLSRAQVFELKPLSEEDLEQLLKRALED-ERGLGRKLELDDEALDALARLADGD------ARRALNLLELA  202 (417)
T ss_pred             ---HHCCHHHHHHHHHEECCCCCHHHHHHHHHHHHHH-HHCCCCCCCCCHHHHHHHHHHCCCC------HHHHHHHHHHH
T ss_conf             ---5348989856570020589999999999999987-7433788776999999999814985------99999999999


Q ss_pred             HHHHHHHHHHHHHCCCCHHHHHHHHHHCCCCCCHHHHHCCHHHHHHHHCCHHHHHHHCHH--HHHHHHHHH
Q ss_conf             333321144322113657899986631024531011100112334210000246653458--999999999
Q gi|254780163|r  424 GASQILQPLSKRRKFITEKDIKKTIASMNRSIHTTSFSRDDDSVLSNLEKNLGTVVYGQE--EAIKKLSSS  492 (798)
Q Consensus       424 ~a~~~~~~~~~~~~~~~~~~i~~~~~~~~~gip~~~~~~~~~~~l~~l~~~l~~~v~GQ~--~ai~~v~~~  492 (798)
                      ..      .......|+.+++.+.+.+..  .   ...++..+ --++-.-|.+.|=|-|  .|+--+++-
T Consensus       203 ~~------~~~~~~~i~~~~~~~~~~~~~--~---~yDk~gd~-HYd~iSAf~KSiRGSDpdAAlyyLarm  261 (417)
T PRK13342        203 AA------AAAGGEVITLELLEEALQRRA--A---RYDKDGDE-HYDLISALHKSIRGSDPDAALYYLARM  261 (417)
T ss_pred             HH------CCCCCCCCCHHHHHHHHHHCC--C---CCCCCCCH-HHHHHHHHHHHHHCCCCCHHHHHHHHH
T ss_conf             85------258997348999999984410--3---57778634-789999999985169954899999999


No 23 
>CHL00195 ycf46 Ycf46; Provisional
Probab=99.76  E-value=3.4e-16  Score=135.54  Aligned_cols=304  Identities=19%  Similarity=0.254  Sum_probs=184.5

Q ss_pred             HHHHCCCCCEEEEECCHHHHHCCCCCCCCCCCHHHHHHHH---H--CCCCEEEEEE--CCHHHHHHHHHCCHHHHHHCEE
Q ss_conf             9872038983999736166301554443447778888766---3--0266038873--0489999985201114320014
Q gi|254780163|r  289 VKEIESYANAILYIDEIHTLVGAGSASGISVDASNLLKPA---L--SSGAVRCIGS--TTYSEYRQFFEKDKALVRRFQK  361 (798)
Q Consensus       289 ~~~~~~~~~~ilfideih~ligag~~~g~~~d~an~lkP~---L--~rg~~~~Iga--tT~~ey~~~~e~d~al~rrF~~  361 (798)
                      ++.+...++.++.+-++|..++--       -....||-.   +  .+..+=+++.  +-|.|          |.+-+..
T Consensus        74 I~~~~~~~~~lfvLkDfh~fl~d~-------~i~R~Lrdla~~~~~~~~tlIlls~~~~lP~e----------L~~~~~~  136 (491)
T CHL00195         74 IERLTSETPTLFLLKDFNLFLNDI-------SISRKLRNLSRILKLQSKTIIIIASELNIPKE----------LKDLITV  136 (491)
T ss_pred             HHHCCCCCCEEEEEECCCHHHCCH-------HHHHHHHHHHHHHHHCCCEEEEEECCCCCCHH----------HHHCEEE
T ss_conf             986168898399993686243287-------99999999999996479859999479989978----------8722579


Q ss_pred             EEECCCCHHHHHHHHHHHHHHHHHHCCCEECCHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHCCCCH
Q ss_conf             43068786899999986127665410351211178999998654201555646798899865333321144322113657
Q gi|254780163|r  362 IDVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLPDKAIDVIDEAGASQILQPLSKRRKFITE  441 (798)
Q Consensus       362 i~v~ep~~~~~~~iL~~~~~~ye~~h~v~~~~~al~~av~ls~ryi~~r~lPdkAidllDea~a~~~~~~~~~~~~~~~~  441 (798)
                      +.++=|+.++-..+|.+....    .++....+.++..++-+.=      |     .+ .|+.  ..+...-..+..++.
T Consensus       137 l~~~LP~~~Ei~~~l~~~~~~----~~~~~~~~~~~~l~~a~~G------L-----t~-~e~~--~~~~~ai~~~g~i~~  198 (491)
T CHL00195        137 LDFPLPNESEINKELKRLINS----LNIPIDSELLENLTRACQG------L-----SL-ERIR--RVLAKIIATYKTIDE  198 (491)
T ss_pred             EECCCCCHHHHHHHHHHHHHH----CCCCCCHHHHHHHHHHHCC------C-----CH-HHHH--HHHHHHHHHCCCCCH
T ss_conf             804894999999999999985----2888998999999999669------9-----99-9999--999999985599883


Q ss_pred             HHHHHHHHHCC-----CCCCHHH---HHCCHHHHHHHHCCHHHHHHHCHHHHHHHHHHHHHHHHCCCCCCCCCCCEEEEE
Q ss_conf             89998663102-----4531011---100112334210000246653458999999999877520445657874068861
Q gi|254780163|r  442 KDIKKTIASMN-----RSIHTTS---FSRDDDSVLSNLEKNLGTVVYGQEEAIKKLSSSIKIARAGLSDPNKPIGCYVFS  513 (798)
Q Consensus       442 ~~i~~~~~~~~-----~gip~~~---~~~~~~~~l~~l~~~l~~~v~GQ~~ai~~v~~~i~~~~~gl~~~~rP~g~flf~  513 (798)
                      +|+..++....     +|+=...   -.-++---|.+|.+.|.+|=-    |   ....  -...||..   |-|++ ++
T Consensus       199 ~~i~~i~~~K~q~i~~~g~Le~~~~~~~~~~vGGl~~lK~wl~~r~~----~---f~~~--a~~~gl~~---PkGvL-L~  265 (491)
T CHL00195        199 ESIQIILEEKRQIISQTEILEFYSVNEKISDIGGLDNLKDWLKKRST----S---FSKQ--AENYGLPT---PRGLL-LV  265 (491)
T ss_pred             HHHHHHHHHHHHHHHCCCCEEEEECCCCCHHCCCHHHHHHHHHHHHH----H---HHHH--HHHCCCCC---CCEEE-EE
T ss_conf             32899999999998356965887489980414688999999999889----8---6233--66459999---98799-97


Q ss_pred             CCCCHHHHHHHHHHHHHCCCCEEEEEHHHHHCCCCCCHHCCCCCHHCCCCCCC--CCCHHHHHCCCEEEEECCHHHCC--
Q ss_conf             43200388999998730477337720688612465301104780002564443--10035551585177740445502--
Q gi|254780163|r  514 GPTGVGKTEISKQLAFALGVQLLRFDMSEYMERHAVSRLIGAPPGYVGFGQGG--ILADSVDQNPYSVVLLDEIEKSH--  589 (798)
Q Consensus       514 GptGvGKTelak~la~~~~~~lir~dmsey~e~~~vs~LiGappGYvG~~egg--~Lte~vr~~P~sVvl~DEiEKAh--  589 (798)
                      ||+|+|||.+||++|...+-+|+++|||+++.            +|||-.|.-  .+....+..--|||.+|||||+-  
T Consensus       266 GpPG~GKtl~AKAvA~e~~~p~l~l~~~~l~~------------~~vGesE~~~r~~f~~A~~~aP~ilfiDEidk~~~~  333 (491)
T CHL00195        266 GIQGTGKSLTAKAIANEWNLPLLRLDVGKLFG------------GIVGESESRMRQMIQLAETISPCILWIDEIDKAFSG  333 (491)
T ss_pred             CCCCCCHHHHHHHHHHHHCCCEEEEEHHHHHH------------HHCCHHHHHHHHHHHHHHHHCCEEEEEEHHHHHCCC
T ss_conf             99998789999999866389469966799756------------006704999999999998619858997465454258


Q ss_pred             ----------HHHHHHHHHHHHHHHCCCCCCCEECCCCEEEEEECCCCHHHHHHCCCCCCCCCCHHHHHHHHHHHCCHHH
Q ss_conf             ----------8999999998777502177997761254299994242145533036898821114889999987288788
Q gi|254780163|r  590 ----------PDVLNILLQIMDYGILTDQSGKKISFRNVILIMTTNAGALEMSKARIGFGSSRNDDADKEALRNFLSPEF  659 (798)
Q Consensus       590 ----------~~v~~~llqild~G~ltd~~Gr~vdf~n~iii~TsN~G~~~~~~~~~g~~~~~~~~~~~~~l~~~f~pef  659 (798)
                                ..|++-||.-|++     .      -+..++|.|+|-    +                     ..+.|||
T Consensus       334 ~~~~~d~g~s~rv~~~~Lt~m~e-----~------~~~VfViattN~----~---------------------~~L~pel  377 (491)
T CHL00195        334 LDSKGDSGTSNRVLATFITWLSE-----K------KSPVFVVATANN----I---------------------DSLPLEL  377 (491)
T ss_pred             CCCCCCCCHHHHHHHHHHHHHCC-----C------CCCEEEEEECCC----C---------------------CCCCHHH
T ss_conf             88888872328999999998646-----8------997699995899----7---------------------5589877


Q ss_pred             H--CCCCEEEECCCCCHHHHHHHHHHHHHHH
Q ss_conf             1--7768289628899999999999999999
Q gi|254780163|r  660 L--NRLDSIIPFFPLSSDIIRQVVHKFIMKL  688 (798)
Q Consensus       660 l--nRid~ii~F~~l~~~~~~~i~~~~l~~l  688 (798)
                      +  +|+|+++....-+.++-.+|.++++.+.
T Consensus       378 lR~GRFD~~~~v~lP~~~~R~~I~~ihl~~~  408 (491)
T CHL00195        378 LRKGRFDEIFFLDLPNLEERELIFKIHLKRF  408 (491)
T ss_pred             CCCCCCCEEEECCCCCHHHHHHHHHHHHHCC
T ss_conf             0898777047648959899999999998544


No 24 
>KOG0735 consensus
Probab=99.73  E-value=7.5e-14  Score=118.69  Aligned_cols=427  Identities=19%  Similarity=0.245  Sum_probs=240.5

Q ss_pred             CCCCCEEEECCCCCHHHHHHHHHHHHHHCCCCCHHHHEEEEEEEEHHHHHCCCCCCCHHHHHHHHHHHHHCCCCCEEEEE
Q ss_conf             67787489667641166899999999854898834520144554046753063431237899999998720389839997
Q gi|254780163|r  223 RSKNNPLYVGDPGVGKTAIAEGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIESYANAILYI  302 (798)
Q Consensus       223 R~KNn~~lvG~~gvGktaive~la~~i~~~~vp~~l~~~~i~~ld~~~l~ag~~~rg~fe~r~~~~~~~~~~~~~~ilfi  302 (798)
                      -+.-|.+|-|++|.|||.+|+.++...-..    .+....++   -++-++|++ ---+..-+..++.+...+++.|.+.
T Consensus       429 ~~~~~Ill~G~~GsGKT~L~kal~~~~~k~----~~~hv~~v---~Cs~l~~~~-~e~iQk~l~~vfse~~~~~PSiIvL  500 (952)
T KOG0735         429 FRHGNILLNGPKGSGKTNLVKALFDYYSKD----LIAHVEIV---SCSTLDGSS-LEKIQKFLNNVFSEALWYAPSIIVL  500 (952)
T ss_pred             CCCCCEEEECCCCCCHHHHHHHHHHHHCCC----CCEEEEEE---ECHHCCCHH-HHHHHHHHHHHHHHHHHHCCCEEEE
T ss_conf             346618986799877769999999875156----50699997---522104204-8999999999999988637808997


Q ss_pred             CCHHHHHCCCCCCCCCCCH---------HHHHHHHHCCCCE-EEEEECCHHHHHHHHHCCHHHHHHCEE-EEECCCCHHH
Q ss_conf             3616630155444344777---------8888766302660-388730489999985201114320014-4306878689
Q gi|254780163|r  303 DEIHTLVGAGSASGISVDA---------SNLLKPALSSGAV-RCIGSTTYSEYRQFFEKDKALVRRFQK-IDVSEPSIED  371 (798)
Q Consensus       303 deih~ligag~~~g~~~d~---------an~lkP~L~rg~~-~~IgatT~~ey~~~~e~d~al~rrF~~-i~v~ep~~~~  371 (798)
                      |++|.|+|+...+++..+.         -.+.|-++.++.. .+|+  |-+|..+ |-+---..++||. +.+..|...+
T Consensus       501 Ddld~l~~~s~~e~~q~~~~~~rla~flnqvi~~y~~~~~~ia~Ia--t~qe~qt-l~~~L~s~~~Fq~~~~L~ap~~~~  577 (952)
T KOG0735         501 DDLDCLASASSNENGQDGVVSERLAAFLNQVIKIYLKRNRKIAVIA--TGQELQT-LNPLLVSPLLFQIVIALPAPAVTR  577 (952)
T ss_pred             CCHHHHHCCCCCCCCCCHHHHHHHHHHHHHHHHHHHCCCCEEEEEE--ECHHHHH-CCHHHCCCCCEEEEEECCCCCHHH
T ss_conf             0503540568444773028999999999999999870685799998--5143420-385334763147888158923567


Q ss_pred             HHHHHHHHHHHHHHHCCCEECCHHHHHHHHHHHHHCCCC--CCHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHH
Q ss_conf             999998612766541035121117899999865420155--564679889986533332114432211365789998663
Q gi|254780163|r  372 AIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSR--KLPDKAIDVIDEAGASQILQPLSKRRKFITEKDIKKTIA  449 (798)
Q Consensus       372 ~~~iL~~~~~~ye~~h~v~~~~~al~~av~ls~ryi~~r--~lPdkAidllDea~a~~~~~~~~~~~~~~~~~~i~~~~~  449 (798)
                      --.||..+-..-    ..-++.+-|........-|..--  .|-|+||-       ...++..+...+.++..+....+.
T Consensus       578 R~~IL~~~~s~~----~~~~~~~dLd~ls~~TEGy~~~DL~ifVeRai~-------~a~leris~~~klltke~f~ksL~  646 (952)
T KOG0735         578 RKEILTTIFSKN----LSDITMDDLDFLSVKTEGYLATDLVIFVERAIH-------EAFLERISNGPKLLTKELFEKSLK  646 (952)
T ss_pred             HHHHHHHHHHHH----HHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHH-------HHHHHHHCCCCCCCHHHHHHHHHH
T ss_conf             999999999755----345456789988876078440447999999999-------999887516763101889999987


Q ss_pred             HCCCCCCHHH--HHCCHHHHHHHHCCHHH-HHHHCHHHHHHHHHHHHHH--------HHCCCCCCCCCCCEEEEECCCCH
Q ss_conf             1024531011--10011233421000024-6653458999999999877--------52044565787406886143200
Q gi|254780163|r  450 SMNRSIHTTS--FSRDDDSVLSNLEKNLG-TVVYGQEEAIKKLSSSIKI--------ARAGLSDPNKPIGCYVFSGPTGV  518 (798)
Q Consensus       450 ~~~~gip~~~--~~~~~~~~l~~l~~~l~-~~v~GQ~~ai~~v~~~i~~--------~~~gl~~~~rP~g~flf~GptGv  518 (798)
                      ..   .|...  +....+       ..|+ ..|-|-.++...+-+.|.+        ...+|.-   +.|.+|| ||+|+
T Consensus       647 ~F---~P~aLR~ik~~k~-------tgi~w~digg~~~~k~~l~~~i~~P~kyp~if~~~plr~---~~giLLy-GppGc  712 (952)
T KOG0735         647 DF---VPLALRGIKLVKS-------TGIRWEDIGGLFEAKKVLEEVIEWPSKYPQIFANCPLRL---RTGILLY-GPPGC  712 (952)
T ss_pred             HC---CHHHHHHCCCCCC-------CCCCCEECCCHHHHHHHHHHHHHCCCCCHHHHHHCCCCC---CCCEEEE-CCCCC
T ss_conf             40---7677640301566-------787710033589999999999855410367886088666---5545887-79998


Q ss_pred             HHHHHHHHHHHHCCCCEEEEEHHHHHCCCCCCHHCCCCCHHCCCCCCC-CCCHHHHHCCCEEEEECCHHHCCH-------
Q ss_conf             388999998730477337720688612465301104780002564443-100355515851777404455028-------
Q gi|254780163|r  519 GKTEISKQLAFALGVQLLRFDMSEYMERHAVSRLIGAPPGYVGFGQGG-ILADSVDQNPYSVVLLDEIEKSHP-------  590 (798)
Q Consensus       519 GKTelak~la~~~~~~lir~dmsey~e~~~vs~LiGappGYvG~~egg-~Lte~vr~~P~sVvl~DEiEKAh~-------  590 (798)
                      |||.||-++|-...-++|.+--.|.-.     +.||+.      +|+- .|.++-+-.--||++|||++--.|       
T Consensus       713 GKT~la~a~a~~~~~~fisvKGPElL~-----KyIGaS------Eq~vR~lF~rA~~a~PCiLFFDEfdSiAPkRGhDsT  781 (952)
T KOG0735         713 GKTLLASAIASNSNLRFISVKGPELLS-----KYIGAS------EQNVRDLFERAQSAKPCILFFDEFDSIAPKRGHDST  781 (952)
T ss_pred             CHHHHHHHHHHHCCEEEEEECCHHHHH-----HHHCCC------HHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCCCCC
T ss_conf             578888888853780599825889999-----874500------788999999865149748971210243766687777


Q ss_pred             ----HHHHHHHHHHHHHHCCCCCCCEECCCCEEE-EEECCCCHHHHHHCCCCCCCCCCHHHHHHHHHHHCCHHHHCCCCE
Q ss_conf             ----999999998777502177997761254299-994242145533036898821114889999987288788177682
Q gi|254780163|r  591 ----DVLNILLQIMDYGILTDQSGKKISFRNVIL-IMTTNAGALEMSKARIGFGSSRNDDADKEALRNFLSPEFLNRLDS  665 (798)
Q Consensus       591 ----~v~~~llqild~G~ltd~~Gr~vdf~n~ii-i~TsN~G~~~~~~~~~g~~~~~~~~~~~~~l~~~f~peflnRid~  665 (798)
                          .|.|-||.-|| |       -.. ....+| -.||-        .          +...+++   .||   +|+|.
T Consensus       782 GVTDRVVNQlLTelD-G-------~Eg-l~GV~i~aaTsR--------p----------dliDpAL---LRp---GRlD~  828 (952)
T KOG0735         782 GVTDRVVNQLLTELD-G-------AEG-LDGVYILAATSR--------P----------DLIDPAL---LRP---GRLDK  828 (952)
T ss_pred             CCHHHHHHHHHHHHC-C-------CCC-CCEEEEEEECCC--------C----------CCCCHHH---CCC---CCCCE
T ss_conf             742999999987603-6-------334-453899973378--------3----------4367766---288---76540


Q ss_pred             EEECCCCCHHHHHHHHHHHHHHHHHHHHHCCCEEEECHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHHHHHHHHHC
Q ss_conf             8962889999999999999999999998669889998899999997189810153267999998623599999962
Q gi|254780163|r  666 IIPFFPLSSDIIRQVVHKFIMKLELQLQEKGISFHFSEEVINWLVSHGYDVKMGARPLERIIKEHVKVPLADEILF  741 (798)
Q Consensus       666 ii~F~~l~~~~~~~i~~~~l~~l~~~l~~~~i~l~~~~~~~~~l~~~~~~~~~GAR~l~r~i~~~i~~~la~~il~  741 (798)
                      .|.-..-++.+-..|...    |..++.      .-++.-.++++.+. +--.| -.|.-.+.+--...+-+.+..
T Consensus       829 ~v~C~~P~~~eRl~il~~----ls~s~~------~~~~vdl~~~a~~T-~g~tg-ADlq~ll~~A~l~avh~~l~~  892 (952)
T KOG0735         829 LVYCPLPDEPERLEILQV----LSNSLL------KDTDVDLECLAQKT-DGFTG-ADLQSLLYNAQLAAVHEILKR  892 (952)
T ss_pred             EEECCCCCCHHHHHHHHH----HHHCCC------CCCCCCHHHHHHHC-CCCCH-HHHHHHHHHHHHHHHHHHHHH
T ss_conf             156799892899999999----853457------75210168876521-78736-659989877799999999986


No 25 
>KOG0741 consensus
Probab=99.72  E-value=4.5e-16  Score=134.68  Aligned_cols=358  Identities=23%  Similarity=0.392  Sum_probs=208.1

Q ss_pred             HHHHHHCCCCCCEEEECCCCCHHHHHHHHHHHHHHCCCCCHHHHEEEEEEEEHHHHHCCCCCCCHHHHHHHHHHHHHCC-
Q ss_conf             9998622677874896676411668999999998548988345201445540467530634312378999999987203-
Q gi|254780163|r  216 TIQILCRRSKNNPLYVGDPGVGKTAIAEGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIES-  294 (798)
Q Consensus       216 iiqIL~RR~KNn~~lvG~~gvGktaive~la~~i~~~~vp~~l~~~~i~~ld~~~l~ag~~~rg~fe~r~~~~~~~~~~-  294 (798)
                      +++-|.-++=...+|-|+||.|||-++..+.... +..-|....|-.|++          ||.||-|+.++.++.+++. 
T Consensus       247 vie~lGi~HVKGiLLyGPPGTGKTLiARqIGkML-NArePKIVNGPeIL~----------KYVGeSE~NvR~LFaDAEeE  315 (744)
T KOG0741         247 VIEQLGIKHVKGILLYGPPGTGKTLIARQIGKML-NAREPKIVNGPEILN----------KYVGESEENVRKLFADAEEE  315 (744)
T ss_pred             HHHHCCCCCEEEEEEECCCCCCHHHHHHHHHHHH-CCCCCCCCCCHHHHH----------HHHCCCHHHHHHHHHHHHHH
T ss_conf             9987195112357887799987018999987874-579986347578898----------76063078899998757999


Q ss_pred             -------CCCEEEEECCHHHHHC-CCCCCCCC---CCHHHHHHHHH----CCCCEEEEEECCHHHHHHHHHCCHHHHH--
Q ss_conf             -------8983999736166301-55444344---77788887663----0266038873048999998520111432--
Q gi|254780163|r  295 -------YANAILYIDEIHTLVG-AGSASGIS---VDASNLLKPAL----SSGAVRCIGSTTYSEYRQFFEKDKALVR--  357 (798)
Q Consensus       295 -------~~~~ilfideih~lig-ag~~~g~~---~d~an~lkP~L----~rg~~~~IgatT~~ey~~~~e~d~al~r--  357 (798)
                             ++=-|.-+|||..|-- -|+..|++   ..+-|-|.--+    +-..|-+||-|.-..     --|.||-|  
T Consensus       316 ~r~~g~~SgLHIIIFDEiDAICKqRGS~~g~TGVhD~VVNQLLsKmDGVeqLNNILVIGMTNR~D-----lIDEALLRPG  390 (744)
T KOG0741         316 QRRLGANSGLHIIIFDEIDAICKQRGSMAGSTGVHDTVVNQLLSKMDGVEQLNNILVIGMTNRKD-----LIDEALLRPG  390 (744)
T ss_pred             HHHHCCCCCCEEEEEHHHHHHHHHCCCCCCCCCCCHHHHHHHHHHCCCHHHHHCEEEEECCCCHH-----HHHHHHCCCC
T ss_conf             98437667725999634679997448878988631899999998532287661678994047366-----6788755887


Q ss_pred             HCEE-EEECCCCHHHHHHHHHHHHHHHHHHCCCEECCHHHHHHHHHHHHHCCCCCCHHHHHHHH-H-----------HHH
Q ss_conf             0014-43068786899999986127665410351211178999998654201555646798899-8-----------653
Q gi|254780163|r  358 RFQK-IDVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLPDKAIDVI-D-----------EAG  424 (798)
Q Consensus       358 rF~~-i~v~ep~~~~~~~iL~~~~~~ye~~h~v~~~~~al~~av~ls~ryi~~r~lPdkAidll-D-----------ea~  424 (798)
                      ||++ +.|.=|+..--++||+--..+.+.|.... +|--++....|++-|      -+.-|.=| .           .++
T Consensus       391 RlEVqmEIsLPDE~gRlQIl~IHT~rMre~~~l~-~dVdl~elA~lTKNf------SGAEleglVksA~S~A~nR~vk~~  463 (744)
T KOG0741         391 RLEVQMEISLPDEKGRLQILKIHTKRMRENNKLS-ADVDLKELAALTKNF------SGAELEGLVKSAQSFAMNRHVKAG  463 (744)
T ss_pred             CEEEEEEEECCCCCCCEEEEEHHHHHHHHCCCCC-CCCCHHHHHHHHCCC------CHHHHHHHHHHHHHHHHHHHHCCC
T ss_conf             1699999846887672788871445566517877-776989999985578------626789999988889888661368


Q ss_pred             HHHHHHHHHHHHCCCCHHHHHHHHHHCCCCCCHHHHHCCHHHHHHHHCCHHHHHHHCHHHHHHHHHHHHHHHHCCCC-CC
Q ss_conf             33321144322113657899986631024531011100112334210000246653458999999999877520445-65
Q gi|254780163|r  425 ASQILQPLSKRRKFITEKDIKKTIASMNRSIHTTSFSRDDDSVLSNLEKNLGTVVYGQEEAIKKLSSSIKIARAGLS-DP  503 (798)
Q Consensus       425 a~~~~~~~~~~~~~~~~~~i~~~~~~~~~gip~~~~~~~~~~~l~~l~~~l~~~v~GQ~~ai~~v~~~i~~~~~gl~-~~  503 (798)
                      ...++.......-.|+..|....+...   -|..-.+.++      |+..+..-+|---+-+..+.+.=.+.-.-++ ..
T Consensus       464 ~~~~~~~~~~e~lkV~r~DFl~aL~dV---kPAFG~see~------l~~~~~~Gmi~~g~~v~~il~~G~llv~qvk~s~  534 (744)
T KOG0741         464 GKVEVDPVAIENLKVTRGDFLNALEDV---KPAFGISEED------LERFVMNGMINWGPPVTRILDDGKLLVQQVKNSE  534 (744)
T ss_pred             CCEECCCHHHHHEEECHHHHHHHHHHC---CCCCCCCHHH------HHHHHHCCCEEECCCHHHHHHHHHHHHHHHHCCC
T ss_conf             631127111432020288789898735---7544878899------9999857854516307788766889999863346


Q ss_pred             CCCCCEEEEECCCCHHHHHHHHHHHHHCCCCEEEE----EHHHHHCCCCCCHHCCCCCHHCCCCCCCCCCHHHHHCCCEE
Q ss_conf             78740688614320038899999873047733772----06886124653011047800025644431003555158517
Q gi|254780163|r  504 NKPIGCYVFSGPTGVGKTEISKQLAFALGVQLLRF----DMSEYMERHAVSRLIGAPPGYVGFGQGGILADSVDQNPYSV  579 (798)
Q Consensus       504 ~rP~g~flf~GptGvGKTelak~la~~~~~~lir~----dmsey~e~~~vs~LiGappGYvG~~egg~Lte~vr~~P~sV  579 (798)
                      +.|+-|.||.||+|+|||-||-.+|..++=++|++    ||.-|+|...+.-+-+             ..+---+.|-||
T Consensus       535 ~s~lvSvLl~Gp~~sGKTaLAA~iA~~S~FPFvKiiSpe~miG~sEsaKc~~i~k-------------~F~DAYkS~lsi  601 (744)
T KOG0741         535 RSPLVSVLLEGPPGSGKTALAAKIALSSDFPFVKIISPEDMIGLSESAKCAHIKK-------------IFEDAYKSPLSI  601 (744)
T ss_pred             CCCCEEEEEECCCCCCHHHHHHHHHHHCCCCEEEEECHHHHCCCCHHHHHHHHHH-------------HHHHHHCCCCEE
T ss_conf             6763589986699887688999997527998479737787037466788999999-------------888763386508


Q ss_pred             EEECCHHH------CCHHHHHHHHHHHHHHHCC--CCCCCEECCCCEEEEEEC
Q ss_conf             77404455------0289999999987775021--779977612542999942
Q gi|254780163|r  580 VLLDEIEK------SHPDVLNILLQIMDYGILT--DQSGKKISFRNVILIMTT  624 (798)
Q Consensus       580 vl~DEiEK------Ah~~v~~~llqild~G~lt--d~~Gr~vdf~n~iii~Ts  624 (798)
                      |++|+||.      --|..-|+.||.|-= .|.  --+||+     -+|+.||
T Consensus       602 ivvDdiErLiD~vpIGPRfSN~vlQaL~V-llK~~ppkg~k-----Lli~~TT  648 (744)
T KOG0741         602 IVVDDIERLLDYVPIGPRFSNLVLQALLV-LLKKQPPKGRK-----LLIFGTT  648 (744)
T ss_pred             EEECCHHHHHCCCCCCCCHHHHHHHHHHH-HHCCCCCCCCE-----EEEEECC
T ss_conf             99815565620024684035799999999-95248988845-----9999624


No 26 
>KOG0736 consensus
Probab=99.70  E-value=1.5e-14  Score=123.82  Aligned_cols=431  Identities=21%  Similarity=0.323  Sum_probs=244.6

Q ss_pred             HHHHHHHHHHHHHHHHHCCC--------CCC-EEEECCCCCHHHHHHHHHHHHHHCCCCCHHHHEEEEEEEEHHHHHCCC
Q ss_conf             22217899999999862267--------787-489667641166899999999854898834520144554046753063
Q gi|254780163|r  205 ILVGRHEEINRTIQILCRRS--------KNN-PLYVGDPGVGKTAIAEGFAKQIVDGMVPDILLGARIFSLDMGNLIAGT  275 (798)
Q Consensus       205 PVIGRd~EI~riiqIL~RR~--------KNn-~~lvG~~gvGktaive~la~~i~~~~vp~~l~~~~i~~ld~~~l~ag~  275 (798)
                      +..+++.-+..+.+||+-+.        +|- .+|-|+||+|||.+|+..|+..          +..+++.|-.+|+|-+
T Consensus       402 ~~~~~~~~~~~l~~vl~p~~~~s~~~~~~~~~vLLhG~~g~GK~t~V~~vas~l----------g~h~~evdc~el~~~s  471 (953)
T KOG0736         402 SPPGLEAKVLELVAVLSPQKQPSGALLTLNPSVLLHGPPGSGKTTVVRAVASEL----------GLHLLEVDCYELVAES  471 (953)
T ss_pred             CCCCCHHHHHHHHHHHCCCCCCCHHCCCCCEEEEEECCCCCCHHHHHHHHHHHH----------CCCEEECCHHHHHHCC
T ss_conf             876602799999998486558530013355379986799987579999999983----------8725701389886436


Q ss_pred             CCCCHHHHHHHHHHHHHCCCCCEEEEECCHHHHHCCCCCCCCCCCH--HHHHHHHH-------CCCCEEEEEECCHHHHH
Q ss_conf             4312378999999987203898399973616630155444344777--88887663-------02660388730489999
Q gi|254780163|r  276 RYRGDFEERIKKIVKEIESYANAILYIDEIHTLVGAGSASGISVDA--SNLLKPAL-------SSGAVRCIGSTTYSEYR  346 (798)
Q Consensus       276 ~~rg~fe~r~~~~~~~~~~~~~~ilfideih~ligag~~~g~~~d~--an~lkP~L-------~rg~~~~IgatT~~ey~  346 (798)
                        ++--|-+++.+...++...+.|||+..+..+-  ..+.| +.|+  ...+.--|       .++..-+||+|+-.   
T Consensus       472 --~~~~etkl~~~f~~a~~~~pavifl~~~dvl~--id~dg-ged~rl~~~i~~~ls~e~~~~~~~~~ivv~t~~s~---  543 (953)
T KOG0736         472 --ASHTETKLQAIFSRARRCSPAVLFLRNLDVLG--IDQDG-GEDARLLKVIRHLLSNEDFKFSCPPVIVVATTSSI---  543 (953)
T ss_pred             --CCHHHHHHHHHHHHHHHCCCEEEEEECCCEEE--ECCCC-CHHHHHHHHHHHHHHCCCCCCCCCCEEEEEECCCC---
T ss_conf             --33137899999998752686289872242455--33777-44277999999997202356779965999962530---


Q ss_pred             HHHHCCHHHHHH--CEEEEECCCCHHHHHHHHHHHHHHHHHHCCCEECCHH-HHHHHHHHH--------HHCCCCCCHHH
Q ss_conf             985201114320--0144306878689999998612766541035121117-899999865--------42015556467
Q gi|254780163|r  347 QFFEKDKALVRR--FQKIDVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEA-IRAAVQLSV--------RHFTSRKLPDK  415 (798)
Q Consensus       347 ~~~e~d~al~rr--F~~i~v~ep~~~~~~~iL~~~~~~ye~~h~v~~~~~a-l~~av~ls~--------ryi~~r~lPdk  415 (798)
                         ++=++--|+  +..|.++.|+.++-.+||+.    |-.||.  +.++. +.-++.-..        .|.++-  |--
T Consensus       544 ---~~lp~~i~~~f~~ei~~~~lse~qRl~iLq~----y~~~~~--~n~~v~~k~~a~~t~gfs~~~L~~l~~~~--s~~  612 (953)
T KOG0736         544 ---EDLPADIQSLFLHEIEVPALSEEQRLEILQW----YLNHLP--LNQDVNLKQLARKTSGFSFGDLEALVAHS--SLA  612 (953)
T ss_pred             ---CCCCHHHHHHHHHHCCCCCCCHHHHHHHHHH----HHHCCC--CCHHHHHHHHHHHCCCCCHHHHHHHHCCC--HHH
T ss_conf             ---2398789875265213778887889999999----983065--23577878999865898777799771475--188


Q ss_pred             HHHHHHHHHHHHHHHHHH-----HHHCCCCHHHHHHHHHHCCC------C---CCHHHHHCCHHHHHHHHCCHHHHHHHC
Q ss_conf             988998653333211443-----22113657899986631024------5---310111001123342100002466534
Q gi|254780163|r  416 AIDVIDEAGASQILQPLS-----KRRKFITEKDIKKTIASMNR------S---IHTTSFSRDDDSVLSNLEKNLGTVVYG  481 (798)
Q Consensus       416 AidllDea~a~~~~~~~~-----~~~~~~~~~~i~~~~~~~~~------g---ip~~~~~~~~~~~l~~l~~~l~~~v~G  481 (798)
                      +.+-+.+++-.--.+...     -.-..++++|+...+.++.+      |   ||.-..  +              -|=|
T Consensus       613 ~~~~i~~~~l~g~~~~~~~~~~~~~~~~l~~edf~kals~~~~~fs~aiGAPKIPnV~W--d--------------DVGG  676 (953)
T KOG0736         613 AKTRIKNKGLAGGLQEEDEGELCAAGFLLTEEDFDKALSRLQKEFSDAIGAPKIPNVSW--D--------------DVGG  676 (953)
T ss_pred             HHHHHHHHCCCCCCHHCCCCCCCCCCCEECHHHHHHHHHHHHHHHHHHCCCCCCCCCCH--H--------------CCCC
T ss_conf             89999752014431110245401246410198888898898886555307988896460--0--------------1557


Q ss_pred             HHHHHHHHHHHHHH-------HHCCCCCCCCCCCEEEEECCCCHHHHHHHHHHHHHCCCCEEEEEHHHHHCCCCCCHHCC
Q ss_conf             58999999999877-------52044565787406886143200388999998730477337720688612465301104
Q gi|254780163|r  482 QEEAIKKLSSSIKI-------ARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFALGVQLLRFDMSEYMERHAVSRLIG  554 (798)
Q Consensus       482 Q~~ai~~v~~~i~~-------~~~gl~~~~rP~g~flf~GptGvGKTelak~la~~~~~~lir~dmsey~e~~~vs~LiG  554 (798)
                      =+++-+.|.+.|+.       .-.||+..    .-.||-||+|+|||-+||++|-...-+|+.+--.|.-.         
T Consensus       677 LeevK~eIldTIqlPL~hpeLfssglrkR----SGILLYGPPGTGKTLlAKAVATEcsL~FlSVKGPELLN---------  743 (953)
T KOG0736         677 LEEVKTEILDTIQLPLKHPELFSSGLRKR----SGILLYGPPGTGKTLLAKAVATECSLNFLSVKGPELLN---------  743 (953)
T ss_pred             HHHHHHHHHHHHCCCCCCHHHHHCCCCCC----CEEEEECCCCCCHHHHHHHHHHHCEEEEEEECCHHHHH---------
T ss_conf             89999999987547543756651254313----50588779998557999998754303678505889988---------


Q ss_pred             CCCHHCCCCCCC--CCCHHHHHCCCEEEEECCHHHCCHH---------HHHH-HHHHHHH-HHCCCCCCCEECCCCEEEE
Q ss_conf             780002564443--1003555158517774044550289---------9999-9998777-5021779977612542999
Q gi|254780163|r  555 APPGYVGFGQGG--ILADSVDQNPYSVVLLDEIEKSHPD---------VLNI-LLQIMDY-GILTDQSGKKISFRNVILI  621 (798)
Q Consensus       555 appGYvG~~egg--~Lte~vr~~P~sVvl~DEiEKAh~~---------v~~~-llqild~-G~ltd~~Gr~vdf~n~iii  621 (798)
                         =|||-.|..  ...|+-|..-=|||+|||++--.|.         |++- .-|+|-| --|.|+     +-....||
T Consensus       744 ---MYVGqSE~NVR~VFerAR~A~PCVIFFDELDSlAP~RG~sGDSGGVMDRVVSQLLAELDgls~~-----~s~~VFVi  815 (953)
T KOG0736         744 ---MYVGQSEENVREVFERARSAAPCVIFFDELDSLAPNRGRSGDSGGVMDRVVSQLLAELDGLSDS-----SSQDVFVI  815 (953)
T ss_pred             ---HHHCCHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCC-----CCCCEEEE
T ss_conf             ---7743018889999998544697499831212327567887886540899999999986266678-----88865998


Q ss_pred             EECCCCHHHHHHCCCCCCCCCCHHHHHHHHHHHCCHHHHCCCCEEEECCCCCHHH-HHHHHHHHHHHHHHHHHHCCCEEE
Q ss_conf             9424214553303689882111488999998728878817768289628899999-999999999999999986698899
Q gi|254780163|r  622 MTTNAGALEMSKARIGFGSSRNDDADKEALRNFLSPEFLNRLDSIIPFFPLSSDI-IRQVVHKFIMKLELQLQEKGISFH  700 (798)
Q Consensus       622 ~TsN~G~~~~~~~~~g~~~~~~~~~~~~~l~~~f~peflnRid~ii~F~~l~~~~-~~~i~~~~l~~l~~~l~~~~i~l~  700 (798)
                      =.||       ++          +...+   ...||   +|+|..+...|=...+ ..+|    |+.+.+++     .|+
T Consensus       816 GATN-------RP----------DLLDp---ALLRP---GRFDKLvyvG~~~d~esk~~v----L~AlTrkF-----kLd  863 (953)
T KOG0736         816 GATN-------RP----------DLLDP---ALLRP---GRFDKLVYVGPNEDAESKLRV----LEALTRKF-----KLD  863 (953)
T ss_pred             ECCC-------CC----------CCCCH---HHCCC---CCCCEEEEECCCCCHHHHHHH----HHHHHHHC-----CCC
T ss_conf             2588-------85----------54576---55388---765524885588567889999----99988770-----287


Q ss_pred             ECHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHHHH
Q ss_conf             98899999997189810153267999998623599
Q gi|254780163|r  701 FSEEVINWLVSHGYDVKMGARPLERIIKEHVKVPL  735 (798)
Q Consensus       701 ~~~~~~~~l~~~~~~~~~GAR~l~r~i~~~i~~~l  735 (798)
                      -+-+ +.-++++|-..-.||- +--.+.+-....+
T Consensus       864 edVd-L~eiAk~cp~~~TGAD-lYsLCSdA~l~Ai  896 (953)
T KOG0736         864 EDVD-LVEIAKKCPPNMTGAD-LYSLCSDAMLAAI  896 (953)
T ss_pred             CCCC-HHHHHHHCCCCCCHHH-HHHHHHHHHHHHH
T ss_conf             8767-9999963896775247-9999889999999


No 27 
>KOG2170 consensus
Probab=99.70  E-value=1.1e-15  Score=131.74  Aligned_cols=222  Identities=24%  Similarity=0.417  Sum_probs=147.9

Q ss_pred             HHHHHHCCHHHHHHHCHHHHHHHHHHHHHHHHCCCCCCCCCCCEEEEECCCCHHHHHHHHHHHH-----HCCCCEEEEEH
Q ss_conf             3342100002466534589999999998775204456578740688614320038899999873-----04773377206
Q gi|254780163|r  466 SVLSNLEKNLGTVVYGQEEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAF-----ALGVQLLRFDM  540 (798)
Q Consensus       466 ~~l~~l~~~l~~~v~GQ~~ai~~v~~~i~~~~~gl~~~~rP~g~flf~GptGvGKTelak~la~-----~~~~~lir~dm  540 (798)
                      ..+-.|+..|...++||.-|++.|+.+++-..+.= .|.||+ ++=|-|+||+||...++.+|.     |+..++++.  
T Consensus        71 ~~~~~Le~dL~~~lfGQHla~~~Vv~alk~~~~n~-~p~KPL-vLSfHG~tGTGKN~Va~iiA~n~~~~Gl~S~~V~~--  146 (344)
T KOG2170          71 NDLDGLEKDLARALFGQHLAKQLVVNALKSHWANP-NPRKPL-VLSFHGWTGTGKNYVAEIIAENLYRGGLRSPFVHH--  146 (344)
T ss_pred             CCCHHHHHHHHHHHHCHHHHHHHHHHHHHHHHCCC-CCCCCE-EEEECCCCCCCHHHHHHHHHHHHHHCCCCCHHHHH--
T ss_conf             56067899999986320879999999999986289-999875-89830899875648999999998751125626887--


Q ss_pred             HHHHCCCCCCHHCCCCCHHCC-CCC--CCCCCHHHHHCCCEEEEECCHHHCCHHHHHHHHHHHHHHHCCCCCCCEECCCC
Q ss_conf             886124653011047800025-644--43100355515851777404455028999999998777502177997761254
Q gi|254780163|r  541 SEYMERHAVSRLIGAPPGYVG-FGQ--GGILADSVDQNPYSVVLLDEIEKSHPDVLNILLQIMDYGILTDQSGKKISFRN  617 (798)
Q Consensus       541 sey~e~~~vs~LiGappGYvG-~~e--gg~Lte~vr~~P~sVvl~DEiEKAh~~v~~~llqild~G~ltd~~Gr~vdf~n  617 (798)
                             -++.+==+-|-|+- |.+  --++-.-++..+-|+.+|||+||-||.+++.+=.-||.-    ...--+||++
T Consensus       147 -------fvat~hFP~~~~ie~Yk~eL~~~v~~~v~~C~rslFIFDE~DKmp~gLld~lkpfLdyy----p~v~gv~frk  215 (344)
T KOG2170         147 -------FVATLHFPHASKIEDYKEELKNRVRGTVQACQRSLFIFDEVDKLPPGLLDVLKPFLDYY----PQVSGVDFRK  215 (344)
T ss_pred             -------HHHHCCCCCHHHHHHHHHHHHHHHHHHHHHCCCCEEEECHHHHCCHHHHHHHHHHHCCC----CCCCCCCCCC
T ss_conf             -------65541599767899999999999999998557754873105435876999876663046----3213554551


Q ss_pred             EEEEEECCCCHHHHHHC-----CCCCCCCCCH-HHHHHHHH-HHCCH--------HH--HCCCCEEEECCCCCHHHHHHH
Q ss_conf             29999424214553303-----6898821114-88999998-72887--------88--177682896288999999999
Q gi|254780163|r  618 VILIMTTNAGALEMSKA-----RIGFGSSRND-DADKEALR-NFLSP--------EF--LNRLDSIIPFFPLSSDIIRQV  680 (798)
Q Consensus       618 ~iii~TsN~G~~~~~~~-----~~g~~~~~~~-~~~~~~l~-~~f~p--------ef--lnRid~ii~F~~l~~~~~~~i  680 (798)
                      +|+|+-||.|..+|.+-     ..|-..++.. +....++. ..|-+        ++  .|+||..|||-||+..++..-
T Consensus       216 aIFIfLSN~gg~eI~~~aL~~~~~g~~re~~~l~~~E~~L~~~~~n~~~~Gl~~S~li~~~lid~fIPFLPLek~hV~~C  295 (344)
T KOG2170         216 AIFIFLSNAGGSEIARIALENARNGKPREQLRLKSFEPALMQSAFNEKAGGLVHSRLISNNLIDHFIPFLPLEKRHVRSC  295 (344)
T ss_pred             EEEEEECCCCCHHHHHHHHHHHHCCCCCCCCHHHHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHCCCCCCCCHHHHHHH
T ss_conf             48999717861477999999997479756452655269998755354456640142154667765057676238999999


Q ss_pred             HHHHHHHHHHHHHHCCCEEEECHHHHHHHHH
Q ss_conf             9999999999998669889998899999997
Q gi|254780163|r  681 VHKFIMKLELQLQEKGISFHFSEEVINWLVS  711 (798)
Q Consensus       681 ~~~~l~~l~~~l~~~~i~l~~~~~~~~~l~~  711 (798)
                      ++-+|       +.+|  +..+.+.++.+++
T Consensus       296 ~r~el-------~~rg--~~~d~~~~erva~  317 (344)
T KOG2170         296 IRAEL-------RKRG--LAPDQDFVERVAN  317 (344)
T ss_pred             HHHHH-------HHCC--CCCCHHHHHHHHH
T ss_conf             99999-------8654--6552689999998


No 28 
>PRK13341 recombination factor protein RarA/unknown domain fusion protein; Reviewed
Probab=99.69  E-value=6.1e-16  Score=133.73  Aligned_cols=179  Identities=27%  Similarity=0.400  Sum_probs=131.3

Q ss_pred             HHHHHHHHHHHHHHHHHCCCCCCEEEECCCCCHHHHHHHHHHHHHHCCCCCHHHHEEEEEEEEHHHHHCCCCCCCHHHHH
Q ss_conf             22217899999999862267787489667641166899999999854898834520144554046753063431237899
Q gi|254780163|r  205 ILVGRHEEINRTIQILCRRSKNNPLYVGDPGVGKTAIAEGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGDFEER  284 (798)
Q Consensus       205 PVIGRd~EI~riiqIL~RR~KNn~~lvG~~gvGktaive~la~~i~~~~vp~~l~~~~i~~ld~~~l~ag~~~rg~fe~r  284 (798)
                      .++|...=++|+|+   ..+=.|.||-|+||+|||+++.-+|...          +..++.|+  +..+|.       ..
T Consensus        35 hllg~g~~Lrr~i~---~~~~~S~Il~GPPGtGKTTLA~iIA~~t----------~~~F~~ls--Av~sgv-------kd   92 (726)
T PRK13341         35 HILGEGRLLRRAIK---ADRVGSLILYGPPGVGKTTLARIIANHT----------RAHFSSLN--AVLAGV-------KD   92 (726)
T ss_pred             HHCCCCCHHHHHHH---CCCCCEEEEECCCCCCHHHHHHHHHHHH----------CCCEEEEE--CCCCCH-------HH
T ss_conf             54289828999997---6999827888979999999999998874----------88679985--620377-------99


Q ss_pred             HHHHHHHHCC----C-CCEEEEECCHHHHHCCCCCCCCCCCHHHHHHHHHCCCCEEEEEECCHHHHHHHHHCCHHHHHHC
Q ss_conf             9999987203----8-9839997361663015544434477788887663026603887304899999852011143200
Q gi|254780163|r  285 IKKIVKEIES----Y-ANAILYIDEIHTLVGAGSASGISVDASNLLKPALSSGAVRCIGSTTYSEYRQFFEKDKALVRRF  359 (798)
Q Consensus       285 ~~~~~~~~~~----~-~~~ilfideih~ligag~~~g~~~d~an~lkP~L~rg~~~~IgatT~~ey~~~~e~d~al~rrF  359 (798)
                      ++.++++++.    . .+.||||||||-.=   +      .--+.|-|++.+|.|..|||||..-|   |+-++||-.|-
T Consensus        93 lr~ii~~A~~~~~~~g~~tILFIDEIHRfN---K------~QQD~LLp~vE~G~i~LIGATTENP~---F~vn~ALlSR~  160 (726)
T PRK13341         93 LRAEVDAAKERLERHGKRTILFIDEVHRFN---K------AQQDALLPWVENGTVTLIGATTENPY---FEVNKALVSRS  160 (726)
T ss_pred             HHHHHHHHHHHHHHCCCCEEEEEECHHHCC---H------HHHHHHHHHHCCCEEEEEEECCCCCC---EEECHHHHHHC
T ss_conf             999999999998745996599986254258---8------78998788860683899970478974---36429888323


Q ss_pred             EEEEECCCCHHHHHHHHHHHHHHHHH---HCCCEECCHHHHHHHHHHHHHCCCCCCHHHHHHHHHHH
Q ss_conf             14430687868999999861276654---10351211178999998654201555646798899865
Q gi|254780163|r  360 QKIDVSEPSIEDAIEIVKGIKPYFEE---HHQLRYSKEAIRAAVQLSVRHFTSRKLPDKAIDVIDEA  423 (798)
Q Consensus       360 ~~i~v~ep~~~~~~~iL~~~~~~ye~---~h~v~~~~~al~~av~ls~ryi~~r~lPdkAidllDea  423 (798)
                      +.+.++..+.++-..||+..-...|.   .++|.++++|+...+.+|.==      -.+|+..|+-|
T Consensus       161 ~vf~L~~L~~~dl~~il~rAl~d~~~g~~~~~i~i~~~al~~l~~~s~GD------aR~aLN~LEla  221 (726)
T PRK13341        161 RLFRLKSLEDEDLHQLLKRALQDKERGYGDRNIDLEPEAEKHLVDVANGD------ARSLLNALELA  221 (726)
T ss_pred             EEEEECCCCHHHHHHHHHHHHHHHHCCCCCCCCCCCHHHHHHHHHHCCCC------HHHHHHHHHHH
T ss_conf             46674389999999999999876743256678775989999999975973------99999999999


No 29 
>PRK10923 glnG nitrogen regulation protein NR(I); Provisional
Probab=99.68  E-value=6.7e-14  Score=119.04  Aligned_cols=351  Identities=18%  Similarity=0.213  Sum_probs=231.5

Q ss_pred             CCEEEEECCHHHHHCCCCCCCCCCCHHHHHHHHHCCCCEEEEEECCHHHHHHHHHCCHHHHHHCEEE--EECCCCHHHHH
Q ss_conf             9839997361663015544434477788887663026603887304899999852011143200144--30687868999
Q gi|254780163|r  296 ANAILYIDEIHTLVGAGSASGISVDASNLLKPALSSGAVRCIGSTTYSEYRQFFEKDKALVRRFQKI--DVSEPSIEDAI  373 (798)
Q Consensus       296 ~~~ilfideih~ligag~~~g~~~d~an~lkP~L~rg~~~~IgatT~~ey~~~~e~d~al~rrF~~i--~v~ep~~~~~~  373 (798)
                      +.-||+||+=             .+....|.-+|.+...+|+.|.+..+....++..     .|..|  .+.=|.. +-+
T Consensus         3 k~kILiVDDd-------------~~~r~~l~~~L~~~g~~v~~a~~~~~al~~l~~~-----~~dlvl~Di~mP~~-~Gl   63 (469)
T PRK10923          3 RGIVWVVDDD-------------SSIRWVLERALAGAGLTCTTFENGNEVLEALASK-----TPDVLLSDIRMPGM-DGL   63 (469)
T ss_pred             CCEEEEEECC-------------HHHHHHHHHHHHHCCCEEEEECCHHHHHHHHHCC-----CCCEEEECCCCCCC-CHH
T ss_conf             9979999498-------------9999999999987799899989999999998669-----99999878999998-999


Q ss_pred             HHHHHHHHHHHHHCCCEECC----HHHHHHHHH-HHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHH
Q ss_conf             99986127665410351211----178999998-6542015556467988998653333211443221136578999866
Q gi|254780163|r  374 EIVKGIKPYFEEHHQLRYSK----EAIRAAVQL-SVRHFTSRKLPDKAIDVIDEAGASQILQPLSKRRKFITEKDIKKTI  448 (798)
Q Consensus       374 ~iL~~~~~~ye~~h~v~~~~----~al~~av~l-s~ryi~~r~lPdkAidllDea~a~~~~~~~~~~~~~~~~~~i~~~~  448 (798)
                      .+|+.++..+-.-.-|-+|-    +....|.+. +.-|+.-=+-|+.-+..+..|-...+.+     +            
T Consensus        64 ~ll~~lr~~~~~~pvIviT~~~~~~~av~A~~~GA~dyL~KP~~~~~L~~~v~ral~~~~~~-----~------------  126 (469)
T PRK10923         64 ALLKQIKQRHPMLPVIIMTAHSDLDAAVSAYQQGAFDYLPKPFDIDEAVALVERAISHYQEQ-----Q------------  126 (469)
T ss_pred             HHHHHHHHCCCCCCEEEEECCCCHHHHHHHHHCCHHHHCCCCCCHHHHHHHHHHHHHHHHHH-----H------------
T ss_conf             99999984298997899989999899999985570443008899999999999999999998-----6------------


Q ss_pred             HHCCCCCCHHHHHCCHHHHHHHHCCHHHHHHHCHHHHHHHHHHHHHHHHCCCCCCCCCCCEEEEECCCCHHHHHHHHHHH
Q ss_conf             31024531011100112334210000246653458999999999877520445657874068861432003889999987
Q gi|254780163|r  449 ASMNRSIHTTSFSRDDDSVLSNLEKNLGTVVYGQEEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLA  528 (798)
Q Consensus       449 ~~~~~gip~~~~~~~~~~~l~~l~~~l~~~v~GQ~~ai~~v~~~i~~~~~gl~~~~rP~g~flf~GptGvGKTelak~la  528 (798)
                       ... ..+..               .-...+||+..++..+.+.+.+.    ...+.|   .|+.|++|+||..+|+++-
T Consensus       127 -~~~-~~~~~---------------~~~~~liG~S~~m~~v~~~i~~~----a~~~~p---VLI~GE~GTGK~~~Ar~IH  182 (469)
T PRK10923        127 -QPR-NIQVN---------------GPTTDIIGEAPAMQDVFRIIGRL----SRSSIS---VLINGESGTGKELVAHALH  182 (469)
T ss_pred             -HHH-HHHHC---------------CCCCCCEECCHHHHHHHHHHHHH----HCCCCC---EEEECCCCCCHHHHHHHHH
T ss_conf             -544-31210---------------67556546899999999999998----588997---8998989826999999999


Q ss_pred             HHC---CCCEEEEEHHHHHCCCCCCHHCCCCCHH-CCCCC--CCCCCHHHHHCCCEEEEECCHHHCCHHHHHHHHHHHHH
Q ss_conf             304---7733772068861246530110478000-25644--43100355515851777404455028999999998777
Q gi|254780163|r  529 FAL---GVQLLRFDMSEYMERHAVSRLIGAPPGY-VGFGQ--GGILADSVDQNPYSVVLLDEIEKSHPDVLNILLQIMDY  602 (798)
Q Consensus       529 ~~~---~~~lir~dmsey~e~~~vs~LiGappGY-vG~~e--gg~Lte~vr~~P~sVvl~DEiEKAh~~v~~~llqild~  602 (798)
                      ..+   ..+|+.+||+-..+..--+.|.|...|+ .|-.+  -|.    +.+...+.++||||+.-.++++.-||++|++
T Consensus       183 ~~S~r~~~pfi~vnC~~~~~~~~e~eLFG~~~gaf~ga~~~~~g~----~e~a~~GTLfLdeI~~L~~~~Q~kLl~~L~~  258 (469)
T PRK10923        183 RHSPRAKAPFIALNMAAIPKDLIESELFGHEKGAFTGANTIRQGR----FEQADGGTLFLDEIGDMPLDVQTRLLRVLAD  258 (469)
T ss_pred             HCCCCCCCCCEEEECCCCCHHHHHHHHHCCCCCCCCCCCCCCCCC----HHHCCCCCEEHHHHHHCCHHHHHHHHHHHHC
T ss_conf             748877999578767889977899997087667878864245873----6643899265663664899999999999855


Q ss_pred             HHCCCCCCCEECCCCEEEEEECCCCHHHHHHCCCCCCCCCCHHHHHHHHHHHCCHHHHCCCCEE-EECCCCC--HHHHHH
Q ss_conf             5021779977612542999942421455330368988211148899999872887881776828-9628899--999999
Q gi|254780163|r  603 GILTDQSGKKISFRNVILIMTTNAGALEMSKARIGFGSSRNDDADKEALRNFLSPEFLNRLDSI-IPFFPLS--SDIIRQ  679 (798)
Q Consensus       603 G~ltd~~Gr~vdf~n~iii~TsN~G~~~~~~~~~g~~~~~~~~~~~~~l~~~f~peflnRid~i-i~F~~l~--~~~~~~  679 (798)
                      |..+--.|.+---.|+=||.|||..-.                  ...-+..|+++|+.|+..+ |..-||.  .+++..
T Consensus       259 ~~~~~~g~~~~~~~d~RiIaat~~~L~------------------~~v~~g~Fr~dLyyrL~~~~I~lPpLReR~eDI~~  320 (469)
T PRK10923        259 GQFYRVGGYAPVKVDVRIIAATHQNLE------------------QRVQEGKFREDLFHRLNVIRVHLPPLRERREDIPR  320 (469)
T ss_pred             CCEEECCCCCEEEECCEEEEECCCCHH------------------HHHHHCCHHHHHHHHHHHHCCCCCCHHHCHHHHHH
T ss_conf             937857998512214379970787999------------------98660817799998644240158465446534999


Q ss_pred             HHHHHHHHHHHHHHHCCCEEEECHHHHHHHHHCCCCCCCCCHHHHHHHHHHHH
Q ss_conf             99999999999998669889998899999997189810153267999998623
Q gi|254780163|r  680 VVHKFIMKLELQLQEKGISFHFSEEVINWLVSHGYDVKMGARPLERIIKEHVK  732 (798)
Q Consensus       680 i~~~~l~~l~~~l~~~~i~l~~~~~~~~~l~~~~~~~~~GAR~l~r~i~~~i~  732 (798)
                      +++-++.+...+..  .-...+++++...|....+--  -.|.|+.++++-+.
T Consensus       321 L~~~fl~~~~~~~~--~~~~~~s~~a~~~L~~y~WPG--NvrEL~n~ier~~~  369 (469)
T PRK10923        321 LARHFLQVAARELG--VEAKLLHPETEAALTRLAWPG--NVRQLENTCRWLTV  369 (469)
T ss_pred             HHHHHHHHHHHHCC--CCCCCCCHHHHHHHHCCCCCC--HHHHHHHHHHHHHH
T ss_conf             99999999999859--997878999999997499998--79999999999998


No 30 
>TIGR00390 hslU heat shock protein HslVU, ATPase subunit HslU; InterPro: IPR004491   This family of proteins represent HslU, a bacterial clpX homolog, which is an ATPase and chaperone belonging to the AAA Clp/Hsp100 family and a component of the eubacterial proteasome.    ATP-dependent protease complexes are present in all three kingdoms of life, where they rid the cell of misfolded or damaged proteins and control the level of certain regulatory proteins. They include the proteasome in Eukaryotes, Archaea, and Actinomycetales and the HslVU (ClpQY, ClpXP) complex in other eubacteria. Genes homologous to eubacterial HslV, IPR001353 from INTERPRO, (ClpQ,) and HslU (ClpY, ClpX) have also been demonstrated in to be present in the genome of trypanosomatid protozoa. They are expressed as precursors, with a propeptide that is removed to produce the active protease. The protease is probably located in the kinetoplast (mitochondrion). Phylogenetic analysis shows that HslV and HslU from trypanosomatids form a single clad with other eubacterial homologs . ; GO: 0005515 protein binding, 0005524 ATP binding, 0009377 HslUV protease activity, 0016887 ATPase activity, 0005737 cytoplasm, 0009376 HslUV protease complex.
Probab=99.67  E-value=1.9e-15  Score=130.20  Aligned_cols=266  Identities=23%  Similarity=0.352  Sum_probs=183.1

Q ss_pred             HCCHHHHHHHCHHHHHHHHHHHH----HHHHCC--CCCCCCCCCEEEEECCCCHHHHHHHHHHHHHCCCCEEEEEHHHHH
Q ss_conf             00002466534589999999998----775204--456578740688614320038899999873047733772068861
Q gi|254780163|r  471 LEKNLGTVVYGQEEAIKKLSSSI----KIARAG--LSDPNKPIGCYVFSGPTGVGKTEISKQLAFALGVQLLRFDMSEYM  544 (798)
Q Consensus       471 l~~~l~~~v~GQ~~ai~~v~~~i----~~~~~g--l~~~~rP~g~flf~GptGvGKTelak~la~~~~~~lir~dmsey~  544 (798)
                      .-..|-++||||++|-.+|+-|+    +|++..  |++-=-|= ..|..|||||||||.|+.||.-.+-+||.+--+-|+
T Consensus         6 iV~~LD~yIiGQ~~AKk~VAiALrNRyrR~~L~~~L~~EV~PK-NILMiGpTGVGKTEIARRlAKL~~aPFiKVEAtKfT   84 (463)
T TIGR00390         6 IVAELDKYIIGQDEAKKAVAIALRNRYRRSQLEEELKDEVTPK-NILMIGPTGVGKTEIARRLAKLANAPFIKVEATKFT   84 (463)
T ss_pred             HHHHHCCCCCCHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCC-CEEEECCCCCCHHHHHHHHHHHHCCCCEEEEEEEEE
T ss_conf             8875144220636678899999886677612871113565874-304327889854479999999844891466641001


Q ss_pred             CCCCCCHHCCCCCHHCCCCCCCC---CC------------------------HHH-------------HHCCCEEEEECC
Q ss_conf             24653011047800025644431---00------------------------355-------------515851777404
Q gi|254780163|r  545 ERHAVSRLIGAPPGYVGFGQGGI---LA------------------------DSV-------------DQNPYSVVLLDE  584 (798)
Q Consensus       545 e~~~vs~LiGappGYvG~~egg~---Lt------------------------e~v-------------r~~P~sVvl~DE  584 (798)
                      |=           ||||-|=...   |+                        |++             -++||. .+|.+
T Consensus        85 EV-----------GYVGrdVeSmvRDL~~~aV~lV~~e~~~~~r~~aee~~~erI~~~L~pp~~n~sGvknPfe-~f~~~  152 (463)
T TIGR00390        85 EV-----------GYVGRDVESMVRDLVDTAVKLVKEEKIEKVRDRAEEAAEERIVDKLLPPAKNQSGVKNPFE-MFWGS  152 (463)
T ss_pred             EC-----------CEECCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCHH-HEECC
T ss_conf             10-----------2142410036787899999999998899889999999988999872888988776667223-00056


Q ss_pred             HH----HCCHHHHHHHHHHHHH--------HHCCCCCCCEECCCCEE--EEEECCCCHHHH--HH------CCCCCCCCC
Q ss_conf             45----5028999999998777--------50217799776125429--999424214553--30------368988211
Q gi|254780163|r  585 IE----KSHPDVLNILLQIMDY--------GILTDQSGKKISFRNVI--LIMTTNAGALEM--SK------ARIGFGSSR  642 (798)
Q Consensus       585 iE----KAh~~v~~~llqild~--------G~ltd~~Gr~vdf~n~i--ii~TsN~G~~~~--~~------~~~g~~~~~  642 (798)
                      .|    +++.....-+-+=+-+        |.|-|-. =+|+.+...  +-.-++.|...-  ..      ..++-....
T Consensus       153 ~ePN~~~e~~~~~~~~~~klr~r~ahqlalGeLDd~~-iei~v~~~~pf~~~e~~~pp~~e~~~~~l~~~l~~l~~~~kk  231 (463)
T TIGR00390       153 EEPNEKDEEESSREALRKKLRERMAHQLALGELDDKE-IEIEVSAKSPFSGIEILAPPGMEEMTMNLQSLLQNLGPDKKK  231 (463)
T ss_pred             CCCCHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCE-EEEEEECCCCEEEEECCCCCCHHHHHHHHHHHHHHHCCCCCE
T ss_conf             6874024689999999999999877663036646715-899861378712675058885567767899998620453200


Q ss_pred             CHH----------------------HH-HHHHH-----------------------------------------------
Q ss_conf             148----------------------89-99998-----------------------------------------------
Q gi|254780163|r  643 NDD----------------------AD-KEALR-----------------------------------------------  652 (798)
Q Consensus       643 ~~~----------------------~~-~~~l~-----------------------------------------------  652 (798)
                      .++                      .+ ++++.                                               
T Consensus       232 kr~l~ik~A~~~L~~Ee~~kL~d~e~~~~~A~~~vE~~GiiFIDEIDKIa~~~~e~S~~DvSrEGVQRDlLPiVEGS~V~  311 (463)
T TIGR00390       232 KRKLKIKEAKKALIAEEAAKLVDPEEIKQEAIDRVEQSGIIFIDEIDKIAKKGKESSGADVSREGVQRDLLPIVEGSTVN  311 (463)
T ss_pred             ECCCCHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHCCCEEEECCHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCEEE
T ss_conf             01145699999989998873369666438999999847828985303542168886788876556510114202266643


Q ss_pred             ----------------HHC--------CHHHHCCCCEEEECCCCCHHHHHHHHHHHHHHH----HHHHHHCCCEEEECHH
Q ss_conf             ----------------728--------878817768289628899999999999999999----9999866988999889
Q gi|254780163|r  653 ----------------NFL--------SPEFLNRLDSIIPFFPLSSDIIRQVVHKFIMKL----ELQLQEKGISFHFSEE  704 (798)
Q Consensus       653 ----------------~~f--------~peflnRid~ii~F~~l~~~~~~~i~~~~l~~l----~~~l~~~~i~l~~~~~  704 (798)
                                      .-|        =||+=+|+.==|=...||.+++.+|+.--=+.|    .+.|+-.||.|.|+++
T Consensus       312 TKyG~VkTdHiLFIAaGAF~lAKPSDLIPELQGRfPirVEL~~Lt~~d~~rIL~~p~~Sl~kQY~ALl~~eGv~i~F~d~  391 (463)
T TIGR00390       312 TKYGSVKTDHILFIAAGAFHLAKPSDLIPELQGRFPIRVELEALTVDDFERILTEPKNSLIKQYQALLKVEGVNIEFSDE  391 (463)
T ss_pred             EECCEEECCHHHHHHHHHHCCCCCCCCCCHHHCCCCHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHCCCCEEECHH
T ss_conf             10010422157876752320277766663110667377876763299999962083436899999988762764033556


Q ss_pred             HHHHHHHCCC-----CCCCCCHHHHHHHHHHHHHHHHHHHHCCCCCCCCEEEEEEEEC
Q ss_conf             9999997189-----8101532679999986235999999629676888489999607
Q gi|254780163|r  705 VINWLVSHGY-----DVKMGARPLERIIKEHVKVPLADEILFGKLKKGGGVVKVSLNP  757 (798)
Q Consensus       705 ~~~~l~~~~~-----~~~~GAR~l~r~i~~~i~~~la~~il~~~~~~g~~~~~v~~~~  757 (798)
                      |++.||+..|     +...|||-|.-++++.+++     |-| .. ++-+.-+|+++.
T Consensus       392 AI~~iAe~ay~~N~~teniGARRLHTv~E~lled-----isF-ea-~D~~~~~~~I~~  442 (463)
T TIGR00390       392 AIKKIAELAYNVNQKTENIGARRLHTVLERLLED-----ISF-EA-PDVSGQKVTITA  442 (463)
T ss_pred             HHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHHHH-----HCC-CC-CCCCCCEEEECH
T ss_conf             8999999999816442334650466899999987-----512-66-686343245078


No 31 
>PRK11361 acetoacetate metabolism regulatory protein AtoC; Provisional
Probab=99.66  E-value=3e-13  Score=114.41  Aligned_cols=348  Identities=16%  Similarity=0.199  Sum_probs=220.7

Q ss_pred             CEEEEECCHHHHHCCCCCCCCCCCHHHHHHHHHCCCCEEEEEECCHHHHHHHHHCCHHHHHHCEEEEEC--CCCHHHHHH
Q ss_conf             839997361663015544434477788887663026603887304899999852011143200144306--878689999
Q gi|254780163|r  297 NAILYIDEIHTLVGAGSASGISVDASNLLKPALSSGAVRCIGSTTYSEYRQFFEKDKALVRRFQKIDVS--EPSIEDAIE  374 (798)
Q Consensus       297 ~~ilfideih~ligag~~~g~~~d~an~lkP~L~rg~~~~IgatT~~ey~~~~e~d~al~rrF~~i~v~--ep~~~~~~~  374 (798)
                      +-||.||+=             -+....|+-.|.+....+..|.+..|-.+.++..     +|..|-++  =|.. +-+.
T Consensus         5 ~rILIVDDd-------------~~ir~~l~~~L~~~G~~V~~a~~~~~Al~~l~~~-----~~DlvllDi~mP~~-~Gle   65 (457)
T PRK11361          5 NRILIVDDE-------------DNVRRMLSTAFALQGFETHCANNGRTALHLFADI-----HPDVVLMDIRMPEM-DGIK   65 (457)
T ss_pred             CCEEEECCC-------------HHHHHHHHHHHHHCCCEEEEECCHHHHHHHHHCC-----CCCEEEEECCCCCC-CHHH
T ss_conf             928998399-------------9999999999997799899989999999998668-----98999982879999-9999


Q ss_pred             HHHHHHHHHHHHCCCEECC----HHHHHHHHH-HHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHH
Q ss_conf             9986127665410351211----178999998-65420155564679889986533332114432211365789998663
Q gi|254780163|r  375 IVKGIKPYFEEHHQLRYSK----EAIRAAVQL-SVRHFTSRKLPDKAIDVIDEAGASQILQPLSKRRKFITEKDIKKTIA  449 (798)
Q Consensus       375 iL~~~~~~ye~~h~v~~~~----~al~~av~l-s~ryi~~r~lPdkAidllDea~a~~~~~~~~~~~~~~~~~~i~~~~~  449 (798)
                      +|+.++...-.-.-|-+|-    +....|+++ +.-|++-=|-||.-+.++..|-...++..           +    ..
T Consensus        66 ll~~ir~~~p~~pvIvlTa~~~~~~av~A~k~GA~Dyl~KPf~~~~L~~~v~rAl~~~~l~~-----------~----~~  130 (457)
T PRK11361         66 ALKEMRSHETRTPVILMTAYAEVETAVEALRCGAFDYVIKPFDLDELNLIVQRALQLQSMKK-----------E----IR  130 (457)
T ss_pred             HHHHHHHCCCCCCEEEEECCCCHHHHHHHHHCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHH-----------H----HH
T ss_conf             99999820989938999689998999999975966325699999999999999999988777-----------7----76


Q ss_pred             HCCCCCCHHHHHCCHHHHHHHHCC-HHHHHHHCHHHHHHHHHHHHHHHHCCCCCCCCCCCEEEEECCCCHHHHHHHHHHH
Q ss_conf             102453101110011233421000-0246653458999999999877520445657874068861432003889999987
Q gi|254780163|r  450 SMNRSIHTTSFSRDDDSVLSNLEK-NLGTVVYGQEEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLA  528 (798)
Q Consensus       450 ~~~~gip~~~~~~~~~~~l~~l~~-~l~~~v~GQ~~ai~~v~~~i~~~~~gl~~~~rP~g~flf~GptGvGKTelak~la  528 (798)
                      ....                .+.. .-...++|+..++..+.+.+.+.    .+.+.|   .|+.|+||+||.-+|+++-
T Consensus       131 ~l~~----------------~~~~~~~~~~lig~S~~m~~v~~~i~~~----A~s~~~---VLI~GEsGTGKe~~Ar~IH  187 (457)
T PRK11361        131 HLHQ----------------ALSTSWQWGHILTNSPAMMDICKDTAKI----ALSQAS---VLISGESGTGKELIARAIH  187 (457)
T ss_pred             HHHH----------------HHCCCCCCCCCEECCHHHHHHHHHHHHH----HCCCCC---EEEECCCCCCHHHHHHHHH
T ss_conf             6654----------------3201245677454699999999999998----488995---8998899857899999999


Q ss_pred             HHC---CCCEEEEEHHHHHCCCCCCHHCCCCCHHCCCCCCCCCCHHHHH-------CCCEEEEECCHHHCCHHHHHHHHH
Q ss_conf             304---7733772068861246530110478000256444310035551-------585177740445502899999999
Q gi|254780163|r  529 FAL---GVQLLRFDMSEYMERHAVSRLIGAPPGYVGFGQGGILADSVDQ-------NPYSVVLLDEIEKSHPDVLNILLQ  598 (798)
Q Consensus       529 ~~~---~~~lir~dmsey~e~~~vs~LiGappGYvG~~egg~Lte~vr~-------~P~sVvl~DEiEKAh~~v~~~llq  598 (798)
                      ..+   +.+|+.+||+-..+.---|.|.|.-.        |-.|.+...       .-.+-++||||+...++.+.-||.
T Consensus       188 ~~S~r~~~pFv~vnc~ai~~~l~eseLFG~~k--------gaftga~~~~~G~~e~A~gGTLfLdeI~~l~~~~Q~kLLr  259 (457)
T PRK11361        188 YNSRRAKGPFIKVNCAALPESLLESELFGHEK--------GAFTGAQTLRQGLFERANEGTLLLDEIGEMPLVLQAKLLR  259 (457)
T ss_pred             HHCCCCCCCEEEEECCCCCHHHHHHHHHCCCC--------CCCCCCCCCCCCCHHHCCCCCEECCCHHHHHHHHHHHHHH
T ss_conf             83798899838764787985778999718766--------7878853146986133599826314664523999999999


Q ss_pred             HHHHHHCCCCCCCEECCCCEEEEEECCCCHHHHHHCCCCCCCCCCHHHHHHHH-HHHCCHHHHCCCCEEEE-CCCC--CH
Q ss_conf             87775021779977612542999942421455330368988211148899999-87288788177682896-2889--99
Q gi|254780163|r  599 IMDYGILTDQSGKKISFRNVILIMTTNAGALEMSKARIGFGSSRNDDADKEAL-RNFLSPEFLNRLDSIIP-FFPL--SS  674 (798)
Q Consensus       599 ild~G~ltd~~Gr~vdf~n~iii~TsN~G~~~~~~~~~g~~~~~~~~~~~~~l-~~~f~peflnRid~ii~-F~~l--~~  674 (798)
                      +|++|.++--.|.+.--.|+=||.+||.--                   .+.+ +..|+++|+-|+..+-+ .-||  -.
T Consensus       260 ~L~~~~~~~~g~~~~~~~dvRiIaaT~~~L-------------------~~~v~~g~Fr~DLyyrL~~~~i~lPpLReR~  320 (457)
T PRK11361        260 ILQEREFERIGGHQTIKVDIRIIAATNRDL-------------------QAMVKEGTFREDLFYRLNVIHLILPPLRDRR  320 (457)
T ss_pred             HHHCCCEEECCCCCEEEECCEEEECCCCCH-------------------HHHHHCCCCHHHHHHHHCEEEEECCCHHHCH
T ss_conf             986492785699713665348996578785-------------------9998758323889953022125173854587


Q ss_pred             HHHHHHHHHHHHHHHHHHHHCCCEEEECHHHHHHHHHCCCCCCCCCHHHHHHHHHHHH
Q ss_conf             9999999999999999998669889998899999997189810153267999998623
Q gi|254780163|r  675 DIIRQVVHKFIMKLELQLQEKGISFHFSEEVINWLVSHGYDVKMGARPLERIIKEHVK  732 (798)
Q Consensus       675 ~~~~~i~~~~l~~l~~~l~~~~i~l~~~~~~~~~l~~~~~~~~~GAR~l~r~i~~~i~  732 (798)
                      +++..+++-++.+...+...  -...+++++++.|....+--  --|.|+.+|++-+.
T Consensus       321 eDI~~L~~~fl~~~~~~~~~--~~~~~s~~a~~~L~~y~WPG--NvREL~n~ierav~  374 (457)
T PRK11361        321 EDISLLANHFLQKFSSENQR--DIIDIDPMAMSLLTAWSWPG--NIRELSNVIERAVV  374 (457)
T ss_pred             HHHHHHHHHHHHHHHHHCCC--CCCCCCHHHHHHHHCCCCCC--HHHHHHHHHHHHHH
T ss_conf             54999999999999997499--98988999999995699997--99999999999998


No 32 
>COG1220 HslU ATP-dependent protease HslVU (ClpYQ), ATPase subunit [Posttranslational modification, protein turnover, chaperones]
Probab=99.65  E-value=1.6e-14  Score=123.49  Aligned_cols=268  Identities=23%  Similarity=0.386  Sum_probs=150.1

Q ss_pred             HCCHHHHHHHCHHHHHHHHHHHH----HHHHC--CCCCCCCCCCEEEEECCCCHHHHHHHHHHHHHCCCCEEEEEHHHHH
Q ss_conf             00002466534589999999998----77520--4456578740688614320038899999873047733772068861
Q gi|254780163|r  471 LEKNLGTVVYGQEEAIKKLSSSI----KIARA--GLSDPNKPIGCYVFSGPTGVGKTEISKQLAFALGVQLLRFDMSEYM  544 (798)
Q Consensus       471 l~~~l~~~v~GQ~~ai~~v~~~i----~~~~~--gl~~~~rP~g~flf~GptGvGKTelak~la~~~~~~lir~dmsey~  544 (798)
                      +-..|.+.||||++|-.+|+-|+    +|.+.  -|++.--|- ..|..|||||||||.|+.||.-.+-+||.+.-+-|+
T Consensus         9 IV~eLd~yIIGQ~~AKkaVAIALRNR~RR~qL~~~lr~EV~PK-NILMIGpTGVGKTEIARRLAkl~~aPFiKVEATKfT   87 (444)
T COG1220           9 IVSELDRYIIGQDEAKKAVAIALRNRWRRMQLEEELRDEVTPK-NILMIGPTGVGKTEIARRLAKLAGAPFIKVEATKFT   87 (444)
T ss_pred             HHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHCCHHHHHCCCCC-CEEEECCCCCCHHHHHHHHHHHHCCCEEEEEEEEEE
T ss_conf             9999876740717778899999998999975478776225755-358888888768899999999848983788764213


Q ss_pred             CCCCCCHHCCCCCHHCCCCCCCC---CCH------------HHHHC--------------CCE--EEEECCHHHCCHHHH
Q ss_conf             24653011047800025644431---003------------55515--------------851--777404455028999
Q gi|254780163|r  545 ERHAVSRLIGAPPGYVGFGQGGI---LAD------------SVDQN--------------PYS--VVLLDEIEKSHPDVL  593 (798)
Q Consensus       545 e~~~vs~LiGappGYvG~~egg~---Lte------------~vr~~--------------P~s--Vvl~DEiEKAh~~v~  593 (798)
                      |-           ||||-|-...   |++            .|+.+              |-+  -.=+++=+.+.+...
T Consensus        88 EV-----------GYVGrDVesivRDLve~av~lvke~~~~~vk~~ae~~aeeRild~Lvp~~~~~~g~~~~~~~~~~~r  156 (444)
T COG1220          88 EV-----------GYVGRDVESIIRDLVEIAVKLVREEKIEKVKDKAEELAEERILDALVPPAKNFWGQSENKQESSATR  156 (444)
T ss_pred             EC-----------CCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCHHHH
T ss_conf             40-----------3256458999999999999999999999999999999999999986698755466673000026799


Q ss_pred             HHHHHHHHHHHCCCCCCCEECCCCE----EEEEECCCCHHHHHH------CCCCCCCCCCH-------------------
Q ss_conf             9999987775021779977612542----999942421455330------36898821114-------------------
Q gi|254780163|r  594 NILLQIMDYGILTDQSGKKISFRNV----ILIMTTNAGALEMSK------ARIGFGSSRND-------------------  644 (798)
Q Consensus       594 ~~llqild~G~ltd~~Gr~vdf~n~----iii~TsN~G~~~~~~------~~~g~~~~~~~-------------------  644 (798)
                      .-|-+-|.+|.|-|.. -.++...+    +=||+- -|..++..      +.++-+.....                   
T Consensus       157 ~~~rkkLr~GeLdd~e-Ieiev~~~~~~~~~i~~~-pgme~~~~~l~~m~~~~~~~kkkkrk~~Vk~A~~~L~~eea~KL  234 (444)
T COG1220         157 EKFRKKLREGELDDKE-IEIEVADKGPPGFEIMGP-PGMEEMTNNLQDMFGNLGGKKKKKRKLKVKEAKKLLIEEEADKL  234 (444)
T ss_pred             HHHHHHHHCCCCCCCE-EEEEEECCCCCCCCCCCC-CCHHHHHHHHHHHHHHHCCCCCEEEEEEHHHHHHHHHHHHHHHH
T ss_conf             9999999758877617-999972267875346899-85789999999999864688730366569999998777788762


Q ss_pred             ----HHHHHHH---------------------------------H-----------------------------------
Q ss_conf             ----8899999---------------------------------8-----------------------------------
Q gi|254780163|r  645 ----DADKEAL---------------------------------R-----------------------------------  652 (798)
Q Consensus       645 ----~~~~~~l---------------------------------~-----------------------------------  652 (798)
                          +...+++                                 +                                   
T Consensus       235 id~e~i~~eAi~~aE~~GIvFIDEIDKIa~~~~~g~~dvSREGVQRDlLPlvEGstV~TKyG~VkTdHILFIasGAFh~s  314 (444)
T COG1220         235 IDQEEIKQEAIDAAEQNGIVFIDEIDKIAKRGGSGGPDVSREGVQRDLLPLVEGSTVSTKYGPVKTDHILFIASGAFHVA  314 (444)
T ss_pred             CCHHHHHHHHHHHHHHCCEEEEEHHHHHHHCCCCCCCCCCHHHHCCCCCCCCCCCEEECCCCCCCCCEEEEEECCCEECC
T ss_conf             69999999999998856908973466787437889988664320102103105754431544401443788714820037


Q ss_pred             --HHCCHHHHCCCCEEEECCCCCHHHHHHHHHHHHHH----HHHHHHHCCCEEEECHHHHHHHHHCCCC-----CCCCCH
Q ss_conf             --72887881776828962889999999999999999----9999986698899988999999971898-----101532
Q gi|254780163|r  653 --NFLSPEFLNRLDSIIPFFPLSSDIIRQVVHKFIMK----LELQLQEKGISFHFSEEVINWLVSHGYD-----VKMGAR  721 (798)
Q Consensus       653 --~~f~peflnRid~ii~F~~l~~~~~~~i~~~~l~~----l~~~l~~~~i~l~~~~~~~~~l~~~~~~-----~~~GAR  721 (798)
                        .-+-||+-+|+.--|-..+|+.+++.+|+.--=..    ....+.-.|+.|.|++++++.|++-.|.     ...|||
T Consensus       315 KPSDLiPELQGRfPIRVEL~~Lt~~Df~rILtep~~sLikQY~aLlkTE~v~l~FtddaI~~iAeiA~~vN~~~ENIGAR  394 (444)
T COG1220         315 KPSDLIPELQGRFPIRVELDALTKEDFERILTEPKASLIKQYKALLKTEGVELEFTDDAIKRIAEIAYQVNEKTENIGAR  394 (444)
T ss_pred             CHHHCCHHHCCCCCEEEECCCCCHHHHHHHHCCCHHHHHHHHHHHHHHCCEEEEECHHHHHHHHHHHHHHCCCCCCHHHH
T ss_conf             81321766627773488704489989999963760789999999973158348853799999999999855430001178


Q ss_pred             HHHHHHHHHHHHHHHHHHHCCCCCCCCEEEEEEEEC
Q ss_conf             679999986235999999629676888489999607
Q gi|254780163|r  722 PLERIIKEHVKVPLADEILFGKLKKGGGVVKVSLNP  757 (798)
Q Consensus       722 ~l~r~i~~~i~~~la~~il~~~~~~g~~~~~v~~~~  757 (798)
                      .|.-++++.+++     |-|..-..++..+.|+-.+
T Consensus       395 RLhTvlErlLed-----iSFeA~d~~g~~v~Id~~y  425 (444)
T COG1220         395 RLHTVLERLLED-----ISFEAPDMSGQKVTIDAEY  425 (444)
T ss_pred             HHHHHHHHHHHH-----HCCCCCCCCCCEEEECHHH
T ss_conf             899999999987-----0705877899758975899


No 33 
>KOG2004 consensus
Probab=99.65  E-value=2.5e-14  Score=122.09  Aligned_cols=297  Identities=23%  Similarity=0.389  Sum_probs=209.7

Q ss_pred             HHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHCCCCCCHHHHHCCHHHHHHHHCCHHHHHHH
Q ss_conf             98654201555646798899865333321144322113657899986631024531011100112334210000246653
Q gi|254780163|r  401 QLSVRHFTSRKLPDKAIDVIDEAGASQILQPLSKRRKFITEKDIKKTIASMNRSIHTTSFSRDDDSVLSNLEKNLGTVVY  480 (798)
Q Consensus       401 ~ls~ryi~~r~lPdkAidllDea~a~~~~~~~~~~~~~~~~~~i~~~~~~~~~gip~~~~~~~~~~~l~~l~~~l~~~v~  480 (798)
                      .+-.|-.+ -.+||-+.+++|+--.+  ++.+.   ..-.+=+|-...-.|-|-+|-.+.+.+ +-.|......|.+--+
T Consensus       342 ~~~er~~~-~~~P~~v~kv~~eEl~k--L~~le---~~~sEfnvtrNYLdwlt~LPWgk~S~E-n~dl~~Ak~iLdeDHY  414 (906)
T KOG2004         342 KFRERIKS-LKMPDHVLKVIDEELTK--LKLLE---PSSSEFNVTRNYLDWLTSLPWGKSSTE-NLDLARAKEILDEDHY  414 (906)
T ss_pred             HHHHHHHH-CCCCHHHHHHHHHHHHH--HHCCC---CCCCCHHHHHHHHHHHHHCCCCCCCHH-HHHHHHHHHHHCCCCC
T ss_conf             99988621-12769999999999998--74257---556404389899999984887878735-3037989876346530


Q ss_pred             CHHHHHHHHHHHHHHHHCCCCCC-CCCCCEEEEECCCCHHHHHHHHHHHHHCCCCEEEEEHHHHHCCCCCCHHCCCCCHH
Q ss_conf             45899999999987752044565-78740688614320038899999873047733772068861246530110478000
Q gi|254780163|r  481 GQEEAIKKLSSSIKIARAGLSDP-NKPIGCYVFSGPTGVGKTEISKQLAFALGVQLLRFDMSEYMERHAVSRLIGAPPGY  559 (798)
Q Consensus       481 GQ~~ai~~v~~~i~~~~~gl~~~-~rP~g~flf~GptGvGKTelak~la~~~~~~lir~dmsey~e~~~vs~LiGappGY  559 (798)
                      |-++.-+.|.+-|-..+  |+.. .-|  .+.|+||+|||||-.||..|..++..+.||-..-..+   ++-.-|----|
T Consensus       415 gm~dVKeRILEfiAV~k--Lrgs~qGk--IlCf~GPPGVGKTSI~kSIA~ALnRkFfRfSvGG~tD---vAeIkGHRRTY  487 (906)
T KOG2004         415 GMEDVKERILEFIAVGK--LRGSVQGK--ILCFVGPPGVGKTSIAKSIARALNRKFFRFSVGGMTD---VAEIKGHRRTY  487 (906)
T ss_pred             CHHHHHHHHHHHHHHHH--HCCCCCCC--EEEEECCCCCCCCCHHHHHHHHHCCCEEEEECCCCCC---HHHHCCCCEEE
T ss_conf             16889999999999875--14667883--7998689987732189999998487469985366342---77642542110


Q ss_pred             CCCCCCCCCCHHHHH--CCCEEEEECCHHHCC----HHHHHHHHHHHHH---HHCCCCC-CCEECCCCEEEEEECCCCHH
Q ss_conf             256444310035551--585177740445502----8999999998777---5021779-97761254299994242145
Q gi|254780163|r  560 VGFGQGGILADSVDQ--NPYSVVLLDEIEKSH----PDVLNILLQIMDY---GILTDQS-GKKISFRNVILIMTTNAGAL  629 (798)
Q Consensus       560 vG~~egg~Lte~vr~--~P~sVvl~DEiEKAh----~~v~~~llqild~---G~ltd~~-Gr~vdf~n~iii~TsN~G~~  629 (798)
                      ||.= .|.+.+++++  .-+-|+|+|||+|--    -|=-..||.+||-   ....|.. .-.+|.+..++|+|.|.=  
T Consensus       488 VGAM-PGkiIq~LK~v~t~NPliLiDEvDKlG~g~qGDPasALLElLDPEQNanFlDHYLdVp~DLSkVLFicTAN~i--  564 (906)
T KOG2004         488 VGAM-PGKIIQCLKKVKTENPLILIDEVDKLGSGHQGDPASALLELLDPEQNANFLDHYLDVPVDLSKVLFICTANVI--  564 (906)
T ss_pred             ECCC-CHHHHHHHHHHCCCCCEEEEEHHHHHCCCCCCCHHHHHHHHCCHHHCCCHHHHCCCCCCCHHHEEEEEECCCC--
T ss_conf             0148-8489999986177886588532234178877986899987439653553454202664211106889853644--


Q ss_pred             HHHHCCCCCCCCCCHHHHHHHHHHHCCHHHHCCCCEEEECCCCCHHHHHHHHHHHHHHHHHHHHHCCC---EEEECHHHH
Q ss_conf             53303689882111488999998728878817768289628899999999999999999999986698---899988999
Q gi|254780163|r  630 EMSKARIGFGSSRNDDADKEALRNFLSPEFLNRLDSIIPFFPLSSDIIRQVVHKFIMKLELQLQEKGI---SFHFSEEVI  706 (798)
Q Consensus       630 ~~~~~~~g~~~~~~~~~~~~~l~~~f~peflnRid~ii~F~~l~~~~~~~i~~~~l~~l~~~l~~~~i---~l~~~~~~~  706 (798)
                                             ...+|.++.|+ ++|-.--...++-.+|+..+|-.  +.+...|+   ++.++++++
T Consensus       565 -----------------------dtIP~pLlDRM-EvIelsGYv~eEKv~IA~~yLip--~a~~~~gl~~e~v~is~~al  618 (906)
T KOG2004         565 -----------------------DTIPPPLLDRM-EVIELSGYVAEEKVKIAERYLIP--QALKDCGLKPEQVKISDDAL  618 (906)
T ss_pred             -----------------------CCCCHHHHHHH-HEEECCCCCHHHHHHHHHHHHHH--HHHHHCCCCHHHCCCCHHHH
T ss_conf             -----------------------56985664122-32203672279899999984125--78987499878658629999


Q ss_pred             HHHHHCCCCCCCCCHHHHHHHHHHHHHHHHHHHHCC
Q ss_conf             999971898101532679999986235999999629
Q gi|254780163|r  707 NWLVSHGYDVKMGARPLERIIKEHVKVPLADEILFG  742 (798)
Q Consensus       707 ~~l~~~~~~~~~GAR~l~r~i~~~i~~~la~~il~~  742 (798)
                      .-|.+ -|-.+.|-|+|+|-|++-. ...|-.+..+
T Consensus       619 ~~lI~-~YcrEaGVRnLqk~iekI~-Rk~Al~vv~~  652 (906)
T KOG2004         619 LALIE-RYCREAGVRNLQKQIEKIC-RKVALKVVEG  652 (906)
T ss_pred             HHHHH-HHHHHHHHHHHHHHHHHHH-HHHHHHHHHH
T ss_conf             99999-9988876778999999999-9999999986


No 34 
>PRK10365 transcriptional regulatory protein ZraR; Provisional
Probab=99.62  E-value=1.4e-12  Score=109.57  Aligned_cols=349  Identities=17%  Similarity=0.193  Sum_probs=220.6

Q ss_pred             CEEEEECCHHHHHCCCCCCCCCCCHHHHHHHHHCCCCEEEEEECCHHHHHHHHHCCHHHHHHCEEEE--ECCCCHHHHHH
Q ss_conf             8399973616630155444344777888876630266038873048999998520111432001443--06878689999
Q gi|254780163|r  297 NAILYIDEIHTLVGAGSASGISVDASNLLKPALSSGAVRCIGSTTYSEYRQFFEKDKALVRRFQKID--VSEPSIEDAIE  374 (798)
Q Consensus       297 ~~ilfideih~ligag~~~g~~~d~an~lkP~L~rg~~~~IgatT~~ey~~~~e~d~al~rrF~~i~--v~ep~~~~~~~  374 (798)
                      --||.||+=             -+...+|+-.|.+-..+|..|++.++-.+.+...     .|..|-  +.=|.. +-+.
T Consensus         6 ~~ILIVDDd-------------~~~~~~l~~~L~~~G~~v~~a~~~~~al~~l~~~-----~~DlvllD~~mp~~-~Gl~   66 (441)
T PRK10365          6 IDILVVDDD-------------ISHCTILQALLRGWGYNVALANSGRQALEQVREQ-----VFDLVLCDVRMAEM-DGIA   66 (441)
T ss_pred             CEEEEECCC-------------HHHHHHHHHHHHHCCCEEEEECCHHHHHHHHHCC-----CCCEEEECCCCCCC-CHHH
T ss_conf             859998398-------------9999999999997799899989999999998648-----99999988999999-8999


Q ss_pred             HHHHHHHHHHHHCCCEECC----HHHHHHHHH-HHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHH
Q ss_conf             9986127665410351211----178999998-65420155564679889986533332114432211365789998663
Q gi|254780163|r  375 IVKGIKPYFEEHHQLRYSK----EAIRAAVQL-SVRHFTSRKLPDKAIDVIDEAGASQILQPLSKRRKFITEKDIKKTIA  449 (798)
Q Consensus       375 iL~~~~~~ye~~h~v~~~~----~al~~av~l-s~ryi~~r~lPdkAidllDea~a~~~~~~~~~~~~~~~~~~i~~~~~  449 (798)
                      +|+.++..+-.-.=|-+|-    +....|+++ +.-|+.-=+-|++-...++.|.+..+..              .    
T Consensus        67 lL~~l~~~~p~~pvIviT~~~~~~~av~A~k~GA~Dyl~KP~~~~~L~~~i~~al~~~~~~--------------~----  128 (441)
T PRK10365         67 TLKEIKALNPAIPVLIMTAYSSVETAVEALKTGALDYLIKPLDFDNLQATLEKALAHTHSI--------------D----  128 (441)
T ss_pred             HHHHHHHHCCCCCEEEEECCCCHHHHHHHHHHCCCEEEECCCCHHHHHHHHHHHHHHHHHH--------------H----
T ss_conf             9999984298982899969999899999998285123407888999999999999999876--------------5----


Q ss_pred             HCCCCCCHHHHHCCHHHHHHHHCCHHHHHHHCHHHHHHHHHHHHHHHHCCCCCCCCCCCEEEEECCCCHHHHHHHHHHHH
Q ss_conf             10245310111001123342100002466534589999999998775204456578740688614320038899999873
Q gi|254780163|r  450 SMNRSIHTTSFSRDDDSVLSNLEKNLGTVVYGQEEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAF  529 (798)
Q Consensus       450 ~~~~gip~~~~~~~~~~~l~~l~~~l~~~v~GQ~~ai~~v~~~i~~~~~gl~~~~rP~g~flf~GptGvGKTelak~la~  529 (798)
                      .   ..+..              ......+||+..|+..+.+.+.+.    .+.+.|   .|+.|.||+||.-+|+++-.
T Consensus       129 ~---~~~~~--------------~~~~~~liG~S~am~~v~~~i~~~----A~s~~p---VLI~GE~GTGK~~~Ar~IH~  184 (441)
T PRK10365        129 A---ETPAV--------------SASQFGMVGKSPAMQHLLSEIALV----APSEAT---VLIHGDSGTGKELVARAIHA  184 (441)
T ss_pred             H---CCHHC--------------CCCCCCCEECCHHHHHHHHHHHHH----HCCCCC---EEEECCCCHHHHHHHHHHHH
T ss_conf             2---00001--------------222578666899999999999998----488994---89989998109999999996


Q ss_pred             HC---CCCEEEEEHHHHHCCCCCCHHCCCCCHH-CCCC--CCCCCCHHHHHCCCEEEEECCHHHCCHHHHHHHHHHHHHH
Q ss_conf             04---7733772068861246530110478000-2564--4431003555158517774044550289999999987775
Q gi|254780163|r  530 AL---GVQLLRFDMSEYMERHAVSRLIGAPPGY-VGFG--QGGILADSVDQNPYSVVLLDEIEKSHPDVLNILLQIMDYG  603 (798)
Q Consensus       530 ~~---~~~lir~dmsey~e~~~vs~LiGappGY-vG~~--egg~Lte~vr~~P~sVvl~DEiEKAh~~v~~~llqild~G  603 (798)
                      .+   +.+|+.+||+...+..--|.|.|.-.|. -|-+  .-|.+    .....+.++||||+.-.++++.-||.++++|
T Consensus       185 ~S~r~~~pfv~vnC~~l~~~l~eseLFG~~~gaftga~~~~~g~~----~~A~gGTLfLdeI~~l~~~~Q~kLl~~l~~~  260 (441)
T PRK10365        185 SSARSEKPLVTLNCAALNESLLESELFGHEKGAFTGADKRREGRF----VEADGGTLFLDEIGDISPMMQVRLLRAIQER  260 (441)
T ss_pred             CCCCCCCCCEEEECCCCCHHHHHHHHCCCCCCCCCCCCCCCCCCE----EECCCCEECCCCCCCCCHHHHHHHHHHHHHH
T ss_conf             578778980798789898455589861775568789653468987----7889982550231529999999999877752


Q ss_pred             HCCCCCCCEECCCCEEEEEECCCCHHHHHHCCCCCCCCCCHHHHHHHHHHHCCHHHHCCCCEE-EECCCCC--HHHHHHH
Q ss_conf             021779977612542999942421455330368988211148899999872887881776828-9628899--9999999
Q gi|254780163|r  604 ILTDQSGKKISFRNVILIMTTNAGALEMSKARIGFGSSRNDDADKEALRNFLSPEFLNRLDSI-IPFFPLS--SDIIRQV  680 (798)
Q Consensus       604 ~ltd~~Gr~vdf~n~iii~TsN~G~~~~~~~~~g~~~~~~~~~~~~~l~~~f~peflnRid~i-i~F~~l~--~~~~~~i  680 (798)
                      .++--.|...--.|+=||.+||.--.                  ...-...|+++++-|+..+ |..-||.  .+++..+
T Consensus       261 ~~~~~g~~~~~~~d~RiIaat~~~l~------------------~~v~~g~Fr~dLy~rL~~~~i~lPpLReR~eDI~~L  322 (441)
T PRK10365        261 EVQRVGSNQTISVDVRLIAATHRDLA------------------AEVNAGRFRQDLYYRLNVVAIEVPSLRQRREDIPLL  322 (441)
T ss_pred             HHCCCCCCCEEECCCEEEECCCCCHH------------------HHHHCCCCHHHHHHHHCCHHCCCCCCCCCCCHHHHH
T ss_conf             10005887344136379983788999------------------998819825899988601113782600062009999


Q ss_pred             HHHHHHHHHHHHHHCCCEEEECHHHHHHHHHCCCCCCCCCHHHHHHHHHHHH
Q ss_conf             9999999999998669889998899999997189810153267999998623
Q gi|254780163|r  681 VHKFIMKLELQLQEKGISFHFSEEVINWLVSHGYDVKMGARPLERIIKEHVK  732 (798)
Q Consensus       681 ~~~~l~~l~~~l~~~~i~l~~~~~~~~~l~~~~~~~~~GAR~l~r~i~~~i~  732 (798)
                      ++.++.++..+...  -...+++++.+.|....+--  --|.|+.+|++-+.
T Consensus       323 ~~~fl~~~~~~~~~--~~~~~s~~a~~~L~~y~WPG--NvREL~n~iera~~  370 (441)
T PRK10365        323 AGHFLQRFAERNRK--AVKGFTPQAMDLLIHYDWPG--NIRELENAVERAVV  370 (441)
T ss_pred             HHHHHHHHHHHCCC--CCCCCCHHHHHHHHCCCCCC--HHHHHHHHHHHHHH
T ss_conf             99999999998499--98888999999997099998--99999999999999


No 35 
>pfam10431 ClpB_D2-small C-terminal, D2-small domain, of ClpB protein. This is the C-terminal domain of ClpB protein, referred to as the D2-small domain, and is a mixed alpha-beta structure. Compared with the D1-small domain (included in AAA, pfam00004) it lacks the long coiled-coil insertion, and instead of helix C4 contains a beta-strand (e3) that is part of a three stranded beta-pleated sheet. In Thermophilus the whole protein forms a hexamer with the D1-small and D2-small domains located on the outside of the hexamer, with the long coiled-coil being exposed on the surface. The D2-small domain is essential for oligomerisation, forming a tight interface with the D2-large domain of a neighbouring subunit and thereby providing enough binding energy to stabilize the functional assembly. The domain is associated with two Clp_N, pfam02861, at the N-terminus as well as AAA, pfam00004 and AAA_2, pfam07724.
Probab=99.62  E-value=8.9e-15  Score=125.36  Aligned_cols=85  Identities=40%  Similarity=0.762  Sum_probs=79.9

Q ss_pred             CCHHHHHHHHHHHHHHHHHHHHHCCCEEEECHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHHHHHHHHHCCCCCCCCEEE
Q ss_conf             99999999999999999999986698899988999999971898101532679999986235999999629676888489
Q gi|254780163|r  672 LSSDIIRQVVHKFIMKLELQLQEKGISFHFSEEVINWLVSHGYDVKMGARPLERIIKEHVKVPLADEILFGKLKKGGGVV  751 (798)
Q Consensus       672 l~~~~~~~i~~~~l~~l~~~l~~~~i~l~~~~~~~~~l~~~~~~~~~GAR~l~r~i~~~i~~~la~~il~~~~~~g~~~~  751 (798)
                      |+.+++.+|++++|.++.+|+..++|.+.+++++++||+++||+++||||||+|+|+++|++|||+.+|++.+.+|++ +
T Consensus         1 L~~~~l~~Iv~~~l~~l~~rl~~~~i~l~~~~~~~~~i~~~~~~~~~GAR~l~r~I~~~i~~~la~~il~~~~~~~~~-i   79 (89)
T pfam10431         1 LSKEELRQIVDLQLKRLQKRLAERGITLELTDAAKDWLAEKGYDPEYGARPLRRAIQREIEDPLAEEILSGELKEGDT-V   79 (89)
T ss_pred             CCHHHHHHHHHHHHHHHHHHHHHCCEEEEECHHHHHHHHHHCCCCCCCCHHHHHHHHHHHHHHHHHHHHCCCCCCCCE-E
T ss_conf             988999999999999999999978907998689999999835675679478999999999999999998498999799-9


Q ss_pred             EEEEEC
Q ss_conf             999607
Q gi|254780163|r  752 KVSLNP  757 (798)
Q Consensus       752 ~v~~~~  757 (798)
                      .|++..
T Consensus        80 ~i~~~~   85 (89)
T pfam10431        80 RVDVDD   85 (89)
T ss_pred             EEEECC
T ss_conf             997158


No 36 
>CHL00181 cbbX CbbX; Provisional
Probab=99.61  E-value=7.1e-13  Score=111.66  Aligned_cols=186  Identities=20%  Similarity=0.332  Sum_probs=140.0

Q ss_pred             CEEEECCCCCHHHHHHHHHHHHHHCCCCCHHHHEEEEEEEEHHHHHCCCCCCCHHHHHHHHHHHHHCCCCCEEEEECCHH
Q ss_conf             74896676411668999999998548988345201445540467530634312378999999987203898399973616
Q gi|254780163|r  227 NPLYVGDPGVGKTAIAEGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIESYANAILYIDEIH  306 (798)
Q Consensus       227 n~~lvG~~gvGktaive~la~~i~~~~vp~~l~~~~i~~ld~~~l~ag~~~rg~fe~r~~~~~~~~~~~~~~ilfideih  306 (798)
                      |-++.|+||+|||+++.-+|+-...-.   .|..-.+++.+-+.|+++  |.|+-+.+.+.+++.+.  | =||||||.|
T Consensus        61 h~vF~GnPGTGKTTVARl~a~il~~lG---~L~~g~vve~~r~dLvg~--yvG~Ta~kt~~~i~~a~--G-GVLfIDEAY  132 (287)
T CHL00181         61 HMSFTGSPGTGKTTVALKMADILYRLG---YIKKGHLITVTRDDLVGQ--YIGHTAPKTKEVLKKAM--G-GVLFIDEAY  132 (287)
T ss_pred             EEEEECCCCCCHHHHHHHHHHHHHHCC---CCCCCEEEEECHHHHCCC--CCCCCHHHHHHHHHHCC--C-CEEEEECHH
T ss_conf             388878998679999999999999869---955895899535884163--53521699999999645--9-879982446


Q ss_pred             HHHCCCCCCCCCCCHHHHHHHHHC--CCCEEEEEECCHHHHHHHHHCCHHHHHHCEE-EEECCCCHHHHHHHHHHHHHHH
Q ss_conf             630155444344777888876630--2660388730489999985201114320014-4306878689999998612766
Q gi|254780163|r  307 TLVGAGSASGISVDASNLLKPALS--SGAVRCIGSTTYSEYRQFFEKDKALVRRFQK-IDVSEPSIEDAIEIVKGIKPYF  383 (798)
Q Consensus       307 ~ligag~~~g~~~d~an~lkP~L~--rg~~~~IgatT~~ey~~~~e~d~al~rrF~~-i~v~ep~~~~~~~iL~~~~~~y  383 (798)
                      +|...++..+-+..|-+.|-.++.  |+++-||.|--++|-.++++.+|.|.+||.. +..+.-|.++-.+|++..    
T Consensus       133 ~L~~~~~~~dfg~eaidtLl~~me~~~~~lvvI~AGY~~eM~~fl~~NpGL~sRf~~~i~F~dYt~~EL~~I~~~~----  208 (287)
T CHL00181        133 YLYKPDNERDYGAEAIEILLQVMENQRDDLVVIFAGYKDRMDKFYESNPGLSSRVANHVDFPDYTPEELLQIAKMM----  208 (287)
T ss_pred             HHCCCCCCCCCHHHHHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHCCCHHHHCCCEEECCCCCHHHHHHHHHHH----
T ss_conf             5357889998379999999999870799889998467899999998590478768872377985999999999999----


Q ss_pred             HHHCCCEECCHHHHHHHHHHHHHCCCCCC-HHHHHH-HHHHHH
Q ss_conf             54103512111789999986542015556-467988-998653
Q gi|254780163|r  384 EEHHQLRYSKEAIRAAVQLSVRHFTSRKL-PDKAID-VIDEAG  424 (798)
Q Consensus       384 e~~h~v~~~~~al~~av~ls~ryi~~r~l-PdkAid-llDea~  424 (798)
                      -..++..++++|.....+.-.+......| -..++. +++.+.
T Consensus       209 ~~~~~~~l~~~a~~~l~~~~~~~~~~~~FGNaR~vrnl~e~a~  251 (287)
T CHL00181        209 LEEQQYQLTPEAEKVLLDYIKRRMEQPLFANARSVRNAIDRAR  251 (287)
T ss_pred             HHHCCCCCCHHHHHHHHHHHHHHCCCCCCCCHHHHHHHHHHHH
T ss_conf             9986982587999999999998508999874899999999999


No 37 
>PRK03992 proteasome-activating nucleotidase; Provisional
Probab=99.60  E-value=3.7e-13  Score=113.67  Aligned_cols=217  Identities=23%  Similarity=0.340  Sum_probs=142.3

Q ss_pred             HHHHHHHHHHHHHHHHHH-------------CCCCCCEEEECCCCCHHHHHHHHHHHHHHCCCCCHHHHEEEEEEEEHHH
Q ss_conf             122217899999999862-------------2677874896676411668999999998548988345201445540467
Q gi|254780163|r  204 DILVGRHEEINRTIQILC-------------RRSKNNPLYVGDPGVGKTAIAEGFAKQIVDGMVPDILLGARIFSLDMGN  270 (798)
Q Consensus       204 DPVIGRd~EI~riiqIL~-------------RR~KNn~~lvG~~gvGktaive~la~~i~~~~vp~~l~~~~i~~ld~~~  270 (798)
                      +-|-|=|+.++.+-+..-             =+--..++|.|+||.|||-++..+|..          .+..++.++.+.
T Consensus       132 ~dIGGl~~~k~el~E~velPl~~pe~f~~~Gi~pPkGvLLyGPPGtGKTllAkAvA~e----------~~~~fi~v~~s~  201 (390)
T PRK03992        132 EDIGGLDEQIREVREAVELPLKNPELFEEVGIEPPKGVLLYGPPGTGKTLLAKAVAHE----------TNATFIRVVGSE  201 (390)
T ss_pred             HHHCCHHHHHHHHHHHHHHHHHCHHHHHHCCCCCCCEEEEECCCCCCHHHHHHHHHHH----------HCCCEEEEEHHH
T ss_conf             6614989999999999999865989999769999972786898999789999999987----------488879966799


Q ss_pred             HHCCCCCCCHHHHHHHHHHHHHCCCCCEEEEECCHHHHHCCCCCCCCCCC--HHHHHHHHH-------CCCCEEEEEECC
Q ss_conf             53063431237899999998720389839997361663015544434477--788887663-------026603887304
Q gi|254780163|r  271 LIAGTRYRGDFEERIKKIVKEIESYANAILYIDEIHTLVGAGSASGISVD--ASNLLKPAL-------SSGAVRCIGSTT  341 (798)
Q Consensus       271 l~ag~~~rg~fe~r~~~~~~~~~~~~~~ilfideih~ligag~~~g~~~d--~an~lkP~L-------~rg~~~~IgatT  341 (798)
                      ++.  +|-||-|..++.+++.+++..+.|+|||||..|-+.-..++++.|  +.+++-..|       .++.+.+||||.
T Consensus       202 l~s--k~vGesek~vr~lF~~Ar~~aP~IiFiDEiDai~~~R~~~~~~g~~ev~r~l~qLL~emDG~~~~~~V~VIaATN  279 (390)
T PRK03992        202 LVQ--KFIGEGARLVRELFELAREKAPSIIFIDEIDAIAAKRTDSGTSGDREVQRTLMQLLAEMDGFDPRGNVKIIAATN  279 (390)
T ss_pred             HHH--CCCCHHHHHHHHHHHHHHHHCCCEEEHHHHHHHHCCCCCCCCCCCHHHHHHHHHHHHHCCCCCCCCCEEEEEECC
T ss_conf             752--454179999999999999709908971432566335677888620889999999999744877778827996069


Q ss_pred             HHHHHHHHHCCHHHHH--HCE-EEEECCCCHHHHHHHHHHHHHHHHHHCCCEECCH-HHHHHHHHHHHHCCCCCCHHHHH
Q ss_conf             8999998520111432--001-4430687868999999861276654103512111-78999998654201555646798
Q gi|254780163|r  342 YSEYRQFFEKDKALVR--RFQ-KIDVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKE-AIRAAVQLSVRHFTSRKLPDKAI  417 (798)
Q Consensus       342 ~~ey~~~~e~d~al~r--rF~-~i~v~ep~~~~~~~iL~~~~~~ye~~h~v~~~~~-al~~av~ls~ryi~~r~lPdkAi  417 (798)
                      --+     .-|+||-|  ||. .|.|+-|+.++-..||+-...      ++...++ -+...++.+.-|-      +.-|
T Consensus       280 rpd-----~LDpAllRpGRFDr~I~iplPd~~~R~~Ilki~~~------~~~l~~dvdl~~lA~~T~G~S------GADI  342 (390)
T PRK03992        280 RPD-----ILDPALLRPGRFDRIIEVPLPDEEGRLEILKIHTR------KMNLADDVDLEELAELTEGAS------GADL  342 (390)
T ss_pred             CCH-----HCCHHHHCCCCCCEEEEECCCCHHHHHHHHHHHHC------CCCCCCCCCHHHHHHHCCCCC------HHHH
T ss_conf             810-----05977754776523887089499999999999847------999998889999997687998------9999


Q ss_pred             HHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHCC
Q ss_conf             89986533332114432211365789998663102
Q gi|254780163|r  418 DVIDEAGASQILQPLSKRRKFITEKDIKKTIASMN  452 (798)
Q Consensus       418 dllDea~a~~~~~~~~~~~~~~~~~~i~~~~~~~~  452 (798)
                      .   ..|-.+.+.+..+.+..|+.+|....+.+..
T Consensus       343 ~---~lc~EA~m~Air~~r~~i~~~Df~~Ai~kv~  374 (390)
T PRK03992        343 K---AICTEAGMFAIRDDRTEVTMEDFLKAIEKVM  374 (390)
T ss_pred             H---HHHHHHHHHHHHCCCCCCCHHHHHHHHHHHH
T ss_conf             9---9999999999985898608999999999996


No 38 
>CHL00195 ycf46 Ycf46; Provisional
Probab=99.60  E-value=1.9e-12  Score=108.61  Aligned_cols=210  Identities=22%  Similarity=0.289  Sum_probs=136.9

Q ss_pred             CEEEECCCCCHHHHHHHHHHHHHHCCCCCHHHHEEEEEEEEHHHHHCCCCCCCHHHHHHHHHHHHHCCCCCEEEEECCHH
Q ss_conf             74896676411668999999998548988345201445540467530634312378999999987203898399973616
Q gi|254780163|r  227 NPLYVGDPGVGKTAIAEGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIESYANAILYIDEIH  306 (798)
Q Consensus       227 n~~lvG~~gvGktaive~la~~i~~~~vp~~l~~~~i~~ld~~~l~ag~~~rg~fe~r~~~~~~~~~~~~~~ilfideih  306 (798)
                      .++|+|+||.|||-++..+|..          -+..++.+|++.+..  +|.||-|.+++.++..+++..+.|||||||-
T Consensus       261 GvLL~GpPG~GKtl~AKAvA~e----------~~~p~l~l~~~~l~~--~~vGesE~~~r~~f~~A~~~aP~ilfiDEid  328 (491)
T CHL00195        261 GLLLVGIQGTGKSLTAKAIANE----------WNLPLLRLDVGKLFG--GIVGESESRMRQMIQLAETISPCILWIDEID  328 (491)
T ss_pred             EEEEECCCCCCHHHHHHHHHHH----------HCCCEEEEEHHHHHH--HHCCHHHHHHHHHHHHHHHHCCEEEEEEHHH
T ss_conf             7999799998789999999866----------389469966799756--0067049999999999986198589974654


Q ss_pred             HHHCCCCCCCCC-CC--HHHHHHHHHC-C-CCEEEEEECCHHHHHHHHHCCHHHHH--HCE-EEEECCCCHHHHHHHHHH
Q ss_conf             630155444344-77--7888876630-2-66038873048999998520111432--001-443068786899999986
Q gi|254780163|r  307 TLVGAGSASGIS-VD--ASNLLKPALS-S-GAVRCIGSTTYSEYRQFFEKDKALVR--RFQ-KIDVSEPSIEDAIEIVKG  378 (798)
Q Consensus       307 ~ligag~~~g~~-~d--~an~lkP~L~-r-g~~~~IgatT~~ey~~~~e~d~al~r--rF~-~i~v~ep~~~~~~~iL~~  378 (798)
                      ..++.+.++|.+ ..  +-+-|--.|. + ..+-+||+|.-     .-.-|++|.|  ||. .+.|+-|+.++-..|++-
T Consensus       329 k~~~~~~~~~d~g~s~rv~~~~Lt~m~e~~~~VfViattN~-----~~~L~pellR~GRFD~~~~v~lP~~~~R~~I~~i  403 (491)
T CHL00195        329 KAFSGLDSKGDSGTSNRVLATFITWLSEKKSPVFVVATANN-----IDSLPLELLRKGRFDEIFFLDLPNLEERELIFKI  403 (491)
T ss_pred             HHCCCCCCCCCCCHHHHHHHHHHHHHCCCCCCEEEEEECCC-----CCCCCHHHCCCCCCCEEEECCCCCHHHHHHHHHH
T ss_conf             54258888888723289999999986468997699995899-----7558987708987770476489598999999999


Q ss_pred             HHHHHHHHCCCEECCHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHCCCCCCHH
Q ss_conf             12766541035121117899999865420155564679889986533332114432211365789998663102453101
Q gi|254780163|r  379 IKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLPDKAIDVIDEAGASQILQPLSKRRKFITEKDIKKTIASMNRSIHTT  458 (798)
Q Consensus       379 ~~~~ye~~h~v~~~~~al~~av~ls~ryi~~r~lPdkAidllDea~a~~~~~~~~~~~~~~~~~~i~~~~~~~~~gip~~  458 (798)
                      .-.++   ......+--+...++.+.-|--      .-|   ..+|-.+...+..+. ..++.+|+...+.+   -+|++
T Consensus       404 hl~~~---~~~~~~~~d~~~la~~t~gfsG------AeI---e~~v~~A~~~A~~~~-r~~~~~dl~~a~~~---~~Pls  467 (491)
T CHL00195        404 HLKRF---RPNSWQNYDIEILSQLTNKFSG------AEI---EQSIIEAMHHAFSEK-REFTTEDICLALKQ---LIPLA  467 (491)
T ss_pred             HHHCC---CCCCCCCCCHHHHHHHCCCCCH------HHH---HHHHHHHHHHHHHCC-CCCCHHHHHHHHHH---CCCHH
T ss_conf             98544---7887554699999976859888------999---999999999998758-86658999999981---78813


Q ss_pred             HHHCCHHHHHH
Q ss_conf             11001123342
Q gi|254780163|r  459 SFSRDDDSVLS  469 (798)
Q Consensus       459 ~~~~~~~~~l~  469 (798)
                      ....+.-+.+.
T Consensus       468 ~t~~e~i~~lr  478 (491)
T CHL00195        468 QTDKEQIEALQ  478 (491)
T ss_pred             HCCHHHHHHHH
T ss_conf             32899999999


No 39 
>pfam05496 RuvB_N Holliday junction DNA helicase ruvB N-terminus. The RuvB protein makes up part of the RuvABC revolvasome which catalyses the resolution of Holliday junctions that arise during genetic recombination and DNA repair. Branch migration is catalysed by the RuvB protein that is targeted to the Holliday junction by the structure specific RuvA protein. This family contains the N-terminal region of the protein.
Probab=99.58  E-value=1.2e-13  Score=117.13  Aligned_cols=198  Identities=21%  Similarity=0.272  Sum_probs=121.7

Q ss_pred             HHHHHCHHHHHHHHHHHHHHHHCCCCCCCCCCCEEEEECCCCHHHHHHHHHHHHHCCCCEEEEEHHHHHCCCCCCHHCCC
Q ss_conf             46653458999999999877520445657874068861432003889999987304773377206886124653011047
Q gi|254780163|r  476 GTVVYGQEEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFALGVQLLRFDMSEYMERHAVSRLIGA  555 (798)
Q Consensus       476 ~~~v~GQ~~ai~~v~~~i~~~~~gl~~~~rP~g~flf~GptGvGKTelak~la~~~~~~lir~dmsey~e~~~vs~LiGa  555 (798)
                      -..+|||++.+..+..+|..+    ...+.++.++||.||+|||||-+|+.+|..++.++....-....           
T Consensus        23 l~e~vGQehl~~~l~~~i~a~----~~~~~~l~h~lf~GPPG~GKTTlAriiAk~~~~~~~~~s~~~i~-----------   87 (234)
T pfam05496        23 LDEYIGQEKVKENLKIFIEAA----KKRGEALDHVLLYGPPGLGKTTLANIIANEMGVNIRITSGPALE-----------   87 (234)
T ss_pred             HHHCCCHHHHHHHHHHHHHHH----HHCCCCCCEEEEECCCCCCHHHHHHHHHHHHCCCEEEECCHHHH-----------
T ss_conf             666069499999999999988----74277766278878999988899999998408753761426664-----------


Q ss_pred             CCHHCCCCCCCCCCHHH-HHCCCEEEEECCHHHCCHHHHHHHHHHHHHHHCC-----CCCCCEECCCCEEEEEECCCCHH
Q ss_conf             80002564443100355-5158517774044550289999999987775021-----77997761254299994242145
Q gi|254780163|r  556 PPGYVGFGQGGILADSV-DQNPYSVVLLDEIEKSHPDVLNILLQIMDYGILT-----DQSGKKISFRNVILIMTTNAGAL  629 (798)
Q Consensus       556 ppGYvG~~egg~Lte~v-r~~P~sVvl~DEiEKAh~~v~~~llqild~G~lt-----d~~Gr~vdf~n~iii~TsN~G~~  629 (798)
                              .-+-+...+ ..+...|++.|||+--.+..+++||..+++|++-     +..-+++.+.+--+++   +||.
T Consensus        88 --------~~~di~~~l~~~~~~~ILFIDEIHr~nK~qqd~Llp~vE~g~i~i~ig~~~~A~~~~~e~P~FtL---IgAT  156 (234)
T pfam05496        88 --------KPGDLAAILTNLEPGDVLFIDEIHRLNRAVEEILYPAMEDFRLDIVIGKGPSARSIRLDLPPFTL---VGAT  156 (234)
T ss_pred             --------HHHHHHHHHHHCCCCCEEEEECHHHCCHHHHHHCCCCCCCCEEEEEECCCCCCEEEECCCCCEEE---EEEC
T ss_conf             --------38999999984589988999665435876887445533461699996367663246526897599---8521


Q ss_pred             HHHHCCCCCCCCCCHHHHHHHHHHHCCHHHHCCCCEEEECCCCCHHHHHHHHHHHHHHHHHHHHHCCCEEEECHHHHHHH
Q ss_conf             53303689882111488999998728878817768289628899999999999999999999986698899988999999
Q gi|254780163|r  630 EMSKARIGFGSSRNDDADKEALRNFLSPEFLNRLDSIIPFFPLSSDIIRQVVHKFIMKLELQLQEKGISFHFSEEVINWL  709 (798)
Q Consensus       630 ~~~~~~~g~~~~~~~~~~~~~l~~~f~peflnRid~ii~F~~l~~~~~~~i~~~~l~~l~~~l~~~~i~l~~~~~~~~~l  709 (798)
                                .+          ...+++.|+.|+.-+.-|+||+.+++.+|+..-+..       .+  +.++++++++|
T Consensus       157 ----------Te----------~~~l~~pl~sR~~i~~~l~~l~~edl~~il~r~~~~-------l~--i~i~~eal~~I  207 (234)
T pfam05496       157 ----------TR----------AGLLTSPLRDRFGIVLRLEFYSVEELEEIVKRSARI-------LG--VEIDEEGAAEI  207 (234)
T ss_pred             ----------CC----------CCCCCHHHHHHHHHEEECCCCCHHHHHHHHHHHHHH-------CC--CCCCHHHHHHH
T ss_conf             ----------56----------664777799762112442468999999999999998-------39--99599999999


Q ss_pred             HHCCCCCCCCCHHHHHHHHHHH
Q ss_conf             9718981015326799999862
Q gi|254780163|r  710 VSHGYDVKMGARPLERIIKEHV  731 (798)
Q Consensus       710 ~~~~~~~~~GAR~l~r~i~~~i  731 (798)
                      +..+-   -.||..-+.+++-.
T Consensus       208 A~~s~---Gd~R~ALnlLe~v~  226 (234)
T pfam05496       208 ARRSR---GTPRIANRLLRRVR  226 (234)
T ss_pred             HHHCC---CCHHHHHHHHHHHH
T ss_conf             99779---98999989999999


No 40 
>pfam07728 AAA_5 AAA domain (dynein-related subfamily). This Pfam entry includes some of the AAA proteins not detected by the pfam00004 model.
Probab=99.57  E-value=5.4e-15  Score=126.93  Aligned_cols=112  Identities=29%  Similarity=0.479  Sum_probs=87.5

Q ss_pred             EEEECCCCHHHHHHHHHHHHHC-CCCEEEEEHHHHHCCCCCCHHCCCC---CHHCCCCCCCCCCHHHHHCCCEEEEECCH
Q ss_conf             8861432003889999987304-7733772068861246530110478---00025644431003555158517774044
Q gi|254780163|r  510 YVFSGPTGVGKTEISKQLAFAL-GVQLLRFDMSEYMERHAVSRLIGAP---PGYVGFGQGGILADSVDQNPYSVVLLDEI  585 (798)
Q Consensus       510 flf~GptGvGKTelak~la~~~-~~~lir~dmsey~e~~~vs~LiGap---pGYvG~~egg~Lte~vr~~P~sVvl~DEi  585 (798)
                      .||.||+|+|||.+|+.+|..+ ..++.++.+++.+++   +.|+|..   +|...|. .|.|+.+++..  .|++||||
T Consensus         2 vll~Gp~G~GKT~la~~la~~l~~~~~~~i~~~~~~~~---~dl~G~~~~~~~~~~~~-~g~l~~a~~~g--~vl~lDEi   75 (139)
T pfam07728         2 VLLVGPPGTGKSELAERLAAALSNRPVFYVQLTRDTTE---EDLKGRRNIANGTTSWV-DGPLVRAAREG--EIAVLDEI   75 (139)
T ss_pred             EEEECCCCCHHHHHHHHHHHHCCCCCCHHHCCCCCCCH---HHCCCCEECCCCCEEEE-CCHHHCCCCCC--CEEEECCH
T ss_conf             89998997569999999999807983111214655652---22057342379935781-55141010128--68996343


Q ss_pred             HHCCHHHHHHHHHHHHHHHCCC-CCCCEECC------CCEEEEEECCCC
Q ss_conf             5502899999999877750217-79977612------542999942421
Q gi|254780163|r  586 EKSHPDVLNILLQIMDYGILTD-QSGKKISF------RNVILIMTTNAG  627 (798)
Q Consensus       586 EKAh~~v~~~llqild~G~ltd-~~Gr~vdf------~n~iii~TsN~G  627 (798)
                      ++|||+|++.|+++||+++++- ..|+.+..      .|..+|.|+|-+
T Consensus        76 n~a~~~v~~~L~~~le~~~~~~~~~~~~~~~~~~~~~~~f~viaT~N~~  124 (139)
T pfam07728        76 NRANPDVLNSLLSLLDERRLLLPEGGELVKVAPDDFAKRFRLIATMNPL  124 (139)
T ss_pred             HHCCHHHHHHHHHHHCCCEEEECCCCEEECCCCCCCCCCEEEEEEECCC
T ss_conf             4489999999999974896983689727336666789996999975896


No 41 
>pfam05496 RuvB_N Holliday junction DNA helicase ruvB N-terminus. The RuvB protein makes up part of the RuvABC revolvasome which catalyses the resolution of Holliday junctions that arise during genetic recombination and DNA repair. Branch migration is catalysed by the RuvB protein that is targeted to the Holliday junction by the structure specific RuvA protein. This family contains the N-terminal region of the protein.
Probab=99.54  E-value=1.9e-13  Score=115.77  Aligned_cols=187  Identities=22%  Similarity=0.314  Sum_probs=120.0

Q ss_pred             HCCCCHHHHHHHHHHHHHHHHHHC--CCCC----CEEEECCCCCHHHHHHHHHHHHHHCCCCCHHHHEEEEEEEEHHHHH
Q ss_conf             548611222178999999998622--6778----7489667641166899999999854898834520144554046753
Q gi|254780163|r  199 KKGKVDILVGRHEEINRTIQILCR--RSKN----NPLYVGDPGVGKTAIAEGFAKQIVDGMVPDILLGARIFSLDMGNLI  272 (798)
Q Consensus       199 reGKLDPVIGRd~EI~riiqIL~R--R~KN----n~~lvG~~gvGktaive~la~~i~~~~vp~~l~~~~i~~ld~~~l~  272 (798)
                      |=-.+|-+||-+.=+. ...++.+  +.+|    +.++-|+||+|||+++.-+|...-          ..+..++...+ 
T Consensus        19 RP~~l~e~vGQehl~~-~l~~~i~a~~~~~~~l~h~lf~GPPG~GKTTlAriiAk~~~----------~~~~~~s~~~i-   86 (234)
T pfam05496        19 RPRRLDEYIGQEKVKE-NLKIFIEAAKKRGEALDHVLLYGPPGLGKTTLANIIANEMG----------VNIRITSGPAL-   86 (234)
T ss_pred             CCCCHHHCCCHHHHHH-HHHHHHHHHHHCCCCCCEEEEECCCCCCHHHHHHHHHHHHC----------CCEEEECCHHH-
T ss_conf             9897666069499999-99999998874277766278878999988899999998408----------75376142666-


Q ss_pred             CCCCCCCHHHHHHHHHHHHHCCCCCEEEEECCHHHHHCCCCCCCCCCCHHHHHHHHHCCCCE------------------
Q ss_conf             06343123789999999872038983999736166301554443447778888766302660------------------
Q gi|254780163|r  273 AGTRYRGDFEERIKKIVKEIESYANAILYIDEIHTLVGAGSASGISVDASNLLKPALSSGAV------------------  334 (798)
Q Consensus       273 ag~~~rg~fe~r~~~~~~~~~~~~~~ilfideih~ligag~~~g~~~d~an~lkP~L~rg~~------------------  334 (798)
                      .+.       .-+..++..+.  .+.||||||||.+         +-..-+.|.|++..|.+                  
T Consensus        87 ~~~-------~di~~~l~~~~--~~~ILFIDEIHr~---------nK~qqd~Llp~vE~g~i~i~ig~~~~A~~~~~e~P  148 (234)
T pfam05496        87 EKP-------GDLAAILTNLE--PGDVLFIDEIHRL---------NRAVEEILYPAMEDFRLDIVIGKGPSARSIRLDLP  148 (234)
T ss_pred             HHH-------HHHHHHHHHCC--CCCEEEEECHHHC---------CHHHHHHCCCCCCCCEEEEEECCCCCCEEEECCCC
T ss_conf             438-------99999998458--9988999665435---------87688744553346169999636766324652689


Q ss_pred             --EEEEECCHHHHHHHHHCCHHHHHHCEEEE-ECCCCHHHHHHHHHHHHHHHHHHCCCEECCHHHHHHHHHHHHHCCCCC
Q ss_conf             --38873048999998520111432001443-068786899999986127665410351211178999998654201555
Q gi|254780163|r  335 --RCIGSTTYSEYRQFFEKDKALVRRFQKID-VSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRK  411 (798)
Q Consensus       335 --~~IgatT~~ey~~~~e~d~al~rrF~~i~-v~ep~~~~~~~iL~~~~~~ye~~h~v~~~~~al~~av~ls~ryi~~r~  411 (798)
                        ..|||||..  .   .-.++|-.||..+. .+.-+.++-.+||+...    ...++.++++|+...++.|.=      
T Consensus       149 ~FtLIgATTe~--~---~l~~pl~sR~~i~~~l~~l~~edl~~il~r~~----~~l~i~i~~eal~~IA~~s~G------  213 (234)
T pfam05496       149 PFTLVGATTRA--G---LLTSPLRDRFGIVLRLEFYSVEELEEIVKRSA----RILGVEIDEEGAAEIARRSRG------  213 (234)
T ss_pred             CEEEEEECCCC--C---CCCHHHHHHHHHEEECCCCCHHHHHHHHHHHH----HHCCCCCCHHHHHHHHHHCCC------
T ss_conf             75998521566--6---47777997621124424689999999999999----983999599999999997799------


Q ss_pred             CHHHHHHHHHHHHHHHHHH
Q ss_conf             6467988998653333211
Q gi|254780163|r  412 LPDKAIDVIDEAGASQILQ  430 (798)
Q Consensus       412 lPdkAidllDea~a~~~~~  430 (798)
                      =|..|+.+|+.+.+.+.++
T Consensus       214 d~R~ALnlLe~v~d~a~~~  232 (234)
T pfam05496       214 TPRIANRLLRRVRDFAQVK  232 (234)
T ss_pred             CHHHHHHHHHHHHHHHHHH
T ss_conf             8999989999999999873


No 42 
>COG2256 MGS1 ATPase related to the helicase subunit of the Holliday junction resolvase [DNA replication, recombination, and repair]
Probab=99.54  E-value=1.5e-13  Score=116.48  Aligned_cols=238  Identities=24%  Similarity=0.371  Sum_probs=152.4

Q ss_pred             HHHHHHCCCCHHHH------HHHHHHHHHHHHHHCCCCCCEEEECCCCCHHHHHHHHHHHHHHCCCCCHHHHEEEEEEEE
Q ss_conf             58877548611222------178999999998622677874896676411668999999998548988345201445540
Q gi|254780163|r  194 LTEKVKKGKVDILV------GRHEEINRTIQILCRRSKNNPLYVGDPGVGKTAIAEGFAKQIVDGMVPDILLGARIFSLD  267 (798)
Q Consensus       194 LTe~AreGKLDPVI------GRd~EI~riiqIL~RR~KNn~~lvG~~gvGktaive~la~~i~~~~vp~~l~~~~i~~ld  267 (798)
                      |.+.-|-..||-||      |-+.-|+|+++-   .+=.+-||-|+||||||+|++-+|+..          +..+..++
T Consensus        14 LA~rmRP~~lde~vGQ~HLlg~~~~lrr~v~~---~~l~SmIl~GPPG~GKTTlA~liA~~~----------~~~f~~~s   80 (436)
T COG2256          14 LAERLRPKSLDEVVGQEHLLGEGKPLRRAVEA---GHLHSMILWGPPGTGKTTLARLIAGTT----------NAAFEALS   80 (436)
T ss_pred             HHHHHCCCCHHHHCCHHHHHCCCCHHHHHHHC---CCCCEEEEECCCCCCHHHHHHHHHHHH----------CCCEEEEC
T ss_conf             67770977787855718661899438999964---998605777899988889999998761----------77669951


Q ss_pred             HHHHHCCCCCCCHHHHHHHHHHHHHCCC-C---CEEEEECCHHHHHCCCCCCCCCCCHHHHHHHHHCCCCEEEEEECCHH
Q ss_conf             4675306343123789999999872038-9---83999736166301554443447778888766302660388730489
Q gi|254780163|r  268 MGNLIAGTRYRGDFEERIKKIVKEIESY-A---NAILYIDEIHTLVGAGSASGISVDASNLLKPALSSGAVRCIGSTTYS  343 (798)
Q Consensus       268 ~~~l~ag~~~rg~fe~r~~~~~~~~~~~-~---~~ilfideih~ligag~~~g~~~d~an~lkP~L~rg~~~~IgatT~~  343 (798)
                        +..+|-       ..++.++++.++. .   ..||||||||-+=   ++.   -|   .|.|.+.+|.|..|||||..
T Consensus        81 --Av~~gv-------kdlr~i~e~a~~~~~~gr~tiLflDEIHRfn---K~Q---QD---~lLp~vE~G~iilIGATTEN  142 (436)
T COG2256          81 --AVTSGV-------KDLREIIEEARKNRLLGRRTILFLDEIHRFN---KAQ---QD---ALLPHVENGTIILIGATTEN  142 (436)
T ss_pred             --CCCCCH-------HHHHHHHHHHHHHHHCCCCEEEEEEHHHHCC---HHH---HH---HHHHHHCCCEEEEEECCCCC
T ss_conf             --523467-------9999999999998725883499872253337---445---65---51033248868999626789


Q ss_pred             HHHHHHHCCHHHHHHCEEEEECCCCHHHHHHHHHH-HHHHHHHHC--CCEECCHHHHHHHHHHHHHCCCCCCHHHHHHHH
Q ss_conf             99998520111432001443068786899999986-127665410--351211178999998654201555646798899
Q gi|254780163|r  344 EYRQFFEKDKALVRRFQKIDVSEPSIEDAIEIVKG-IKPYFEEHH--QLRYSKEAIRAAVQLSVRHFTSRKLPDKAIDVI  420 (798)
Q Consensus       344 ey~~~~e~d~al~rrF~~i~v~ep~~~~~~~iL~~-~~~~ye~~h--~v~~~~~al~~av~ls~ryi~~r~lPdkAidll  420 (798)
                      -|   |+-++||-.|-+....+..+.++-.+.|+. +...-...-  .+.++++|+...+.+|.-=      -.+|..+|
T Consensus       143 Ps---F~ln~ALlSR~~vf~lk~L~~~di~~~l~ra~~~~~rgl~~~~~~i~~~a~~~l~~~s~GD------~R~aLN~L  213 (436)
T COG2256         143 PS---FELNPALLSRARVFELKPLSSEDIKKLLKRALLDEERGLGGQIIVLDEEALDYLVRLSNGD------ARRALNLL  213 (436)
T ss_pred             CC---EEECHHHHHHHHEEEEECCCHHHHHHHHHHHHHHHHCCCCCCCCCCCHHHHHHHHHHCCCH------HHHHHHHH
T ss_conf             87---1403888611041565169989999999999865413777655668889999999862861------99998899


Q ss_pred             HHHHHHHHHHHHHHHHCCCCHHHHHHHHHHCCCCCCHHHHHCCHHHHHHHHCCHHHHHHHCHH
Q ss_conf             865333321144322113657899986631024531011100112334210000246653458
Q gi|254780163|r  421 DEAGASQILQPLSKRRKFITEKDIKKTIASMNRSIHTTSFSRDDDSVLSNLEKNLGTVVYGQE  483 (798)
Q Consensus       421 Dea~a~~~~~~~~~~~~~~~~~~i~~~~~~~~~gip~~~~~~~~~~~l~~l~~~l~~~v~GQ~  483 (798)
                      +.+.-..      +.....+.+++.+++.+..   +  ...++ .+.--++-.-|++.|=|-|
T Consensus       214 E~~~~~~------~~~~~~~~~~l~~~l~~~~---~--~~Dk~-gD~hYdliSA~hKSvRGSD  264 (436)
T COG2256         214 ELAALSA------EPDEVLILELLEEILQRRS---A--RFDKD-GDAHYDLISALHKSVRGSD  264 (436)
T ss_pred             HHHHHHC------CCCCCCCHHHHHHHHHHHH---H--CCCCC-CCHHHHHHHHHHHHHCCCC
T ss_conf             9999862------7775247999999986552---0--56777-6347899999998612688


No 43 
>CHL00176 ftsH cell division protein; Validated
Probab=99.53  E-value=1e-12  Score=110.54  Aligned_cols=223  Identities=23%  Similarity=0.388  Sum_probs=148.1

Q ss_pred             CCHHHHHHHHH---HHHHHHHHHCCC---------CCCEEEECCCCCHHHHHHHHHHHHHHCCCCCHHHHEEEEEEEEHH
Q ss_conf             61122217899---999999862267---------787489667641166899999999854898834520144554046
Q gi|254780163|r  202 KVDILVGRHEE---INRTIQILCRRS---------KNNPLYVGDPGVGKTAIAEGFAKQIVDGMVPDILLGARIFSLDMG  269 (798)
Q Consensus       202 KLDPVIGRd~E---I~riiqIL~RR~---------KNn~~lvG~~gvGktaive~la~~i~~~~vp~~l~~~~i~~ld~~  269 (798)
                      .++-|.|-|+.   ++.+++-|---.         -.-++|+|+||.|||-++..+|-   +       .+..+|+++.+
T Consensus       175 tF~DVaG~~eaK~el~EivdfLk~P~k~~~~Gak~PkGvLL~GpPGTGKTlLAkAvAg---E-------a~vpF~~~sgs  244 (631)
T CHL00176        175 TFNDVAGVEEAKEELEEVVTFLKKPERFTAVGAKIPKGVLLVGPPGTGKTLLAKAIAG---E-------AEVPFFSISGS  244 (631)
T ss_pred             CCCCCCCCHHHHHHHHHHHHHHCCHHHHHHCCCCCCCEEEEECCCCCCHHHHHHHHHC---C-------CCCCEEEEEHH
T ss_conf             7532288589999999999983595887644996896589889899878899999856---5-------58846998837


Q ss_pred             HHHCCCCCCCHHHHHHHHHHHHHCCCCCEEEEECCHHHHH---CCCCCCCCCCCHHHHHHHHH-------CCCCEEEEEE
Q ss_conf             7530634312378999999987203898399973616630---15544434477788887663-------0266038873
Q gi|254780163|r  270 NLIAGTRYRGDFEERIKKIVKEIESYANAILYIDEIHTLV---GAGSASGISVDASNLLKPAL-------SSGAVRCIGS  339 (798)
Q Consensus       270 ~l~ag~~~rg~fe~r~~~~~~~~~~~~~~ilfideih~li---gag~~~g~~~d~an~lkP~L-------~rg~~~~Iga  339 (798)
                      .++.  .|.|.=..|++.+.+.+++..+.|+|||||..+=   |+|.++| ...-.+.|-..|       .+..+-+|||
T Consensus       245 ~F~e--~~vGvga~rVR~LF~~Ar~~aP~IiFIDEiDaig~~Rg~~~~gg-~~e~e~tlnqLL~emDGf~~~~gViViaA  321 (631)
T CHL00176        245 EFVE--MFVGVGAARVRDLFKKAKENSPCIVFIDEIDAVGRQRGAGVGGG-NDEREQTLNQLLTEMDGFEGNKGVIVIAA  321 (631)
T ss_pred             HHHH--HHCCHHHHHHHHHHHHHHHCCCEEEEEEEEEEEEECCCCCCCCC-CCHHHHHHHHHHHHHCCCCCCCCEEEEEE
T ss_conf             8556--42155589999999999863996999871012011478988898-50899999999998428887888699982


Q ss_pred             CCHHHHHHHHHCCHHHHH--HCEE-EEECCCCHHHHHHHHHHHHHHHHHHCCCEECCHH-HHHHHHHHHHHCCCCCCHHH
Q ss_conf             048999998520111432--0014-4306878689999998612766541035121117-89999986542015556467
Q gi|254780163|r  340 TTYSEYRQFFEKDKALVR--RFQK-IDVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEA-IRAAVQLSVRHFTSRKLPDK  415 (798)
Q Consensus       340 tT~~ey~~~~e~d~al~r--rF~~-i~v~ep~~~~~~~iL~~~~~~ye~~h~v~~~~~a-l~~av~ls~ryi~~r~lPdk  415 (798)
                      |...+     --|+||-|  ||.+ |.|+-|+.+.-..||+--..      ++.+.+++ +...++.+.     -|-+.-
T Consensus       322 TNrpd-----~LDpALlRPGRFDR~I~V~lPD~~gR~~IL~vh~k------~~~l~~dvdl~~iA~~T~-----GfSGAd  385 (631)
T CHL00176        322 TNRID-----ILDAALLRPGRFDRQVTVSLPDFEGRLDILKVHAR------NKKLAEDVSLELIARRTP-----GFSGAD  385 (631)
T ss_pred             CCCCC-----CCCHHHCCCCCCCEEEEECCCCHHHHHHHHHHHHH------CCCCCCCHHHHHHHHHCC-----CCCHHH
T ss_conf             58855-----45686626887754998269898999999999970------786665300999986269-----986788


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHCCCCCCH
Q ss_conf             988998653333211443221136578999866310245310
Q gi|254780163|r  416 AIDVIDEAGASQILQPLSKRRKFITEKDIKKTIASMNRSIHT  457 (798)
Q Consensus       416 AidllDea~a~~~~~~~~~~~~~~~~~~i~~~~~~~~~gip~  457 (798)
                      --.|+.||+    +.+....+..|+..|+.+.+.+..-|.+.
T Consensus       386 LanlvNEAa----l~AaR~~~~~it~~d~~~AidrV~~G~ek  423 (631)
T CHL00176        386 LANLLNEAA----ILAARRRKNQITMSEIDEAIDRVIAGMEG  423 (631)
T ss_pred             HHHHHHHHH----HHHHHHCCCCCCHHHHHHHHHHHHCCCCC
T ss_conf             876999999----99998477764788999999999716566


No 44 
>PRK10733 hflB ATP-dependent metalloprotease; Reviewed
Probab=99.52  E-value=1.8e-12  Score=108.71  Aligned_cols=226  Identities=20%  Similarity=0.318  Sum_probs=147.3

Q ss_pred             CCHHHHHHHHH---HHHHHHHH---------HCCCCCCEEEECCCCCHHHHHHHHHHHHHHCCCCCHHHHEEEEEEEEHH
Q ss_conf             61122217899---99999986---------2267787489667641166899999999854898834520144554046
Q gi|254780163|r  202 KVDILVGRHEE---INRTIQIL---------CRRSKNNPLYVGDPGVGKTAIAEGFAKQIVDGMVPDILLGARIFSLDMG  269 (798)
Q Consensus       202 KLDPVIGRd~E---I~riiqIL---------~RR~KNn~~lvG~~gvGktaive~la~~i~~~~vp~~l~~~~i~~ld~~  269 (798)
                      .++-|.|-|+.   ++.+++-|         .-|--.-++|+|+||.|||-++..+|-   +       .+.-+|+++.+
T Consensus       150 tF~DVaG~~eaK~el~EiVdfLk~P~k~~~~Gak~PkGvLL~GPPGtGKTlLAkAvAg---E-------a~vpF~~~sgs  219 (644)
T PRK10733        150 TFADVAGCDEAKEEVAELVEYLREPSRFQKLGGKIPKGVLMVGPPGTGKTLLAKAIAG---E-------AKVPFFTISGS  219 (644)
T ss_pred             CCCCCCCCHHHHHHHHHHHHHHHCHHHHHHCCCCCCCCEEEECCCCCCHHHHHHHHHC---C-------CCCEEEEEEHH
T ss_conf             7104089789999999999981297999974997998517779899877899999864---5-------59808997847


Q ss_pred             HHHCCCCCCCHHHHHHHHHHHHHCCCCCEEEEECCHHHHHC---CCCCCCCCCCHHHHHHHHH-------CCCCEEEEEE
Q ss_conf             75306343123789999999872038983999736166301---5544434477788887663-------0266038873
Q gi|254780163|r  270 NLIAGTRYRGDFEERIKKIVKEIESYANAILYIDEIHTLVG---AGSASGISVDASNLLKPAL-------SSGAVRCIGS  339 (798)
Q Consensus       270 ~l~ag~~~rg~fe~r~~~~~~~~~~~~~~ilfideih~lig---ag~~~g~~~d~an~lkP~L-------~rg~~~~Iga  339 (798)
                      .++  .+|.|.=+.|++.+++.+++..+.|+|||||..+-+   +|.+ |+...-.+.|-+.|       .+..+-+|||
T Consensus       220 ef~--e~~vGvga~rVR~lF~~Ar~~aP~IIFIDEiDaig~~R~~~~~-gg~~e~~~tlNqlL~EmDGf~~~~~ViviaA  296 (644)
T PRK10733        220 DFV--EMFVGVGASRVRDMFEQAKKAAPCIIFIDEIDAVGRQRGAGLG-GGHDEREQTLNQMLVEMDGFEGNEGIIVIAA  296 (644)
T ss_pred             HHH--HEEEECCHHHHHHHHHHHHHCCCEEEEEECHHCCCCCCCCCCC-CCCHHHHHHHHHHHHHHHCCCCCCCEEEEEE
T ss_conf             730--2225306899999999999669979999532203666789888-9832888789999999548888787699962


Q ss_pred             CCHHHHHHHHHCCHHHHH--HCEE-EEECCCCHHHHHHHHHHHHHHHHHHCCCEECCHHHHHHHHHHHHHCCCCCCHHHH
Q ss_conf             048999998520111432--0014-4306878689999998612766541035121117899999865420155564679
Q gi|254780163|r  340 TTYSEYRQFFEKDKALVR--RFQK-IDVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLPDKA  416 (798)
Q Consensus       340 tT~~ey~~~~e~d~al~r--rF~~-i~v~ep~~~~~~~iL~~~~~~ye~~h~v~~~~~al~~av~ls~ryi~~r~lPdkA  416 (798)
                      |...+     --|+||-|  ||.+ |.|+-|+.+.-..||+--..      ++.+.++.-  .-.++ |.-++ |-+.--
T Consensus       297 TNrpd-----~LD~ALlRPGRFDr~I~V~lPd~~~R~~ILkvh~~------~~~l~~dvd--l~~lA-~~T~G-fSGADL  361 (644)
T PRK10733        297 TNRPD-----VLDPALLRPGRFDRQVVVGLPDVRGREQILKVHMR------RVPLAPDID--AAIIA-RGTPG-FSGADL  361 (644)
T ss_pred             CCCCC-----CCCHHHHCCCCCCEEEEECCCCHHHHHHHHHHHHC------CCCCCCCCC--HHHHH-CCCCC-CCHHHH
T ss_conf             69975-----54777716888655999779898899999999964------887773115--89884-45998-670333


Q ss_pred             HHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHCCCCCCHHH
Q ss_conf             8899865333321144322113657899986631024531011
Q gi|254780163|r  417 IDVIDEAGASQILQPLSKRRKFITEKDIKKTIASMNRSIHTTS  459 (798)
Q Consensus       417 idllDea~a~~~~~~~~~~~~~~~~~~i~~~~~~~~~gip~~~  459 (798)
                      -.|+.||    .+.+....+..|+..|+.+.+.+..-|.....
T Consensus       362 aNlvNEA----Al~AaR~~k~~It~~d~e~A~drV~~G~ekks  400 (644)
T PRK10733        362 ANLVNEA----ALFAARGNKRVVSMVEFEKAKDKIMMGAERRS  400 (644)
T ss_pred             CCHHHHH----HHHHHHHCCCCCCHHHHHHHHHHHHCCCCCCC
T ss_conf             2599999----99998708754307668998888511534566


No 45 
>PRK03992 proteasome-activating nucleotidase; Provisional
Probab=99.51  E-value=7.3e-13  Score=111.59  Aligned_cols=197  Identities=23%  Similarity=0.367  Sum_probs=125.7

Q ss_pred             HHCHHHHHHHHHHHHHH--------HHCCCCCCCCCCCEEEEECCCCHHHHHHHHHHHHHCCCCEEEEEHHHHHCCCCCC
Q ss_conf             53458999999999877--------5204456578740688614320038899999873047733772068861246530
Q gi|254780163|r  479 VYGQEEAIKKLSSSIKI--------ARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFALGVQLLRFDMSEYMERHAVS  550 (798)
Q Consensus       479 v~GQ~~ai~~v~~~i~~--------~~~gl~~~~rP~g~flf~GptGvGKTelak~la~~~~~~lir~dmsey~e~~~vs  550 (798)
                      |-|.++++..+-++|..        .+.|+..|   -| .||.||+|+|||.+||++|...+.++++++.|++..+    
T Consensus       134 IGGl~~~k~el~E~velPl~~pe~f~~~Gi~pP---kG-vLLyGPPGtGKTllAkAvA~e~~~~fi~v~~s~l~sk----  205 (390)
T PRK03992        134 IGGLDEQIREVREAVELPLKNPELFEEVGIEPP---KG-VLLYGPPGTGKTLLAKAVAHETNATFIRVVGSELVQK----  205 (390)
T ss_pred             HCCHHHHHHHHHHHHHHHHHCHHHHHHCCCCCC---CE-EEEECCCCCCHHHHHHHHHHHHCCCEEEEEHHHHHHC----
T ss_conf             149899999999999998659899997699999---72-7868989997899999999874888799667997524----


Q ss_pred             HHCCCCCHHCCCCCC--CCCCHHHHHCCCEEEEECCHHH-----------CCHHHHHHHHHHHHHHHCCCCCCCEECCCC
Q ss_conf             110478000256444--3100355515851777404455-----------028999999998777502177997761254
Q gi|254780163|r  551 RLIGAPPGYVGFGQG--GILADSVDQNPYSVVLLDEIEK-----------SHPDVLNILLQIMDYGILTDQSGKKISFRN  617 (798)
Q Consensus       551 ~LiGappGYvG~~eg--g~Lte~vr~~P~sVvl~DEiEK-----------Ah~~v~~~llqild~G~ltd~~Gr~vdf~n  617 (798)
                              |+|-.+-  -.+.+.-|++.-|||+||||+.           ++.+|..+++|+|.+   -|+-.   +-.|
T Consensus       206 --------~vGesek~vr~lF~~Ar~~aP~IiFiDEiDai~~~R~~~~~~g~~ev~r~l~qLL~e---mDG~~---~~~~  271 (390)
T PRK03992        206 --------FIGEGARLVRELFELAREKAPSIIFIDEIDAIAAKRTDSGTSGDREVQRTLMQLLAE---MDGFD---PRGN  271 (390)
T ss_pred             --------CCCHHHHHHHHHHHHHHHHCCCEEEHHHHHHHHCCCCCCCCCCCHHHHHHHHHHHHH---CCCCC---CCCC
T ss_conf             --------541799999999999997099089714325663356778886208899999999997---44877---7788


Q ss_pred             EEEEEECCCCHHHHHHCCCCCCCCCCHHHHHHHHHHHCCHHHH--CCCCEEEECCCCCHHHHHHHHHHHHHHHHHHHHHC
Q ss_conf             2999942421455330368988211148899999872887881--77682896288999999999999999999999866
Q gi|254780163|r  618 VILIMTTNAGALEMSKARIGFGSSRNDDADKEALRNFLSPEFL--NRLDSIIPFFPLSSDIIRQVVHKFIMKLELQLQEK  695 (798)
Q Consensus       618 ~iii~TsN~G~~~~~~~~~g~~~~~~~~~~~~~l~~~f~pefl--nRid~ii~F~~l~~~~~~~i~~~~l~~l~~~l~~~  695 (798)
                      .+||++||-=                         ...-|.++  +|+|..|.|.+-+.+.-..|+..+++.+.      
T Consensus       272 V~VIaATNrp-------------------------d~LDpAllRpGRFDr~I~iplPd~~~R~~Ilki~~~~~~------  320 (390)
T PRK03992        272 VKIIAATNRP-------------------------DILDPALLRPGRFDRIIEVPLPDEEGRLEILKIHTRKMN------  320 (390)
T ss_pred             EEEEEECCCC-------------------------HHCCHHHHCCCCCCEEEEECCCCHHHHHHHHHHHHCCCC------
T ss_conf             2799606981-------------------------005977754776523887089499999999999847999------


Q ss_pred             CCEEEECHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHHH
Q ss_conf             988999889999999718981015326799999862359
Q gi|254780163|r  696 GISFHFSEEVINWLVSHGYDVKMGARPLERIIKEHVKVP  734 (798)
Q Consensus       696 ~i~l~~~~~~~~~l~~~~~~~~~GAR~l~r~i~~~i~~~  734 (798)
                       +.-.++   ++.|++..  ..|-...|+.+++.--..+
T Consensus       321 -l~~dvd---l~~lA~~T--~G~SGADI~~lc~EA~m~A  353 (390)
T PRK03992        321 -LADDVD---LEELAELT--EGASGADLKAICTEAGMFA  353 (390)
T ss_pred             -CCCCCC---HHHHHHHC--CCCCHHHHHHHHHHHHHHH
T ss_conf             -998889---99999768--7998999999999999999


No 46 
>PRK13342 recombination factor protein RarA; Reviewed
Probab=99.51  E-value=5.8e-13  Score=112.32  Aligned_cols=183  Identities=21%  Similarity=0.339  Sum_probs=125.3

Q ss_pred             HHHHCHHHHHHH---HHHHHHHHHCCCCCCCCCCCEEEEECCCCHHHHHHHHHHHHHCCCCEEEEEHHHHHCCCCCCHHC
Q ss_conf             665345899999---99998775204456578740688614320038899999873047733772068861246530110
Q gi|254780163|r  477 TVVYGQEEAIKK---LSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFALGVQLLRFDMSEYMERHAVSRLI  553 (798)
Q Consensus       477 ~~v~GQ~~ai~~---v~~~i~~~~~gl~~~~rP~g~flf~GptGvGKTelak~la~~~~~~lir~dmsey~e~~~vs~Li  553 (798)
                      ..||||++.+..   +.+.|.        .+++ .|++|.||+|||||-+|+.+|......++.++-+.    ..|..+-
T Consensus        13 de~vGQ~hllg~~~~L~~~i~--------~~~~-~s~Il~GPPG~GKTTlA~iiA~~~~~~f~~lnA~~----~gv~dir   79 (417)
T PRK13342         13 DEVVGQEHLLGPGKPLRRMIE--------AGRL-SSMILWGPPGTGKTTLARIIAGATDAEFEALSAVT----SGVKDLR   79 (417)
T ss_pred             HHHCCCHHHHCCCHHHHHHHH--------CCCC-CEEEEECCCCCCHHHHHHHHHHHHCCCEEEEECCC----CCHHHHH
T ss_conf             885798776089719999997--------6999-75998896999899999999998689889961410----3889999


Q ss_pred             CCCCHHCCCCCCCCCCHHHHHC---CCEEEEECCHHHCCHHHHHHHHHHHHHHHCCCCCCCEECCCCEEEEEECCCCHHH
Q ss_conf             4780002564443100355515---8517774044550289999999987775021779977612542999942421455
Q gi|254780163|r  554 GAPPGYVGFGQGGILADSVDQN---PYSVVLLDEIEKSHPDVLNILLQIMDYGILTDQSGKKISFRNVILIMTTNAGALE  630 (798)
Q Consensus       554 GappGYvG~~egg~Lte~vr~~---P~sVvl~DEiEKAh~~v~~~llqild~G~ltd~~Gr~vdf~n~iii~TsN~G~~~  630 (798)
                                   ...+..++.   -..|+++|||..-...-++.||..+++|++            ++|-.|+.     
T Consensus        80 -------------~ii~~a~~~~~~~~tilfiDEIHRfnK~QQD~LLp~vE~g~i------------iLIgATTE-----  129 (417)
T PRK13342         80 -------------EVIEEAKQSRLGRRTILFIDEIHRFNKAQQDALLPHVEDGTI------------TLIGATTE-----  129 (417)
T ss_pred             -------------HHHHHHHHHHCCCCEEEEEECHHHCCHHHHHHHHHHHHCCCE------------EEEEECCC-----
T ss_conf             -------------999998863148965999978200588999999875112656------------99974157-----


Q ss_pred             HHHCCCCCCCCCCHHHHHHHHHHHCCHHHHCCCCEEEECCCCCHHHHHHHHHHHHHHHHHHHHHCCCEEEECHHHHHHHH
Q ss_conf             33036898821114889999987288788177682896288999999999999999999999866988999889999999
Q gi|254780163|r  631 MSKARIGFGSSRNDDADKEALRNFLSPEFLNRLDSIIPFFPLSSDIIRQVVHKFIMKLELQLQEKGISFHFSEEVINWLV  710 (798)
Q Consensus       631 ~~~~~~g~~~~~~~~~~~~~l~~~f~peflnRid~ii~F~~l~~~~~~~i~~~~l~~l~~~l~~~~i~l~~~~~~~~~l~  710 (798)
                                 .+.-.        ..|.++.|+ .|+.|+||+.+++..|+.+-+.. .   ...+..+.++++++++|+
T Consensus       130 -----------NP~f~--------in~aLlSRc-~vf~l~~L~~~di~~iL~ral~~-e---~~~~~~i~i~~~al~~i~  185 (417)
T PRK13342        130 -----------NPSFE--------VNPALLSRA-QVFELKPLSEEDLEQLLKRALED-E---RGLGRKLELDDEALDALA  185 (417)
T ss_pred             -----------CCHHH--------CCHHHHHHH-HHEECCCCCHHHHHHHHHHHHHH-H---HCCCCCCCCCHHHHHHHH
T ss_conf             -----------92253--------489898565-70020589999999999999987-7---433788776999999999


Q ss_pred             HCCCCCCCCCHHHHHHHHH
Q ss_conf             7189810153267999998
Q gi|254780163|r  711 SHGYDVKMGARPLERIIKE  729 (798)
Q Consensus       711 ~~~~~~~~GAR~l~r~i~~  729 (798)
                      ..+-.   -||..-..++-
T Consensus       186 ~~s~G---DaR~aLN~LE~  201 (417)
T PRK13342        186 RLADG---DARRALNLLEL  201 (417)
T ss_pred             HHCCC---CHHHHHHHHHH
T ss_conf             81498---59999999999


No 47 
>PRK11608 pspF phage shock protein operon transcriptional activator; Provisional
Probab=99.51  E-value=7.4e-13  Score=111.56  Aligned_cols=226  Identities=20%  Similarity=0.327  Sum_probs=159.9

Q ss_pred             HHHHHHHCHHHHHHHHHHHHHHHHCCCCCCCCCCCEEEEECCCCHHHHHHHHHHHHHC---CCCEEEEEHHHHHCCCCCC
Q ss_conf             0246653458999999999877520445657874068861432003889999987304---7733772068861246530
Q gi|254780163|r  474 NLGTVVYGQEEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFAL---GVQLLRFDMSEYMERHAVS  550 (798)
Q Consensus       474 ~l~~~v~GQ~~ai~~v~~~i~~~~~gl~~~~rP~g~flf~GptGvGKTelak~la~~~---~~~lir~dmsey~e~~~vs  550 (798)
                      ..+..+||+..++..+.+.+++.    ...+.|+   |+.|.+|+||+.+|+++-+.+   ..+|+.+||+.+.+..--+
T Consensus         3 ~~~~~liG~S~~m~~v~~~~~~~----A~~~~pV---LI~GE~GtGK~~~Ar~IH~~S~r~~~pfi~v~C~~l~~~~~e~   75 (325)
T PRK11608          3 EYKDNLLGEANSFLEVLEQVSHL----APLDKPV---LIIGERGTGKELIASRLHYLSSRWQGPFISLNCAALNENLLDS   75 (325)
T ss_pred             CCCCCCEECCHHHHHHHHHHHHH----HCCCCCE---EEECCCCCCHHHHHHHHHHCCCCCCCCCEEEECCCCCHHHHHH
T ss_conf             77899858999999999999999----6889998---9889898379999999996588679997788779899778899


Q ss_pred             HHCCCCCH-HCCCCCCCCCCHHHHHCCCEEEEECCHHHCCHHHHHHHHHHHHHHHCCCCCCCEECCCCEEEEEECCCCHH
Q ss_conf             11047800-02564443100355515851777404455028999999998777502177997761254299994242145
Q gi|254780163|r  551 RLIGAPPG-YVGFGQGGILADSVDQNPYSVVLLDEIEKSHPDVLNILLQIMDYGILTDQSGKKISFRNVILIMTTNAGAL  629 (798)
Q Consensus       551 ~LiGappG-YvG~~egg~Lte~vr~~P~sVvl~DEiEKAh~~v~~~llqild~G~ltd~~Gr~vdf~n~iii~TsN~G~~  629 (798)
                      .|.|...| +.|....  ..-.+.+.--+.++||||+...++++.-||+++++|.+.--.|..--..|+=||.|||.--.
T Consensus        76 ~LFG~~~g~~~~~~~~--~~g~le~a~gGTL~L~eI~~l~~~~Q~~Ll~~l~~~~~~r~g~~~~~~~~~RiIa~t~~~l~  153 (325)
T PRK11608         76 ELFGHEAGAFTGAQKR--HPGRFERADGGTLFLDELATAPMLVQEKLLRVIEYGELERVGGSQPLQVNVRLVCATNADLP  153 (325)
T ss_pred             HHCCCCCCCCCCCCCC--CCCHHHCCCCCEEEEECHHHCCHHHHHHHHHHHHCCCEEECCCCCCCCCCEEEEECCCHHHH
T ss_conf             8727755676775324--68734356898699737454799999999999864908857998766564688713322089


Q ss_pred             HHHHCCCCCCCCCCHHHHHHHHHHHCCHHHHCCCCEE-EECCCCC--HHHHHHHHHHHHHHHHHHHHHCCCEE--EECHH
Q ss_conf             5330368988211148899999872887881776828-9628899--99999999999999999998669889--99889
Q gi|254780163|r  630 EMSKARIGFGSSRNDDADKEALRNFLSPEFLNRLDSI-IPFFPLS--SDIIRQVVHKFIMKLELQLQEKGISF--HFSEE  704 (798)
Q Consensus       630 ~~~~~~~g~~~~~~~~~~~~~l~~~f~peflnRid~i-i~F~~l~--~~~~~~i~~~~l~~l~~~l~~~~i~l--~~~~~  704 (798)
                                        ...-+..|+++|+.|+..+ |..-||.  .+++..+++.++.++.+++   +..+  .++++
T Consensus       154 ------------------~lv~~g~fr~dLy~rL~~~~I~lPpLReR~eDI~~L~~~fl~~~~~~~---~~~~~~~~s~~  212 (325)
T PRK11608        154 ------------------AMVNEGTFRADLLDRLAFDVVQLPPLRERQSDIMLMAEHFAIQMCREL---GLPLFPGFTER  212 (325)
T ss_pred             ------------------HHHHHCCCHHHHHHHHHHHHCCCCCHHHCCCCHHHHHHHHHHHHHHHC---CCCCCCCCCHH
T ss_conf             ------------------999839567999856530111586845471019999999999999982---99988888999


Q ss_pred             HHHHHHHCCCCCCCCCHHHHHHHHHHH
Q ss_conf             999999718981015326799999862
Q gi|254780163|r  705 VINWLVSHGYDVKMGARPLERIIKEHV  731 (798)
Q Consensus       705 ~~~~l~~~~~~~~~GAR~l~r~i~~~i  731 (798)
                      +.+.|....+--.  -|.|+++|++-+
T Consensus       213 a~~~L~~y~WPGN--vrEL~n~ierav  237 (325)
T PRK11608        213 ARETLLNYRWPGN--IRELKNVVERSV  237 (325)
T ss_pred             HHHHHHCCCCCCH--HHHHHHHHHHHH
T ss_conf             9999961999965--999999999999


No 48 
>COG2204 AtoC Response regulator containing CheY-like receiver, AAA-type ATPase, and DNA-binding domains [Signal transduction mechanisms]
Probab=99.49  E-value=1.4e-10  Score=95.23  Aligned_cols=347  Identities=20%  Similarity=0.275  Sum_probs=228.4

Q ss_pred             CEEEEECCHHHHHCCCCCCCCCCCHHHHHHHHHCCCCEEEEEECCHHHHHHHHHCCHHHHHHCEEE--EECCCCHHHHHH
Q ss_conf             839997361663015544434477788887663026603887304899999852011143200144--306878689999
Q gi|254780163|r  297 NAILYIDEIHTLVGAGSASGISVDASNLLKPALSSGAVRCIGSTTYSEYRQFFEKDKALVRRFQKI--DVSEPSIEDAIE  374 (798)
Q Consensus       297 ~~ilfideih~ligag~~~g~~~d~an~lkP~L~rg~~~~IgatT~~ey~~~~e~d~al~rrF~~i--~v~ep~~~~~~~  374 (798)
                      .-||.||+             -.|.-.+|..+|.+....++.+...++-...+..+.     |..|  .+.-| ..+-+.
T Consensus         5 ~~iLvVDD-------------d~~ir~~l~~~L~~~G~~v~~a~~~~~al~~i~~~~-----~~lvl~Di~mp-~~~Gl~   65 (464)
T COG2204           5 ARILVVDD-------------DPDIRELLEQALELAGYEVVTAESAEEALEALSESP-----FDLVLLDIRMP-GMDGLE   65 (464)
T ss_pred             CCEEEEEC-------------CHHHHHHHHHHHHHCCCEEEEECCHHHHHHHHHCCC-----CCEEEEECCCC-CCCHHH
T ss_conf             87899929-------------789999999999976974898589999999986289-----99899816789-996699


Q ss_pred             HHHHHHHHHHHHCCCEECC-HHHHHHHHHHH----HHCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHH
Q ss_conf             9986127665410351211-17899999865----420155564679889986533332114432211365789998663
Q gi|254780163|r  375 IVKGIKPYFEEHHQLRYSK-EAIRAAVQLSV----RHFTSRKLPDKAIDVIDEAGASQILQPLSKRRKFITEKDIKKTIA  449 (798)
Q Consensus       375 iL~~~~~~ye~~h~v~~~~-~al~~av~ls~----ryi~~r~lPdkAidllDea~a~~~~~~~~~~~~~~~~~~i~~~~~  449 (798)
                      .|..++...-..-=+-+|- ..+..||+--+    -|+.--+-||+-+.++..|....+......               
T Consensus        66 ll~~i~~~~~~~pVI~~Tg~g~i~~AV~A~k~GA~Dfl~KP~~~~~L~~~v~ral~~~~~~~e~~---------------  130 (464)
T COG2204          66 LLKEIKSRDPDLPVIVMTGHGDIDTAVEALRLGAFDFLEKPFDLDRLLAIVERALELRELQRENR---------------  130 (464)
T ss_pred             HHHHHHHHCCCCCEEEEECCCCHHHHHHHHHCCCCEEEECCCCHHHHHHHHHHHHHHHHHHHHHH---------------
T ss_conf             99999963899988998288999999999855703332189999999999999998765322210---------------


Q ss_pred             HCCCCCCHHHHHCCHHHHHHHHCCHHHHHHHCHHHHHHHHHHHHHHHHCCCCCCCCCCCEEEEECCCCHHHHHHHHHHHH
Q ss_conf             10245310111001123342100002466534589999999998775204456578740688614320038899999873
Q gi|254780163|r  450 SMNRSIHTTSFSRDDDSVLSNLEKNLGTVVYGQEEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAF  529 (798)
Q Consensus       450 ~~~~gip~~~~~~~~~~~l~~l~~~l~~~v~GQ~~ai~~v~~~i~~~~~gl~~~~rP~g~flf~GptGvGKTelak~la~  529 (798)
                                      . -..-.......+||+..|+..+-+.+.+.    .+.+-   +.|..|.||+||--+|+++-.
T Consensus       131 ----------------~-~~~~~~~~~~~liG~S~am~~l~~~i~kv----A~s~a---~VLI~GESGtGKElvAr~IH~  186 (464)
T COG2204         131 ----------------R-SLKRAKSLGGELVGESPAMQQLRRLIAKV----APSDA---SVLITGESGTGKELVARAIHQ  186 (464)
T ss_pred             ----------------H-HHCCCCCCCCCCCCCCHHHHHHHHHHHHH----HCCCC---CEEEECCCCCCHHHHHHHHHH
T ss_conf             ----------------0-00013455677520699999999999998----47799---789977898758999999986


Q ss_pred             HC---CCCEEEEEHHHHHCCCCCCHHCCCCCHHCCCCCCCCCCHHHHHCC-------CEEEEECCHHHCCHHHHHHHHHH
Q ss_conf             04---773377206886124653011047800025644431003555158-------51777404455028999999998
Q gi|254780163|r  530 AL---GVQLLRFDMSEYMERHAVSRLIGAPPGYVGFGQGGILADSVDQNP-------YSVVLLDEIEKSHPDVLNILLQI  599 (798)
Q Consensus       530 ~~---~~~lir~dmsey~e~~~vs~LiGappGYvG~~egg~Lte~vr~~P-------~sVvl~DEiEKAh~~v~~~llqi  599 (798)
                      .+   ..+||.+||....+.--=|-|.|-       ++ |-.|.|.+++.       -..++||||+.-..+++.-||.+
T Consensus       187 ~S~R~~~PFVavNcaAip~~l~ESELFGh-------ek-GAFTGA~~~r~G~fE~A~GGTLfLDEI~~mpl~~Q~kLLRv  258 (464)
T COG2204         187 ASPRAKGPFIAVNCAAIPENLLESELFGH-------EK-GAFTGAITRRIGRFEQANGGTLFLDEIGEMPLELQVKLLRV  258 (464)
T ss_pred             HCCCCCCCCEEEECCCCCHHHHHHHHHCC-------CC-CCCCCCCCCCCCCEEECCCCEEEEECCCCCCHHHHHHHHHH
T ss_conf             07445899256334648988877776145-------65-67677643457615773796587323110999999999999


Q ss_pred             HHHHHCCCCCCCEECCCCEEEEEECCCCHHHHHHCCCCCCCCCCHHHHHHHHHHHCCHHHHCCCCEEEECCC-C--CHHH
Q ss_conf             777502177997761254299994242145533036898821114889999987288788177682896288-9--9999
Q gi|254780163|r  600 MDYGILTDQSGKKISFRNVILIMTTNAGALEMSKARIGFGSSRNDDADKEALRNFLSPEFLNRLDSIIPFFP-L--SSDI  676 (798)
Q Consensus       600 ld~G~ltd~~Gr~vdf~n~iii~TsN~G~~~~~~~~~g~~~~~~~~~~~~~l~~~f~peflnRid~ii~F~~-l--~~~~  676 (798)
                      |.+|..+---|++.-=-|+=||.+||.-=                  ....-...|+.++.-|+..+-+.-| |  -.++
T Consensus       259 Lqe~~~~rvG~~~~i~vdvRiIaaT~~dL------------------~~~v~~G~FReDLyyRLnV~~i~iPpLRER~ED  320 (464)
T COG2204         259 LQEREFERVGGNKPIKVDVRIIAATNRDL------------------EEEVAAGRFREDLYYRLNVVPLRLPPLRERKED  320 (464)
T ss_pred             HHCCEEEECCCCCEECEEEEEEEECCCCH------------------HHHHHCCCCHHHHHHHHCCCEECCCCCCCCCHH
T ss_conf             87070673588860000169996057789------------------999881973788886523311048762236200


Q ss_pred             HHHHHHHHHHHHHHHHHHCCCEEEECHHHHHHHHHCCCCCCCCCHHHHHHHHHHH
Q ss_conf             9999999999999999866988999889999999718981015326799999862
Q gi|254780163|r  677 IRQVVHKFIMKLELQLQEKGISFHFSEEVINWLVSHGYDVKMGARPLERIIKEHV  731 (798)
Q Consensus       677 ~~~i~~~~l~~l~~~l~~~~i~l~~~~~~~~~l~~~~~~~~~GAR~l~r~i~~~i  731 (798)
                      +--+++-++.+...++.  .-...+++++...|....+--  --|.|+.++++.+
T Consensus       321 Ip~L~~hfl~~~~~~~~--~~~~~~s~~a~~~L~~y~WPG--NVREL~N~ver~~  371 (464)
T COG2204         321 IPLLAEHFLKRFAAELG--RPPKGFSPEALAALLAYDWPG--NVRELENVVERAV  371 (464)
T ss_pred             HHHHHHHHHHHHHHHHC--CCCCCCCHHHHHHHHHCCCCH--HHHHHHHHHHHHH
T ss_conf             79999999999999809--998887999999997389981--8999999999998


No 49 
>COG0714 MoxR-like ATPases [General function prediction only]
Probab=99.47  E-value=3.1e-13  Score=114.28  Aligned_cols=140  Identities=32%  Similarity=0.488  Sum_probs=103.7

Q ss_pred             HHHHHHCCHHHHHHHCHHHHHHHHHHHHHHHHCCCCCCCCCCCEEEEECCCCHHHHHHHHHHHHHCCCCEEEEEHHHHHC
Q ss_conf             33421000024665345899999999987752044565787406886143200388999998730477337720688612
Q gi|254780163|r  466 SVLSNLEKNLGTVVYGQEEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFALGVQLLRFDMSEYME  545 (798)
Q Consensus       466 ~~l~~l~~~l~~~v~GQ~~ai~~v~~~i~~~~~gl~~~~rP~g~flf~GptGvGKTelak~la~~~~~~lir~dmsey~e  545 (798)
                      ..+..+...+.+.++|+++++..+..++..        ++|   .||.||+|||||.+|+++|...+.+++|+.+...+.
T Consensus        13 ~~~~~~~~~~~~~~~g~~~~~~~~l~a~~~--------~~~---vll~G~PG~gKT~la~~lA~~l~~~~~~i~~t~~l~   81 (329)
T COG0714          13 EILGKIRSELEKVVVGDEEVIELALLALLA--------GGH---VLLEGPPGVGKTLLARALARALGLPFVRIQCTPDLL   81 (329)
T ss_pred             HHHHHHHHHCCCCCCCCHHHHHHHHHHHHC--------CCC---EEEECCCCCCHHHHHHHHHHHHCCCCEEEECCCCCC
T ss_conf             666666652256552669999999999985--------997---787798987779999999998389818995689988


Q ss_pred             CCCCCHHCCCC--------CHHCCCCCCCCCCHHHHHCCCEEEEECCHHHCCHHHHHHHHHHHHHHHCCCCCCCE-ECCC
Q ss_conf             46530110478--------00025644431003555158517774044550289999999987775021779977-6125
Q gi|254780163|r  546 RHAVSRLIGAP--------PGYVGFGQGGILADSVDQNPYSVVLLDEIEKSHPDVLNILLQIMDYGILTDQSGKK-ISFR  616 (798)
Q Consensus       546 ~~~vs~LiGap--------pGYvG~~egg~Lte~vr~~P~sVvl~DEiEKAh~~v~~~llqild~G~ltd~~Gr~-vdf~  616 (798)
                      +..   ++|..        +++-=|- .|-|+.+++    +|+|+|||.+|.|++++.||++|++++.|... .. +.+.
T Consensus        82 p~d---~~G~~~~~~~~~~~~~~~~~-~gpl~~~~~----~ill~DEInra~p~~q~aLl~~l~e~~vt~~~-~~~~~~~  152 (329)
T COG0714          82 PSD---LLGTYAYAALLLEPGEFRFV-PGPLFAAVR----VILLLDEINRAPPEVQNALLEALEERQVTVPG-LTTIRLP  152 (329)
T ss_pred             HHH---HCCHHHHHHHHCCCCEEEEE-CCCCCCCCC----EEEEEECCCCCCHHHHHHHHHHHHHCEEEECC-CCCCCCC
T ss_conf             888---20568887664257718984-687334513----38998703458988999999999726897079-6653379


Q ss_pred             C-EEEEEECC
Q ss_conf             4-29999424
Q gi|254780163|r  617 N-VILIMTTN  625 (798)
Q Consensus       617 n-~iii~TsN  625 (798)
                      . .++|.|+|
T Consensus       153 ~~f~viaT~N  162 (329)
T COG0714         153 PPFIVIATQN  162 (329)
T ss_pred             CCCEEEEECC
T ss_conf             9878998268


No 50 
>PRK05022 anaerobic nitric oxide reductase transcription regulator; Provisional
Probab=99.46  E-value=4.5e-12  Score=105.92  Aligned_cols=215  Identities=22%  Similarity=0.347  Sum_probs=158.0

Q ss_pred             HHHHCHHHHHHHHHHHHHHHHCCCCCCCCCCCEEEEECCCCHHHHHHHHHHHHHC---CCCEEEEEHHHHHCCCCCCHHC
Q ss_conf             6653458999999999877520445657874068861432003889999987304---7733772068861246530110
Q gi|254780163|r  477 TVVYGQEEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFAL---GVQLLRFDMSEYMERHAVSRLI  553 (798)
Q Consensus       477 ~~v~GQ~~ai~~v~~~i~~~~~gl~~~~rP~g~flf~GptGvGKTelak~la~~~---~~~lir~dmsey~e~~~vs~Li  553 (798)
                      ..+|||..++..+-+.|.+.    .+.+-|   .|..|.|||||..+|+++-..+   +.+||.+||+-..|.-.-|.|.
T Consensus       186 ~elIG~S~~m~~l~~~i~~v----A~sd~p---VLI~GEtGTGKelvAr~IH~~S~R~~~Pfv~vNCaalpe~l~EseLF  258 (510)
T PRK05022        186 GEMIGQSPAMQQLKKEIEVV----AASDLN---VLITGETGVGKELVARAIHQASPRAVKPLVYLNCAALPESLAESELF  258 (510)
T ss_pred             CCEEECCHHHHHHHHHHHHH----HCCCCC---EEEECCCCCCHHHHHHHHHHCCCCCCCCCEEEECCCCCHHHHHHHHC
T ss_conf             97520899999999999999----689998---89889898139999999996688789985788899998567899865


Q ss_pred             CCCCHHCCCCCCCCCCHHHHHCC-------CEEEEECCHHHCCHHHHHHHHHHHHHHHCC---CCCCCEECCCCEEEEEE
Q ss_conf             47800025644431003555158-------517774044550289999999987775021---77997761254299994
Q gi|254780163|r  554 GAPPGYVGFGQGGILADSVDQNP-------YSVVLLDEIEKSHPDVLNILLQIMDYGILT---DQSGKKISFRNVILIMT  623 (798)
Q Consensus       554 GappGYvG~~egg~Lte~vr~~P-------~sVvl~DEiEKAh~~v~~~llqild~G~lt---d~~Gr~vdf~n~iii~T  623 (798)
                      |--.        |-.|-+++.+|       .+.++||||+...++++.-||.+|++|.+.   +.+-+.+|+|   ||.+
T Consensus       259 Gh~k--------GaFtGA~~~r~G~fe~A~gGTLfLDEI~~Lpl~~Q~KLLrvLq~g~iqrvG~~~~~~vdvR---IIAA  327 (510)
T PRK05022        259 GHVK--------GAFTGAISNRSGKFELADGGTLFLDEIGELPLALQAKLLRVLQYGEIQRVGSDRSLRVDVR---VIAA  327 (510)
T ss_pred             CCCC--------CCCCCCCCCCCCCEEECCCCEEEEECHHHCCHHHHHHHHHHHHCCEEEECCCCCEEEEEEE---EEEE
T ss_conf             9777--------8868865567881017789879875745499999999999984795885589946666689---9960


Q ss_pred             CCCCHHHHHHCCCCCCCCCCHHHHHHH-HHHHCCHHHHCCCCEEE-ECCCCC--HHHHHHHHHHHHHHHHHHHHHCCCEE
Q ss_conf             242145533036898821114889999-98728878817768289-628899--99999999999999999998669889
Q gi|254780163|r  624 TNAGALEMSKARIGFGSSRNDDADKEA-LRNFLSPEFLNRLDSII-PFFPLS--SDIIRQVVHKFIMKLELQLQEKGISF  699 (798)
Q Consensus       624 sN~G~~~~~~~~~g~~~~~~~~~~~~~-l~~~f~peflnRid~ii-~F~~l~--~~~~~~i~~~~l~~l~~~l~~~~i~l  699 (798)
                      ||.-                   ..+. -...|+.+|..|+..+. ..=||.  .+++.-++..++.+...++..+.  +
T Consensus       328 Tnrd-------------------L~~~V~~G~FR~DLYyRLsv~~I~vPPLRER~eDI~lLa~~FLe~~~~~~g~~~--~  386 (510)
T PRK05022        328 TNRD-------------------LREEVLAGRFRADLYHRLSVFPLPVPPLRERGDDVLLLAGYFLEQNRLRLGLSS--L  386 (510)
T ss_pred             CCCC-------------------HHHHHHCCCHHHHHHHHHHCCCCCCCCHHHCHHHHHHHHHHHHHHHHHHCCCCC--C
T ss_conf             7835-------------------999988396389999876204034808655554099999999999999829898--9


Q ss_pred             EECHHHHHHHHHCCCCCCCCCHHHHHHHHHHHH
Q ss_conf             998899999997189810153267999998623
Q gi|254780163|r  700 HFSEEVINWLVSHGYDVKMGARPLERIIKEHVK  732 (798)
Q Consensus       700 ~~~~~~~~~l~~~~~~~~~GAR~l~r~i~~~i~  732 (798)
                      .+++++.+.|....+--  --|.|+.+|++-+.
T Consensus       387 ~ls~eAl~~L~~Y~WPG--NVRELenvIeRA~l  417 (510)
T PRK05022        387 RLSPDAQAALLQYDWPG--NVRELEHVISRAAL  417 (510)
T ss_pred             CCCHHHHHHHHCCCCCC--HHHHHHHHHHHHHH
T ss_conf             88899999997099997--89999999999999


No 51 
>TIGR02903 spore_lon_C ATP-dependent protease, Lon family; InterPro: IPR014252   This entry shows some relation to the widely distributed ATP-dependent protease La, also called Lon or LonA (IPR004815 from INTERPRO), but is more closely related to LonB (IPR014251 from INTERPRO), a LonA paralog found only in endospore-forming bacteria. Proteins in this entry are unassigned peptidases belonging to the MEROPS peptidase family S16 (lon protease family, clan SJ). They are restricted to a subset of endospore-forming species, and probably participate in the program of endospore formation. We propose the designation LonC..
Probab=99.46  E-value=3.9e-12  Score=106.39  Aligned_cols=258  Identities=25%  Similarity=0.397  Sum_probs=157.7

Q ss_pred             CCHHHHHHH-HHHHHHHHHHHCCCEECCHHHHHHHH-HHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHH
Q ss_conf             786899999-98612766541035121117899999-8654201555646798899865333321144322113657899
Q gi|254780163|r  367 PSIEDAIEI-VKGIKPYFEEHHQLRYSKEAIRAAVQ-LSVRHFTSRKLPDKAIDVIDEAGASQILQPLSKRRKFITEKDI  444 (798)
Q Consensus       367 p~~~~~~~i-L~~~~~~ye~~h~v~~~~~al~~av~-ls~ryi~~r~lPdkAidllDea~a~~~~~~~~~~~~~~~~~~i  444 (798)
                      |+..+...| |..+..                ..++ +++||+.++      |.        .+++..-..|+.=--++|
T Consensus        61 P~~~e~~~ial~~~~~----------------~iad~~A~R~v~~~------iE--------~~ve~~l~erq~~Yl~Ei  110 (616)
T TIGR02903        61 PDAKELAEIALEDTED----------------HIADILARRTVENE------IE--------RKVEKKLQERQNKYLEEI  110 (616)
T ss_pred             CCCCCHHHHHHHHHHH----------------HHHHHHHHHHHHHH------HH--------HHHHHHHHHHHHHHHHHH
T ss_conf             7864126889998899----------------99998864335678------89--------999999887666899999


Q ss_pred             HHHHHHCCCCCCHHHHHCCHHHHHHHHCC-------------HHHHHHHCHHHHHHHHHHHHHHHHCCCCCCCCCCCEEE
Q ss_conf             98663102453101110011233421000-------------02466534589999999998775204456578740688
Q gi|254780163|r  445 KKTIASMNRSIHTTSFSRDDDSVLSNLEK-------------NLGTVVYGQEEAIKKLSSSIKIARAGLSDPNKPIGCYV  511 (798)
Q Consensus       445 ~~~~~~~~~gip~~~~~~~~~~~l~~l~~-------------~l~~~v~GQ~~ai~~v~~~i~~~~~gl~~~~rP~g~fl  511 (798)
                      ...|.+-. +=|...-|-..-++|..||+             +--..|+||+.||.++..-+       ..| =|--. +
T Consensus       111 r~~vlk~~-~g~En~sTLKkl~~Le~Lek~kl~~s~~slLRP~~f~EiVGQerAI~aLlaK~-------aSP-fPQHi-i  180 (616)
T TIGR02903       111 RLQVLKEE-KGPENSSTLKKLERLEKLEKKKLAKSIQSLLRPRAFSEIVGQERAIKALLAKL-------ASP-FPQHI-I  180 (616)
T ss_pred             HHHHHHHC-CCCCHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCHHHHHHHHHHHH-------CCC-CCCCE-E
T ss_conf             88775205-78861678899998752447889999998628766764333468999999763-------188-86607-8


Q ss_pred             EECCCCHHHHHHHHHHH----------HHCCCCE-------EEEEHHHHHCCCCCCHHCCC--CCHHCCCCC--------
Q ss_conf             61432003889999987----------3047733-------77206886124653011047--800025644--------
Q gi|254780163|r  512 FSGPTGVGKTEISKQLA----------FALGVQL-------LRFDMSEYMERHAVSRLIGA--PPGYVGFGQ--------  564 (798)
Q Consensus       512 f~GptGvGKTelak~la----------~~~~~~l-------ir~dmsey~e~~~vs~LiGa--ppGYvG~~e--------  564 (798)
                      +-||+|||||-.|+..=          |.-.-+|       +|.|=-|-+.|     |+||  -|=|=|..-        
T Consensus       181 LYGPPGVGKTTaARl~LEe~K~~~~tPF~~DA~FvEVDGtTLRWDPREvTNP-----LLGSVHDPIYQGa~RDLAE~GvP  255 (616)
T TIGR02903       181 LYGPPGVGKTTAARLALEEAKKLKNTPFAEDAPFVEVDGTTLRWDPREVTNP-----LLGSVHDPIYQGARRDLAETGVP  255 (616)
T ss_pred             EECCCCCCHHHHHHHHHHHCCCCCCCCCCCCCCEEEECCCCCCCCCCCCCCC-----CCCCCCCCCCCCCCHHHCCCCCC
T ss_conf             5573388478999998762136874476113785751576266774101477-----67762576556764011047879


Q ss_pred             ---CCCCCHHHHHCCCEEEEECCHHHCCHHHHHHHHHHHHHHHCCCCCCCEECCCCEEEEEECCCCHHHHHHCCCCCCCC
Q ss_conf             ---43100355515851777404455028999999998777502177997761254299994242145533036898821
Q gi|254780163|r  565 ---GGILADSVDQNPYSVVLLDEIEKSHPDVLNILLQIMDYGILTDQSGKKISFRNVILIMTTNAGALEMSKARIGFGSS  641 (798)
Q Consensus       565 ---gg~Lte~vr~~P~sVvl~DEiEKAh~~v~~~llqild~G~ltd~~Gr~vdf~n~iii~TsN~G~~~~~~~~~g~~~~  641 (798)
                         .|+.|+|==    .|++.|||=--.|=.+|=||.||+|        ++|.|+.+.                    .+
T Consensus       256 EPk~GLVT~AHG----GvLFIDEIGELD~lLQnKLLKVLED--------KrV~F~SsY--------------------YD  303 (616)
T TIGR02903       256 EPKLGLVTDAHG----GVLFIDEIGELDPLLQNKLLKVLED--------KRVEFSSSY--------------------YD  303 (616)
T ss_pred             CCCCCCCCCCCC----CEEEEECHHHHHHHHHHHHHHHHCC--------CEEEEEECC--------------------CC
T ss_conf             898987100477----5676502112227876324443226--------436653212--------------------48


Q ss_pred             CCHHHHHHHHHHHCC---------------------HHHHCCCCEEEECCCCCHHHHHHHHHHHHHHHHHHHHHCCCEEE
Q ss_conf             114889999987288---------------------78817768289628899999999999999999999986698899
Q gi|254780163|r  642 RNDDADKEALRNFLS---------------------PEFLNRLDSIIPFFPLSSDIIRQVVHKFIMKLELQLQEKGISFH  700 (798)
Q Consensus       642 ~~~~~~~~~l~~~f~---------------------peflnRid~ii~F~~l~~~~~~~i~~~~l~~l~~~l~~~~i~l~  700 (798)
                      .+++.+-.=+|+.|-                     |.+..|+.+| .|.||++.++..|+..--.+|+.         .
T Consensus       304 pdD~NvPkYIK~lFe~GAPADFvLIGATTr~P~eINpALRSRCaEv-fFePL~p~dI~~Iv~~AA~klnv---------~  373 (616)
T TIGR02903       304 PDDENVPKYIKKLFEEGAPADFVLIGATTRDPEEINPALRSRCAEV-FFEPLTPEDIKEIVLNAAEKLNV---------K  373 (616)
T ss_pred             CCCCCCCHHHHHHHCCCCCCCEEEECCCCCCHHHCCHHHHCCCCEE-ECCCCCHHHHHHHHHHHHHHCCC---------C
T ss_conf             7537865588885226888256872661588244051233014313-21798878999999998886177---------0


Q ss_pred             ECHHHHHHHHH
Q ss_conf             98899999997
Q gi|254780163|r  701 FSEEVINWLVS  711 (798)
Q Consensus       701 ~~~~~~~~l~~  711 (798)
                      +.+.+.+.++.
T Consensus       374 L~~gV~e~Ia~  384 (616)
T TIGR02903       374 LAEGVEELIAR  384 (616)
T ss_pred             CCCCHHHHHHH
T ss_conf             00364878721


No 52 
>PRK11388 DNA-binding transcriptional regulator DhaR; Provisional
Probab=99.45  E-value=6.3e-12  Score=104.86  Aligned_cols=219  Identities=17%  Similarity=0.264  Sum_probs=158.7

Q ss_pred             HHHCHHHHHHHHHHHHHHHHCCCCCCCCCCCEEEEECCCCHHHHHHHHHHHHHC---CCCEEEEEHHHHHCCCCCCHHCC
Q ss_conf             653458999999999877520445657874068861432003889999987304---77337720688612465301104
Q gi|254780163|r  478 VVYGQEEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFAL---GVQLLRFDMSEYMERHAVSRLIG  554 (798)
Q Consensus       478 ~v~GQ~~ai~~v~~~i~~~~~gl~~~~rP~g~flf~GptGvGKTelak~la~~~---~~~lir~dmsey~e~~~vs~LiG  554 (798)
                      .++|++.+...+....+++    ...+-|   .|..|.||+||+.+|+++-..+   ..+|+.+||.-..+.---+.|+|
T Consensus       326 ~l~g~s~~~~~~~~~a~~~----a~~~~p---VLI~GE~GtGKe~lAraIH~~S~r~~~pfv~vnC~ai~~~~~e~elfG  398 (639)
T PRK11388        326 HMPQDSPQMRRLIHFGRQA----AKSSFP---ILLCGEEGVGKALLAQAIHNESERAAGPYIAVNCQLLPDEALAEEFLG  398 (639)
T ss_pred             HCCCCCHHHHHHHHHHHHH----HCCCCC---EEEECCCCCCHHHHHHHHHHCCCCCCCCEEEEECCCCCHHHHHHHHCC
T ss_conf             4467999999999999999----688996---898898981099999999955777899818987898984678998738


Q ss_pred             CCCHHCCCCCCCCCCHHHHHCCCEEEEECCHHHCCHHHHHHHHHHHHHHHCCCCCCCEECCCCEEEEEECCCCHHHHHHC
Q ss_conf             78000256444310035551585177740445502899999999877750217799776125429999424214553303
Q gi|254780163|r  555 APPGYVGFGQGGILADSVDQNPYSVVLLDEIEKSHPDVLNILLQIMDYGILTDQSGKKISFRNVILIMTTNAGALEMSKA  634 (798)
Q Consensus       555 appGYvG~~egg~Lte~vr~~P~sVvl~DEiEKAh~~v~~~llqild~G~ltd~~Gr~vdf~n~iii~TsN~G~~~~~~~  634 (798)
                      .-+|   ...+|.+. ++....-..++||||+--.++++.-||++|++|..+...|.+.---++-||.+||.--      
T Consensus       399 ~~~~---~~~~g~~g-~~e~A~gGTL~LdeI~~lp~~~Q~~LlrvL~~~~~~r~g~~~~~~vdvRiiaat~~~l------  468 (639)
T PRK11388        399 SDRT---DSENGRLS-KFELAHGGTLFLEKVEYLSVELQSALLQVLKTGVITRLDSRRLIPVDVRVIATTTADL------  468 (639)
T ss_pred             CCCC---CCCCCCCC-HHHCCCCCEEEECCHHHCCHHHHHHHHHHHHCCCEEECCCCCEEEEEEEEEEECCHHH------
T ss_conf             7767---64346686-2440369828846726499999999999986593785699946664279997364508------


Q ss_pred             CCCCCCCCCHHHHHHHH-HHHCCHHHHCCCCEE-EECCCCCH--HHHHHHHHHHHHHHHHHHHHCCCEEEECHHHHHHHH
Q ss_conf             68988211148899999-872887881776828-96288999--999999999999999999866988999889999999
Q gi|254780163|r  635 RIGFGSSRNDDADKEAL-RNFLSPEFLNRLDSI-IPFFPLSS--DIIRQVVHKFIMKLELQLQEKGISFHFSEEVINWLV  710 (798)
Q Consensus       635 ~~g~~~~~~~~~~~~~l-~~~f~peflnRid~i-i~F~~l~~--~~~~~i~~~~l~~l~~~l~~~~i~l~~~~~~~~~l~  710 (798)
                                   .+.+ ...|+.+|+-|+... |..-||.+  +++..+++..+.++..+.   +-.+.+++++.+.|.
T Consensus       469 -------------~~~v~~g~fr~dLyyrl~~~~i~lPpLReR~~Di~~L~~~~l~~~~~~~---~~~~~ls~~a~~~L~  532 (639)
T PRK11388        469 -------------AMLVEQNRFSRQLYYALHAFEITIPPLRMRREDIPALVNNKLRSLEKRF---STRLKIDDDALARLV  532 (639)
T ss_pred             -------------HHHHHCCCCHHHHHHHHHHHHCCCCCHHHCHHHHHHHHHHHHHHHHHHC---CCCCCCCHHHHHHHH
T ss_conf             -------------9998749854999987674410573323253439999999999999971---999998999999997


Q ss_pred             HCCCCCCCCCHHHHHHHHHHH
Q ss_conf             718981015326799999862
Q gi|254780163|r  711 SHGYDVKMGARPLERIIKEHV  731 (798)
Q Consensus       711 ~~~~~~~~GAR~l~r~i~~~i  731 (798)
                      ...+--.  -|.|+.++++-+
T Consensus       533 ~y~WPGN--vrEL~nvl~~a~  551 (639)
T PRK11388        533 SYRWPGN--DFELRSVIENLA  551 (639)
T ss_pred             CCCCCCH--HHHHHHHHHHHH
T ss_conf             2899979--999999999999


No 53 
>TIGR03346 chaperone_ClpB ATP-dependent chaperone ClpB. Members of this protein family are the bacterial ATP-dependent chaperone ClpB. This protein belongs to the AAA family, ATPases associated with various cellular activities (pfam00004). This molecular chaperone does not act as a protease, but rather serves to disaggregate misfolded and aggregated proteins.
Probab=99.43  E-value=2.4e-09  Score=86.36  Aligned_cols=65  Identities=18%  Similarity=0.187  Sum_probs=59.8

Q ss_pred             CCHHHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHCCCCHHHHHHHHCCCCHHHHHHHHHHHCCC
Q ss_conf             69899999999999999809981259998787873774299999998499989999999830000
Q gi|254780163|r   82 PTSSFQRVVQRAVLHVQSTGRGIVTGANILVALFSEPDSHATYFLQEQEMTLYDAVNFISHGISK  146 (798)
Q Consensus        82 ~S~~l~rVL~~A~~~A~~~G~~~I~~eHLLLALL~e~ds~a~~iL~~~gis~~~v~~~i~~~~~~  146 (798)
                      ||+.++++|+.|...|..+++.+|+++|||++|+.+.++.+..+|..+|++...+.+.+...+..
T Consensus         1 ft~~a~~aL~~A~~~A~~~~h~~V~~eHlLlaLl~~~~~~~~~~L~~~gvd~~~l~~~l~~~l~~   65 (852)
T TIGR03346         1 FTEKFQEALQAAQSLALGRDHQQIEPEHLLKALLDQEGGLARRLLQKAGVNVGALRQALEKELEK   65 (852)
T ss_pred             CCHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHCCCCCHHHHHHHHCCCCHHHHHHHHHHHHHH
T ss_conf             98899999999999999859990279999999973998479999998598999999999999973


No 54 
>CHL00181 cbbX CbbX; Provisional
Probab=99.43  E-value=1.1e-10  Score=95.97  Aligned_cols=224  Identities=16%  Similarity=0.264  Sum_probs=147.3

Q ss_pred             CCHHHHHHHHCCHHHHHHHCHHHHHHHHHHH-------HHHHHCCCCCCCCCCCEEEEECCCCHHHHHHHHHHHHH----
Q ss_conf             0112334210000246653458999999999-------87752044565787406886143200388999998730----
Q gi|254780163|r  462 RDDDSVLSNLEKNLGTVVYGQEEAIKKLSSS-------IKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFA----  530 (798)
Q Consensus       462 ~~~~~~l~~l~~~l~~~v~GQ~~ai~~v~~~-------i~~~~~gl~~~~rP~g~flf~GptGvGKTelak~la~~----  530 (798)
                      ..++..+..+-..|.+..||-+.....|-.-       ..|...|+..+... -.++|+||+|+|||..|+.+|..    
T Consensus         8 ~~~~~~lee~L~eLd~eliGL~~VK~~v~~l~~~~~~~~~R~~~Gl~~~~~s-~h~vF~GnPGTGKTTVARl~a~il~~l   86 (287)
T CHL00181          8 EYNKTQIQEVLDELDEELIGLVPVKTRIREIAALLLVDRLRKNLGLVSSSPG-LHMSFTGSPGTGKTTVALKMADILYRL   86 (287)
T ss_pred             HHHHCCHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCC-CEEEEECCCCCCHHHHHHHHHHHHHHC
T ss_conf             8645349999999988646969999999999999999999998799988876-538887899867999999999999986


Q ss_pred             ---CCCCEEEEEHHHHHCCCCCCHHCCCCCHHCCCCCCCCCCH-HHHHCCCEEEEECCHHH---------CCHHHHHHHH
Q ss_conf             ---4773377206886124653011047800025644431003-55515851777404455---------0289999999
Q gi|254780163|r  531 ---LGVQLLRFDMSEYMERHAVSRLIGAPPGYVGFGQGGILAD-SVDQNPYSVVLLDEIEK---------SHPDVLNILL  597 (798)
Q Consensus       531 ---~~~~lir~dmsey~e~~~vs~LiGappGYvG~~egg~Lte-~vr~~P~sVvl~DEiEK---------Ah~~v~~~ll  597 (798)
                         ....++-.+-         +.|+|   +|||.-  +.-|. .+.+.--.|+++||---         --.++.+.|+
T Consensus        87 G~L~~g~vve~~r---------~dLvg---~yvG~T--a~kt~~~i~~a~GGVLfIDEAY~L~~~~~~~dfg~eaidtLl  152 (287)
T CHL00181         87 GYIKKGHLITVTR---------DDLVG---QYIGHT--APKTKEVLKKAMGGVLFIDEAYYLYKPDNERDYGAEAIEILL  152 (287)
T ss_pred             CCCCCCEEEEECH---------HHHCC---CCCCCC--HHHHHHHHHHCCCCEEEEECHHHHCCCCCCCCCHHHHHHHHH
T ss_conf             9955895899535---------88416---353521--699999999645987998244653578899983799999999


Q ss_pred             HHHHHHHCCCCCCCEECCCCEEEEEECCCCHHHHHHCCCCCCCCCCHHHHHHHHHHHCCHHHHCCCCEEEECCCCCHHHH
Q ss_conf             98777502177997761254299994242145533036898821114889999987288788177682896288999999
Q gi|254780163|r  598 QIMDYGILTDQSGKKISFRNVILIMTTNAGALEMSKARIGFGSSRNDDADKEALRNFLSPEFLNRLDSIIPFFPLSSDII  677 (798)
Q Consensus       598 qild~G~ltd~~Gr~vdf~n~iii~TsN~G~~~~~~~~~g~~~~~~~~~~~~~l~~~f~peflnRid~ii~F~~l~~~~~  677 (798)
                      +.|++.+     +      +.++|+.             |+      ...|+..-. ..|-|-.|+...+.|..++++++
T Consensus       153 ~~me~~~-----~------~lvvI~A-------------GY------~~eM~~fl~-~NpGL~sRf~~~i~F~dYt~~EL  201 (287)
T CHL00181        153 QVMENQR-----D------DLVVIFA-------------GY------KDRMDKFYE-SNPGLSSRVANHVDFPDYTPEEL  201 (287)
T ss_pred             HHHHHCC-----C------CEEEEEE-------------CC------HHHHHHHHH-HCCCHHHHCCCEEECCCCCHHHH
T ss_conf             9987079-----9------8899984-------------67------899999998-59047876887237798599999


Q ss_pred             HHHHHHHHHHHHHHHHHCCCEEEECHH----HHHHHHHCCCCCCCC-CHHHHHHHHHHHHHHHHHHHH
Q ss_conf             999999999999999866988999889----999999718981015-326799999862359999996
Q gi|254780163|r  678 RQVVHKFIMKLELQLQEKGISFHFSEE----VINWLVSHGYDVKMG-ARPLERIIKEHVKVPLADEIL  740 (798)
Q Consensus       678 ~~i~~~~l~~l~~~l~~~~i~l~~~~~----~~~~l~~~~~~~~~G-AR~l~r~i~~~i~~~la~~il  740 (798)
                      .+|...++.       ++++.  ++++    +.+++...--.+.|| ||-+++++++-+...-.+.+.
T Consensus       202 ~~I~~~~~~-------~~~~~--l~~~a~~~l~~~~~~~~~~~~FGNaR~vrnl~e~a~~~qa~Rl~~  260 (287)
T CHL00181        202 LQIAKMMLE-------EQQYQ--LTPEAEKVLLDYIKRRMEQPLFANARSVRNAIDRARMRQANRIFA  260 (287)
T ss_pred             HHHHHHHHH-------HCCCC--CCHHHHHHHHHHHHHHCCCCCCCCHHHHHHHHHHHHHHHHHHHHC
T ss_conf             999999999-------86982--587999999999998508999874899999999999999988656


No 55 
>cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold. The ASCE division also includes ABC, RecA-like, VirD4-like, PilT-like, and SF1/2 helicases. Members of the AAA+ ATPases function as molecular chaperons, ATPase subunits of proteases, helicases, or nucleic-acid stimulated ATPases. The AAA+ proteins contain several distinct features in addition to the conserved alpha-beta-alpha core domain structure and the Walker A and B motifs of the P-loop NTPases.
Probab=99.43  E-value=2.3e-12  Score=108.03  Aligned_cols=146  Identities=29%  Similarity=0.403  Sum_probs=103.5

Q ss_pred             CHHHHHHHHHHHHHHHHCCCCCCCCCCCEEEEECCCCHHHHHHHHHHHHHC---CCCEEEEEHHHHHCCCCCCHHCCCCC
Q ss_conf             458999999999877520445657874068861432003889999987304---77337720688612465301104780
Q gi|254780163|r  481 GQEEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFAL---GVQLLRFDMSEYMERHAVSRLIGAPP  557 (798)
Q Consensus       481 GQ~~ai~~v~~~i~~~~~gl~~~~rP~g~flf~GptGvGKTelak~la~~~---~~~lir~dmsey~e~~~vs~LiGapp  557 (798)
                      ||+..+..+...+..         .|....||.||+|+|||.+|+++|..+   +..++.++++++......+...+.  
T Consensus         2 ~~~~~~~~l~~~~~~---------~~~~~ill~GppGtGKT~la~~ia~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~--   70 (151)
T cd00009           2 GQEEAIEALREALEL---------PPPKNLLLYGPPGTGKTTLARAIANELFRPGAPFLYLNASDLLEGLVVAELFGH--   70 (151)
T ss_pred             CCHHHHHHHHHHHHC---------CCCCEEEEECCCCCCHHHHHHHHHHHHCCCCCCEEEEEHHHCCHHHHHHHHHHH--
T ss_conf             857999999999818---------799808998999988659999999971213798278547770467777576057--


Q ss_pred             HHCCCCCCCCCCHHHHHCCCEEEEECCHHHCCHHHHHHHHHHHHHHHCCCCCCCEECCCCEEEEEECCCCHHHHHHCCCC
Q ss_conf             00256444310035551585177740445502899999999877750217799776125429999424214553303689
Q gi|254780163|r  558 GYVGFGQGGILADSVDQNPYSVVLLDEIEKSHPDVLNILLQIMDYGILTDQSGKKISFRNVILIMTTNAGALEMSKARIG  637 (798)
Q Consensus       558 GYvG~~egg~Lte~vr~~P~sVvl~DEiEKAh~~v~~~llqild~G~ltd~~Gr~vdf~n~iii~TsN~G~~~~~~~~~g  637 (798)
                           ...............+|+++|||+++.+...+.++++|+.....     .....++.+|++||-...        
T Consensus        71 -----~~~~~~~~~~~~~~~~vl~iDEi~~l~~~~~~~~~~~l~~~~~~-----~~~~~~~~vI~~tn~~~~--------  132 (151)
T cd00009          71 -----FLVRLLFELAEKAKPGVLFIDEIDSLSRGAQNALLRVLETLNDL-----RIDRENVRVIGATNRPLL--------  132 (151)
T ss_pred             -----HHHHHHHHHHHHCCCCEEEEECHHHCCHHHHHHHHHHHHHHCCC-----CCCCCCEEEEEEECCCCC--------
T ss_conf             -----78898999999769986982016655999999999999871575-----406788899995289988--------


Q ss_pred             CCCCCCHHHHHHHHHHHCCHHHHCCCCEEEECC
Q ss_conf             882111488999998728878817768289628
Q gi|254780163|r  638 FGSSRNDDADKEALRNFLSPEFLNRLDSIIPFF  670 (798)
Q Consensus       638 ~~~~~~~~~~~~~l~~~f~peflnRid~ii~F~  670 (798)
                                     ..+.+.+.+|++..+.|.
T Consensus       133 ---------------~~~~~~~~~R~~~~i~~~  150 (151)
T cd00009         133 ---------------GDLDRALYDRLDIRIVIP  150 (151)
T ss_pred             ---------------CCHHHHHHCCCCEEEECC
T ss_conf             ---------------683776425598698638


No 56 
>TIGR01241 FtsH_fam ATP-dependent metallopeptidase HflB; InterPro: IPR005936   Metalloproteases are the most diverse of the four main types of protease, with more than 50 families identified to date. In these enzymes, a divalent cation, usually zinc, activates the water molecule. The metal ion is held in place by amino acid ligands, usually three in number. The known metal ligands are His, Glu, Asp or Lys and at least one other residue is required for catalysis, which may play an electrophillic role. Of the known metalloproteases, around half contain an HEXXH motif, which has been shown in crystallographic studies to form part of the metal-binding site . The HEXXH motif is relatively common, but can be more stringently defined for metalloproteases as 'abXHEbbHbc', where 'a' is most often valine or threonine and forms part of the S1' subsite in thermolysin and neprilysin, 'b' is an uncharged residue, and 'c' a hydrophobic residue. Proline is never found in this site, possibly because it would break the helical structure adopted by this motif in metalloproteases .   Peptidases are grouped into clans and families. Clans are groups of families for which there is evidence of common ancestry. Each clan is identified with two letters, the first representing the catalytic type of the families included in the clan (with the letter 'P' being used for a clan containing families of more than one of the catalytic types serine, threonine and cysteine). Some families cannot yet be assigned to clans, and when a formal assignment is required, such a family is described as belonging to clan A-, C-, M-, S-, T- or U-, according to the catalytic type. Some clans are divided into subclans because there is evidence of a very ancient divergence within the clan, for example MA(E), the gluzincins, and MA(M), the metzincins.   Families are grouped by their catalytic type, the first character representing the catalytic type: A, aspartic; C, cysteine; G, glutamic acid; M, metallo; S, serine; T, threonine; and U, unknown. The serine, threonine and cysteine peptidases utilise the amino acid as a nucleophile and form an acyl intermediate - these peptidases can also readily act as transferases. In the case of aspartic, glutamic and metallopeptidases, the nucleophile is an activated water molecule.    This group of metallopeptidases belong to MEROPS peptidase family M41 (FtsH endopeptidase family, clan MA(E)). The predicted active site residues for members of this family and thermolysin, the type example for clan MA, occur in the motif HEXXH.    FtsH is a membrane-anchored ATP-dependent protease that degrades misfolded or misassembled membrane proteins as well as a subset of cytoplasmic regulatory proteins. FtsH is a 647-residue protein of 70 kDa, with two putative transmembrane segments towards its N terminus which anchor the protein to the membrane, giving rise to a periplasmic domain of 70 residues and a cytoplasmic segment of 520 residues containing the ATPase and protease domains . ; GO: 0004222 metalloendopeptidase activity, 0030163 protein catabolic process, 0016020 membrane.
Probab=99.42  E-value=1.4e-12  Score=109.47  Aligned_cols=231  Identities=25%  Similarity=0.367  Sum_probs=133.3

Q ss_pred             CHHHHHHHHHHHHHHHHHH------------CCCCCCEEEECCCCCHHHHHHHHHHHHHHCCCCCHHHHEEEEEEEEHHH
Q ss_conf             1122217899999999862------------2677874896676411668999999998548988345201445540467
Q gi|254780163|r  203 VDILVGRHEEINRTIQILC------------RRSKNNPLYVGDPGVGKTAIAEGFAKQIVDGMVPDILLGARIFSLDMGN  270 (798)
Q Consensus       203 LDPVIGRd~EI~riiqIL~------------RR~KNn~~lvG~~gvGktaive~la~~i~~~~vp~~l~~~~i~~ld~~~  270 (798)
                      +.=|=|-|++=+.+++|--            =|-=--+|||||||+|||=|+-..|-   +-.||       .|+.+.+.
T Consensus        58 F~DVAG~dEAKeEl~EiVdFLK~P~kf~~LGaKIPKGVLLvGPPGTGKTLLAKAvAG---EA~VP-------FF~iSGSd  127 (505)
T TIGR01241        58 FKDVAGIDEAKEELVEIVDFLKNPSKFTKLGAKIPKGVLLVGPPGTGKTLLAKAVAG---EAGVP-------FFSISGSD  127 (505)
T ss_pred             ECCCCCCHHHHHHHHHHHHHCCCCHHHHHCCCCCCCCEEEECCCCCCHHHHHHHHHC---CCCCC-------CEEECCCC
T ss_conf             234445323334333134222696379872788987147317878424678875202---58896-------24740761


Q ss_pred             HHCCCCCCCHHHHHHHHHHHHHCCCCCEEEEECCHHHH---HCCCCCCCCCCC-H---HHHHHHH----HCCCCEEEEEE
Q ss_conf             53063431237899999998720389839997361663---015544434477-7---8888766----30266038873
Q gi|254780163|r  271 LIAGTRYRGDFEERIKKIVKEIESYANAILYIDEIHTL---VGAGSASGISVD-A---SNLLKPA----LSSGAVRCIGS  339 (798)
Q Consensus       271 l~ag~~~rg~fe~r~~~~~~~~~~~~~~ilfideih~l---igag~~~g~~~d-~---an~lkP~----L~rg~~~~Iga  339 (798)
                      .|=  .+.|==-.|++.+++.++++-+.|.|||||--+   =|||.-+||. | =   =|-|.=-    =++-.+=+|+|
T Consensus       128 FVE--MFVGVGASRVRDLFeqAK~nAPCIIFIDEIDAVGr~RGaG~lGGGn-DEREQTLNQLLVEMDGF~~~~gvIv~AA  204 (505)
T TIGR01241       128 FVE--MFVGVGASRVRDLFEQAKKNAPCIIFIDEIDAVGRQRGAGELGGGN-DEREQTLNQLLVEMDGFGTNTGVIVIAA  204 (505)
T ss_pred             EEE--CCCCCCCEEHHHHHHHHHHHCCCEEEEECHHHCCCCCCCCCCCCCC-CHHHHHHHHHHEECCCCCCCCCEEEEEE
T ss_conf             011--1205640001445799997189705640100003335643667654-1355433233133178589885799850


Q ss_pred             CC-HHHHHHHHHCCHHHHH--HCEE-EEECCCCHHHHHHHHHHHHHHHHHHCCCEECCHHH-HHHHHHHHHHCCCCCCHH
Q ss_conf             04-8999998520111432--0014-43068786899999986127665410351211178-999998654201555646
Q gi|254780163|r  340 TT-YSEYRQFFEKDKALVR--RFQK-IDVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAI-RAAVQLSVRHFTSRKLPD  414 (798)
Q Consensus       340 tT-~~ey~~~~e~d~al~r--rF~~-i~v~ep~~~~~~~iL~~~~~~ye~~h~v~~~~~al-~~av~ls~ryi~~r~lPd  414 (798)
                      |- ||      ==|+||.|  ||.+ |.|+-|+...=.+||+-=.      +++++.+++- ...++..-=| ++=-|  
T Consensus       205 TNRPD------vLD~ALLRPGRFDRQv~V~~PD~~GR~~IL~VH~------~~~kLa~~vdL~~~Ar~TPGf-SGADL--  269 (505)
T TIGR01241       205 TNRPD------VLDPALLRPGRFDRQVVVDLPDIKGREEILKVHA------KNKKLAPDVDLKAVARRTPGF-SGADL--  269 (505)
T ss_pred             CCCCC------CCCCCCCCCCCCCCEEECCCCCHHHHHHHHHHHH------CCCCCCCCCCHHHHHHHCCCC-CHHHH--
T ss_conf             48841------1651006878744513458887467899999985------488997024779997015687-67889--


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHCCCCCCHHHHHCCHHHH
Q ss_conf             79889986533332114432211365789998663102453101110011233
Q gi|254780163|r  415 KAIDVIDEAGASQILQPLSKRRKFITEKDIKKTIASMNRSIHTTSFSRDDDSV  467 (798)
Q Consensus       415 kAidllDea~a~~~~~~~~~~~~~~~~~~i~~~~~~~~~gip~~~~~~~~~~~  467 (798)
                        =.|+.||    .+-+....+..|+..|+.+.+-+..-|.-...+.-++.+|
T Consensus       270 --aNl~NEA----ALlAAR~n~~~i~~~~~eeA~Drv~~G~ekKsr~is~~eK  316 (505)
T TIGR01241       270 --ANLLNEA----ALLAARKNKTEITMNDIEEAVDRVIAGLEKKSRVISEKEK  316 (505)
T ss_pred             --HHHHHHH----HHHHHHCCCCEECHHHHHHHHHHHHCCCCCCCCCCCHHHC
T ss_conf             --9999999----9998617986562888987877652276678853267774


No 57 
>PRK13341 recombination factor protein RarA/unknown domain fusion protein; Reviewed
Probab=99.41  E-value=6.2e-12  Score=104.90  Aligned_cols=99  Identities=16%  Similarity=0.211  Sum_probs=49.1

Q ss_pred             CCCCCHHHHHHHHHHHHHHHHCCC----CCCCHHHHHH------HHHHCHHHH-HHHH-HCCCCHHHHHHHHHHHHHHCC
Q ss_conf             973438999999999999998289----9511999999------982074689-9999-859998999999999964136
Q gi|254780163|r    1 MSFFSENLEKVLHQALVLANERNH----EYATLEHLLL------ALIDDSDAA-IVML-SCNVDLKVLKNNLLNYIDNDS   68 (798)
Q Consensus         1 M~mfS~~a~~vL~~A~~lAk~~~H----~~Vt~EHLLL------aLL~d~~~~-~iL~-~~giD~~~Lk~~Le~~L~~~~   68 (798)
                      |+.|+-...+-.....=+|.+++-    ++|+=+||+-      -+++.+... -||- --|+--    ..+...+.+..
T Consensus         1 mdlf~~~~~~~~~~~aPLA~rmRP~~Lde~vGQ~hllg~g~~Lrr~i~~~~~~S~Il~GPPGtGK----TTLA~iIA~~t   76 (726)
T PRK13341          1 MDLFAFHGEQQRRSEAPLADRLRPRTLEEFVGQDHILGEGRLLRRAIKADRVGSLILYGPPGVGK----TTLARIIANHT   76 (726)
T ss_pred             CCHHHHHHHHHHHCCCCCHHHHCCCCHHHHCCCHHHCCCCCHHHHHHHCCCCCEEEEECCCCCCH----HHHHHHHHHHH
T ss_conf             96155647765332698568629998777359575428982899999769998278889799999----99999998874


Q ss_pred             CCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHCCCCC
Q ss_conf             545778886776469899999999999999809981
Q gi|254780163|r   69 SNKLKNGFRVECKPTSSFQRVVQRAVLHVQSTGRGI  104 (798)
Q Consensus        69 ~~~~~~~~~~ei~~S~~l~rVL~~A~~~A~~~G~~~  104 (798)
                      ...+..- .-...-..+++++++.|...-..+|...
T Consensus        77 ~~~F~~l-sAv~sgvkdlr~ii~~A~~~~~~~g~~t  111 (726)
T PRK13341         77 RAHFSSL-NAVLAGVKDLRAEVDAAKERLERHGKRT  111 (726)
T ss_pred             CCCEEEE-ECCCCCHHHHHHHHHHHHHHHHHCCCCE
T ss_conf             8867998-5620377999999999999987459965


No 58 
>PRK12402 replication factor C small subunit 2; Reviewed
Probab=99.40  E-value=1.3e-11  Score=102.69  Aligned_cols=204  Identities=17%  Similarity=0.215  Sum_probs=136.5

Q ss_pred             HHHHHCCCCHHHHHHHHHHHHHHHHHHCCCCCCEEEECCCCCHHHHHHHHHHHHHHCCCCCHH----------HHEEEEE
Q ss_conf             887754861122217899999999862267787489667641166899999999854898834----------5201445
Q gi|254780163|r  195 TEKVKKGKVDILVGRHEEINRTIQILCRRSKNNPLYVGDPGVGKTAIAEGFAKQIVDGMVPDI----------LLGARIF  264 (798)
Q Consensus       195 Te~AreGKLDPVIGRd~EI~riiqIL~RR~KNn~~lvG~~gvGktaive~la~~i~~~~vp~~----------l~~~~i~  264 (798)
                      +++-|=-.+|-|+|-+.-++.+...+..++-.+-++.|+||+|||+.+.-+|+.+.-......          -+++..+
T Consensus         6 veKYRP~~~~dvvGq~~i~~~L~~~~~~~~~phlLf~GPpG~GKTt~A~~lA~~l~~~~~~~~~~~~nasd~~~~~~~~i   85 (337)
T PRK12402          6 TEKYRPSLFEDILGQESVVDHLSALAASGNLPHLVVYGPSGSGKTAAVRALARELYGDPWENNFTYFNVSDFFDQGKKYL   85 (337)
T ss_pred             CCCCCCCCHHHHCCCHHHHHHHHHHHHCCCCCEEEEECCCCCCHHHHHHHHHHHHCCCCCCCCCCEECCCCCCCCCCCEE
T ss_conf             21418897998039799999999999779987698889298489999999999967997567833311653113564001


Q ss_pred             EEEH--HHHHCCCCCCCH-HHHHHHHHHHHHCCC-----CCEEEEECCHHHHHCCCCCCCCCCCHHHHHHHHHC--CCCE
Q ss_conf             5404--675306343123-789999999872038-----98399973616630155444344777888876630--2660
Q gi|254780163|r  265 SLDM--GNLIAGTRYRGD-FEERIKKIVKEIESY-----ANAILYIDEIHTLVGAGSASGISVDASNLLKPALS--SGAV  334 (798)
Q Consensus       265 ~ld~--~~l~ag~~~rg~-fe~r~~~~~~~~~~~-----~~~ilfideih~ligag~~~g~~~d~an~lkP~L~--rg~~  334 (798)
                      .-|-  ..++.+..-.|. .-.-++.++++....     +--|++|||.|.+         +-+|.|-|...|.  ....
T Consensus        86 ~~~~~~~~~~~~~~~~~~~~~d~i~~ii~~~a~~~p~~~~~KiiIlDEad~l---------t~~Aq~aLlk~lEe~~~~~  156 (337)
T PRK12402         86 VEDPRFAHFYDDPKRKYKSVIDNFKHILKEYASMRPLSADYKLILFDNAEAL---------REDAQQALRRIMERYSETC  156 (337)
T ss_pred             ECCCCHHHHHCCHHHCCCCHHHHHHHHHHHHHCCCCCCCCEEEEEEECCCCC---------CHHHHHHHHHHHHCCCCCE
T ss_conf             0166423442015332773789999999998614887788049997071317---------9999999998874088766


Q ss_pred             EEEEECCHHHHHHHHHCCHHHHHHCEEEEECCCCHHHHHHHHHHHHHHHHHHCCCEECCHHHHHHHHHHHHHCCCCCCHH
Q ss_conf             38873048999998520111432001443068786899999986127665410351211178999998654201555646
Q gi|254780163|r  335 RCIGSTTYSEYRQFFEKDKALVRRFQKIDVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLPD  414 (798)
Q Consensus       335 ~~IgatT~~ey~~~~e~d~al~rrF~~i~v~ep~~~~~~~iL~~~~~~ye~~h~v~~~~~al~~av~ls~ryi~~r~lPd  414 (798)
                      ++|-+||..  .+.+   +++-.|-+.+....|+.++-...|+.+...    .++.++++++...+..|..-      ..
T Consensus       157 ~fIl~t~~~--~~ii---~tI~SRC~~i~F~~~s~~~i~~~L~~I~~~----E~i~~~~~~l~~ia~~s~Gd------lR  221 (337)
T PRK12402        157 RFIFSTTQP--SKLI---PPIRSRCLPLFFRPVPDDEIRSVLESIAAA----EGVEISDDGLDLIAYYAEGD------LR  221 (337)
T ss_pred             EEEEECCCC--CCCC---HHHHHHCEEEECCCCCHHHHHHHHHHHHHH----CCCCCCHHHHHHHHHHCCCC------HH
T ss_conf             998723864--4475---247762445435898999999999999998----49998999999999986998------99


Q ss_pred             HHHHHHHH
Q ss_conf             79889986
Q gi|254780163|r  415 KAIDVIDE  422 (798)
Q Consensus       415 kAidllDe  422 (798)
                      +||.+|.-
T Consensus       222 ~ain~Lq~  229 (337)
T PRK12402        222 KAILTLQL  229 (337)
T ss_pred             HHHHHHHH
T ss_conf             99999999


No 59 
>COG0464 SpoVK ATPases of the AAA+ class [Posttranslational modification, protein turnover, chaperones]
Probab=99.39  E-value=5.6e-11  Score=98.07  Aligned_cols=195  Identities=25%  Similarity=0.359  Sum_probs=129.2

Q ss_pred             CEEEECCCCCHHHHHHHHHHHHHHCCCCCHHHHEEEEEEEEHHHHHCCCCCCCHHHHHHHHHHHHHCCCCCEEEEECCHH
Q ss_conf             74896676411668999999998548988345201445540467530634312378999999987203898399973616
Q gi|254780163|r  227 NPLYVGDPGVGKTAIAEGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIESYANAILYIDEIH  306 (798)
Q Consensus       227 n~~lvG~~gvGktaive~la~~i~~~~vp~~l~~~~i~~ld~~~l~ag~~~rg~fe~r~~~~~~~~~~~~~~ilfideih  306 (798)
                      -.+|.|+||.|||.++..+|.          ..+.++++++...+  -.+|-||.|..++.++..+++....|+||||+.
T Consensus       278 giLl~GpPGtGKT~lAkava~----------~~~~~fi~v~~~~l--~sk~vGesek~ir~~F~~A~~~~p~iifiDEiD  345 (494)
T COG0464         278 GVLLYGPPGTGKTLLAKAVAL----------ESRSRFISVKGSEL--LSKWVGESEKNIRELFEKARKLAPSIIFIDEID  345 (494)
T ss_pred             EEEEECCCCCCHHHHHHHHHH----------HCCCCEEEECCHHH--HHHHHHHHHHHHHHHHHHHHHCCCCEEEHHHHH
T ss_conf             699988999758999999875----------44982488433555--407765999999999999996699889748866


Q ss_pred             HHHCCCCCCCC-CC-CH-HHHHHHH--H-CCCCEEEEEECCHHHHHHHHHCCHHHHH--HCEE-EEECCCCHHHHHHHHH
Q ss_conf             63015544434-47-77-8888766--3-0266038873048999998520111432--0014-4306878689999998
Q gi|254780163|r  307 TLVGAGSASGI-SV-DA-SNLLKPA--L-SSGAVRCIGSTTYSEYRQFFEKDKALVR--RFQK-IDVSEPSIEDAIEIVK  377 (798)
Q Consensus       307 ~ligag~~~g~-~~-d~-an~lkP~--L-~rg~~~~IgatT~~ey~~~~e~d~al~r--rF~~-i~v~ep~~~~~~~iL~  377 (798)
                      .+....+.++. +. .+ .++|.-.  + ....+.+||||....     .-|+|+-|  ||+. +.|..|+.++...|++
T Consensus       346 s~~~~r~~~~~~~~~rv~~~ll~~~d~~e~~~~v~vi~aTN~p~-----~ld~a~lR~gRfd~~i~v~~pd~~~r~~i~~  420 (494)
T COG0464         346 SLASGRGPSEDGSGRRVVGQLLTELDGIEKAEGVLVIAATNRPD-----DLDPALLRPGRFDRLIYVPLPDLEERLEIFK  420 (494)
T ss_pred             HHHCCCCCCCCCHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCC-----CCCHHHHCCCCCEEEEEECCCCHHHHHHHHH
T ss_conf             67412899876379999999999974754437648996479833-----2687562436630378717989899999999


Q ss_pred             HHHHHHHHHCCCEECCHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHHH-HCCCCHHHHHHHHHH
Q ss_conf             6127665410351211178999998654201555646798899865333321144322-113657899986631
Q gi|254780163|r  378 GIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLPDKAIDVIDEAGASQILQPLSKR-RKFITEKDIKKTIAS  450 (798)
Q Consensus       378 ~~~~~ye~~h~v~~~~~al~~av~ls~ryi~~r~lPdkAidllDea~a~~~~~~~~~~-~~~~~~~~i~~~~~~  450 (798)
                      -...+....   ...+--+...++.+     +.+..--...++.+|+    +....+. ...++.+|....+..
T Consensus       421 ~~~~~~~~~---~~~~~~~~~l~~~t-----~~~sgadi~~i~~ea~----~~~~~~~~~~~~~~~~~~~a~~~  482 (494)
T COG0464         421 IHLRDKKPP---LAEDVDLEELAEIT-----EGYSGADIAALVREAA----LEALREARRREVTLDDFLDALKK  482 (494)
T ss_pred             HHHCCCCCC---HHHHHHHHHHHHHH-----CCCCHHHHHHHHHHHH----HHHHHHCCCCCCCHHHHHHHHHH
T ss_conf             985415651---15564199999875-----2778999999999999----98998545776349999999862


No 60 
>PRK10820 DNA-binding transcriptional regulator TyrR; Provisional
Probab=99.39  E-value=3.3e-11  Score=99.71  Aligned_cols=215  Identities=20%  Similarity=0.287  Sum_probs=156.8

Q ss_pred             HHHHHCHHHHHHHHHHHHHHHHCCCCCCCCCCCEEEEECCCCHHHHHHHHHHHHHC---CCCEEEEEHHHHHCCCCCCHH
Q ss_conf             46653458999999999877520445657874068861432003889999987304---773377206886124653011
Q gi|254780163|r  476 GTVVYGQEEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFAL---GVQLLRFDMSEYMERHAVSRL  552 (798)
Q Consensus       476 ~~~v~GQ~~ai~~v~~~i~~~~~gl~~~~rP~g~flf~GptGvGKTelak~la~~~---~~~lir~dmsey~e~~~vs~L  552 (798)
                      -..+||+.+++..+.+..++.    ...+.|   .|..|.||+||..+|+++-..+   ..+|+.+||+-..+..--|.|
T Consensus       203 F~~iig~S~~m~~v~~~a~r~----A~~d~p---VLI~GEsGTGKellAraIH~~S~R~~~pFv~vnC~alp~~l~eseL  275 (513)
T PRK10820        203 FSQIVAVSPKMKHVVEQARKL----AMLSAP---LLITGDTGTGKDLFAYACHLASPRAKKPYLALNCASIPEDAVESEL  275 (513)
T ss_pred             HHHHEECCHHHHHHHHHHHHH----HCCCCC---EEEECCCCCCHHHHHHHHHHCCCCCCCCCEEEECCCCCHHHHHHHH
T ss_conf             777510899999999999998----598998---8998989824999999999668878998268889989967899986


Q ss_pred             CCCCCHHCCCCCCCCCCHHHHHCCCEEEEECCHHHCCHHHHHHHHHHHHHHHCCC---CCCCEECCCCEEEEEECCCCHH
Q ss_conf             0478000256444310035551585177740445502899999999877750217---7997761254299994242145
Q gi|254780163|r  553 IGAPPGYVGFGQGGILADSVDQNPYSVVLLDEIEKSHPDVLNILLQIMDYGILTD---QSGKKISFRNVILIMTTNAGAL  629 (798)
Q Consensus       553 iGappGYvG~~egg~Lte~vr~~P~sVvl~DEiEKAh~~v~~~llqild~G~ltd---~~Gr~vdf~n~iii~TsN~G~~  629 (798)
                      .|.-+    -+.-|.+-    ..--.-++||||+-..++++.-||++|++|..+-   ..-..+   |+=||.+||.-  
T Consensus       276 FG~a~----~~~~G~fe----~A~gGTLfLdEI~~l~~~~Q~kLLr~Lq~~~~~rvG~~~~~~~---dvRiIaaT~~d--  342 (513)
T PRK10820        276 FGHAP----EGKKGFFE----QANGGSVLLDEIGEMSPRMQAKLLRFLNDGTFRRVGEDHEVHV---DVRVICATQKN--  342 (513)
T ss_pred             CCCCC----CCCCCCEE----ECCCCEEEEECHHHCCHHHHHHHHHHHHCCEEEECCCCCEEEE---EEEEEECCCHH--
T ss_conf             38766----68897557----8589889997836599999999999986897996599853567---78999626530--


Q ss_pred             HHHHCCCCCCCCCCHHHHHHHH-HHHCCHHHHCCCCEEE-ECCCCC--HHHHHHHHHHHHHHHHHHHHHCCCEEEECHHH
Q ss_conf             5330368988211148899999-8728878817768289-628899--99999999999999999998669889998899
Q gi|254780163|r  630 EMSKARIGFGSSRNDDADKEAL-RNFLSPEFLNRLDSII-PFFPLS--SDIIRQVVHKFIMKLELQLQEKGISFHFSEEV  705 (798)
Q Consensus       630 ~~~~~~~g~~~~~~~~~~~~~l-~~~f~peflnRid~ii-~F~~l~--~~~~~~i~~~~l~~l~~~l~~~~i~l~~~~~~  705 (798)
                                       ..+.+ +..|+.+|.-|+..+. ..-||.  .+++..+++.++.++..+....  ...+++++
T Consensus       343 -----------------L~~lv~~g~FReDLyyRL~v~~I~lPpLReR~eDI~~L~~~fl~~~~~~~g~~--~~~ls~~a  403 (513)
T PRK10820        343 -----------------LVELVQKGLFREDLYYRLNVLTLNLPPLRDCPQDIMPLTELFVARFADEQGVP--RPKLSADL  403 (513)
T ss_pred             -----------------HHHHHHCCCCCHHHHHHHHCCCCCCCCHHHCHHHHHHHHHHHHHHHHHHCCCC--CCCCCHHH
T ss_conf             -----------------99998729850889998616725588834465569999999999999975999--89847999


Q ss_pred             HHHHHHCCCCCCCCCHHHHHHHHHHH
Q ss_conf             99999718981015326799999862
Q gi|254780163|r  706 INWLVSHGYDVKMGARPLERIIKEHV  731 (798)
Q Consensus       706 ~~~l~~~~~~~~~GAR~l~r~i~~~i  731 (798)
                      .++|....+-  --.|.|+.+|++-+
T Consensus       404 ~~~L~~y~WP--GNVREL~n~iera~  427 (513)
T PRK10820        404 STVLTRYGWP--GNVRQLKNAIYRAL  427 (513)
T ss_pred             HHHHHHCCCC--CHHHHHHHHHHHHH
T ss_conf             9999708999--79999999999999


No 61 
>TIGR03345 VI_ClpV1 type VI secretion ATPase, ClpV1 family. Members of this protein family are homologs of ClpB, an ATPase associated with chaperone-related functions. These ClpB homologs, designated ClpV1, are a key component of the bacterial pathogenicity-associated type VI secretion system.
Probab=99.38  E-value=1.1e-09  Score=88.69  Aligned_cols=64  Identities=19%  Similarity=0.223  Sum_probs=58.8

Q ss_pred             CCHHHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHCCCCHHHHHHHHCCCCHHHHHHHHHHHCC
Q ss_conf             6989999999999999980998125999878787377429999999849998999999983000
Q gi|254780163|r   82 PTSSFQRVVQRAVLHVQSTGRGIVTGANILVALFSEPDSHATYFLQEQEMTLYDAVNFISHGIS  145 (798)
Q Consensus        82 ~S~~l~rVL~~A~~~A~~~G~~~I~~eHLLLALL~e~ds~a~~iL~~~gis~~~v~~~i~~~~~  145 (798)
                      +||.++++|+.|...|..+++++|+++|||+||+.++++.+..+|.++|++...+.+.+...+.
T Consensus         1 Lt~~~~~aL~~A~~~A~~~~H~~I~~eHLLlaLl~~~~~~~~~iL~~~gvd~~~l~~~l~~~l~   64 (852)
T TIGR03345         1 LNPTSRRALEQAAALCVARGHPEVELEHWLLALLDQPDSDLAAILRHFGVDLGRLKADLARALD   64 (852)
T ss_pred             CCHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHCCCCCHHHHHHHHCCCCHHHHHHHHHHHHH
T ss_conf             9889999999999999985998138999999998399747999999869999999999999996


No 62 
>pfam00004 AAA ATPase family associated with various cellular activities (AAA). AAA family proteins often perform chaperone-like functions that assist in the assembly, operation, or disassembly of protein complexes.
Probab=99.35  E-value=9.8e-12  Score=103.47  Aligned_cols=118  Identities=33%  Similarity=0.584  Sum_probs=87.3

Q ss_pred             EEEECCCCCHHHHHHHHHHHHHHCCCCCHHHHEEEEEEEEHHHHHCCCCCCCHHHHHHHHHHHHHCCCCCEEEEECCHHH
Q ss_conf             48966764116689999999985489883452014455404675306343123789999999872038983999736166
Q gi|254780163|r  228 PLYVGDPGVGKTAIAEGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIESYANAILYIDEIHT  307 (798)
Q Consensus       228 ~~lvG~~gvGktaive~la~~i~~~~vp~~l~~~~i~~ld~~~l~ag~~~rg~fe~r~~~~~~~~~~~~~~ilfideih~  307 (798)
                      .+|.|+||+|||.+++.+|...          +..+++++...+.  .+|.|+-+++++.++++++...+.||||||+|.
T Consensus         1 iLl~GppGtGKT~~a~~la~~~----------~~~~~~v~~~~~~--~~~~g~~~~~i~~~f~~a~~~~p~Il~iDe~d~   68 (131)
T pfam00004         1 LLLYGPPGTGKTTLAKAVAKEL----------GAPFIEISGSELV--SKYVGESEKRLRELFEAAKKLAPCVIFIDEIDA   68 (131)
T ss_pred             CEEECCCCCCHHHHHHHHHHHH----------CCCCEECCCCCCC--CCCCCHHHHHHHHHHHHHHHCCCCEEEECHHHH
T ss_conf             9878999999999999999997----------8985332420122--233450688899999999974991898311677


Q ss_pred             HHCCCCCCCC--CCCHHHHHHHHHCC-----CCEEEEEECCHHHHHHHHHCCHHHHH-HCEEE
Q ss_conf             3015544434--47778888766302-----66038873048999998520111432-00144
Q gi|254780163|r  308 LVGAGSASGI--SVDASNLLKPALSS-----GAVRCIGSTTYSEYRQFFEKDKALVR-RFQKI  362 (798)
Q Consensus       308 ligag~~~g~--~~d~an~lkP~L~r-----g~~~~IgatT~~ey~~~~e~d~al~r-rF~~i  362 (798)
                      +.+.....++  ...+.+.|.+.|..     +.+-+||+|..-+     .-|+|+-| ||+.+
T Consensus        69 l~~~~~~~~~~~~~~~~~~ll~~ld~~~~~~~~v~~I~tTN~~~-----~ld~al~r~Rfd~~  126 (131)
T pfam00004        69 LAGSRGSGGDSESRRVVNQLLTELDGFTSSLSKVIVIAATNRPD-----KLDPALLRGRFDRI  126 (131)
T ss_pred             HHCCCCCCCCCCCHHHHHHHHHHHHHCCCCCCCEEEEEECCCHH-----HCCHHHHCCCCEEE
T ss_conf             75167888887513268789999850224688769999759904-----49977962833289


No 63 
>PRK04195 replication factor C large subunit; Provisional
Probab=99.34  E-value=1.7e-11  Score=101.71  Aligned_cols=180  Identities=20%  Similarity=0.329  Sum_probs=117.5

Q ss_pred             HHHHHCCCCHHHHHHHHHHHHHHHHHHC----C-CCCCEEEECCCCCHHHHHHHHHHHHHHCCCCCHHHHEEEEEEEEHH
Q ss_conf             8877548611222178999999998622----6-7787489667641166899999999854898834520144554046
Q gi|254780163|r  195 TEKVKKGKVDILVGRHEEINRTIQILCR----R-SKNNPLYVGDPGVGKTAIAEGFAKQIVDGMVPDILLGARIFSLDMG  269 (798)
Q Consensus       195 Te~AreGKLDPVIGRd~EI~riiqIL~R----R-~KNn~~lvG~~gvGktaive~la~~i~~~~vp~~l~~~~i~~ld~~  269 (798)
                      +++-|=..++-++|-+.-++.+.+-|..    + .+...+|.|+||||||++++.+|...          |..+++++.+
T Consensus         5 veKYRPk~~~divg~~~~v~~l~~Wl~~w~~g~~~~k~lLL~GPpGvGKTT~a~~lAk~~----------g~~viElNAS   74 (403)
T PRK04195          5 VEKYRPKSLSDVVGNEKAKKQLREWIESWLKGKPPKKALLLYGPPGVGKTSLAHALANDY----------GWEVIELNAS   74 (403)
T ss_pred             CCCCCCCCHHHHHCCHHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCHHHHHHHHHHHH----------CCCEEEECCC
T ss_conf             402189989998588999999999999987399657469988939987999999999984----------9985997710


Q ss_pred             HHHCCCCCCCHHHHHHHHHHHHHCC------CCCEEEEECCHHHHHCCCCCCCCCCCHHHHHHHHHCCCCEEEEEECCHH
Q ss_conf             7530634312378999999987203------8983999736166301554443447778888766302660388730489
Q gi|254780163|r  270 NLIAGTRYRGDFEERIKKIVKEIES------YANAILYIDEIHTLVGAGSASGISVDASNLLKPALSSGAVRCIGSTTYS  343 (798)
Q Consensus       270 ~l~ag~~~rg~fe~r~~~~~~~~~~------~~~~ilfideih~ligag~~~g~~~d~an~lkP~L~rg~~~~IgatT~~  343 (798)
                      .    ..-+    +.++.++.....      .+.-|+++||+|.+-|.+-.+| --..-+++|    .....+|..++ +
T Consensus        75 D----~R~~----~~I~~~i~~~~~~~sl~~~~~KlIIlDEvD~l~~~~d~gg-~~al~~~ik----~s~~PiIli~N-d  140 (403)
T PRK04195         75 D----QRTK----DVIERVAGEASTSGSLFGAKRKLILLDEVDGIHGNADRGG-VRAILEIIK----KAKNPIILTAN-D  140 (403)
T ss_pred             C----CCCH----HHHHHHHHHHHHCCCCCCCCCEEEEEECCCCCCCHHHHHH-HHHHHHHHH----CCCCEEEEEEC-C
T ss_conf             1----1478----9999999987606887788734999634344572444799-999999985----48870899826-8


Q ss_pred             HHHHHHHCCHHHHHHCEEEEECCCCHHHHHHHHHHHHHHHHHHCCCEECCHHHHHHHHHHHH
Q ss_conf             99998520111432001443068786899999986127665410351211178999998654
Q gi|254780163|r  344 EYRQFFEKDKALVRRFQKIDVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVR  405 (798)
Q Consensus       344 ey~~~~e~d~al~rrF~~i~v~ep~~~~~~~iL~~~~~~ye~~h~v~~~~~al~~av~ls~r  405 (798)
                      -|.+.+   +.|..|-+.|....|+.++-...|+.+..    ..++.+++++|...++.|.-
T Consensus       141 ~~~~~~---~~lrs~c~~i~F~~~~~~~I~~~L~~I~~----~Egi~i~~~aL~~Ia~~s~G  195 (403)
T PRK04195        141 PYDPSL---RPLRNACLMIEFKRLSKRSIVPVLKRICR----KEGIECEEEALREIAERSGG  195 (403)
T ss_pred             CCCCCH---HHHHHHHHHCCCCCCCHHHHHHHHHHHHH----HCCCCCCHHHHHHHHHHCCC
T ss_conf             455671---77997661221799499999999999999----76999999999999998797


No 64 
>PRK10865 protein disaggregation chaperone; Provisional
Probab=99.33  E-value=7.3e-08  Score=75.68  Aligned_cols=66  Identities=12%  Similarity=0.164  Sum_probs=60.9

Q ss_pred             CCCHHHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHCCCCHHHHHHHHCCCCHHHHHHHHHHHCCC
Q ss_conf             469899999999999999809981259998787873774299999998499989999999830000
Q gi|254780163|r   81 KPTSSFQRVVQRAVLHVQSTGRGIVTGANILVALFSEPDSHATYFLQEQEMTLYDAVNFISHGISK  146 (798)
Q Consensus        81 ~~S~~l~rVL~~A~~~A~~~G~~~I~~eHLLLALL~e~ds~a~~iL~~~gis~~~v~~~i~~~~~~  146 (798)
                      .+|+.++++|+.|...|...++.+|+++|||+||+.+.++.+..+|..+|++...+.+.+...+..
T Consensus         5 k~t~~~~~al~~A~~~A~~~~h~~v~~eHll~all~~~~~~~~~~l~~~~~d~~~l~~~l~~~l~~   70 (857)
T PRK10865          5 RLTNKFQLALADAQSLALGHDNQFIEPLHLMSALLNQEGGSVRPLLTSAGINAGQLRTDINQALNR   70 (857)
T ss_pred             HCCHHHHHHHHHHHHHHHHCCCCEEHHHHHHHHHHCCCCCHHHHHHHHCCCCHHHHHHHHHHHHHH
T ss_conf             539999999999999999859884359999999976997479999998699999999999999862


No 65 
>pfam07726 AAA_3 ATPase family associated with various cellular activities (AAA). This Pfam entry includes some of the AAA proteins not detected by the pfam00004 model.
Probab=99.33  E-value=3.3e-12  Score=106.92  Aligned_cols=108  Identities=23%  Similarity=0.356  Sum_probs=81.7

Q ss_pred             EEEECCCCHHHHHHHHHHHHHCCCCEEEEEHHHHHCCCCCCHHCCCCCHHCCCCCCCCCCHHHHHCC--CEEEEECCHHH
Q ss_conf             8861432003889999987304773377206886124653011047800025644431003555158--51777404455
Q gi|254780163|r  510 YVFSGPTGVGKTEISKQLAFALGVQLLRFDMSEYMERHAVSRLIGAPPGYVGFGQGGILADSVDQNP--YSVVLLDEIEK  587 (798)
Q Consensus       510 flf~GptGvGKTelak~la~~~~~~lir~dmsey~e~~~vs~LiGappGYvG~~egg~Lte~vr~~P--~sVvl~DEiEK  587 (798)
                      .|+.||+|||||.+|+++|...+.+++|+++|+.++   .+-|+|+|-  ...+. |...  .+.-|  -+|+++|||-.
T Consensus         2 VLL~GppG~GKT~l~~~lA~~~~~~~~~i~~~~~~~---~~Dl~G~~~--~~~~~-~~~~--~~~G~l~~~vl~lDEin~   73 (131)
T pfam07726         2 VLLEGVPGLAKTLLARTLARSLGLDFRRIQFTPDLL---PSDITGTEV--YDQKT-REFE--FRPGPIFANVLLADEINR   73 (131)
T ss_pred             EEEECCCCCHHHHHHHHHHHHHCCCCEEEEECCCCC---CCCCCCCEE--ECCCC-CEEE--EECCCCCCCCEEEEHHHC
T ss_conf             878989987699999999999599816888337767---000368454--23787-4089--845731037056401203


Q ss_pred             CCHHHHHHHHHHHHHHHCCCCCCCEECCC-CEEEEEECCC
Q ss_conf             02899999999877750217799776125-4299994242
Q gi|254780163|r  588 SHPDVLNILLQIMDYGILTDQSGKKISFR-NVILIMTTNA  626 (798)
Q Consensus       588 Ah~~v~~~llqild~G~ltd~~Gr~vdf~-n~iii~TsN~  626 (798)
                      |+|+|++.||+++++.+++- .|.++.+. ++.+|.|+|=
T Consensus        74 a~~~v~~~Ll~~l~er~v~~-~g~~~~~p~~f~viAt~NP  112 (131)
T pfam07726        74 APPKTQSALLEAMQERQVTI-GGETHPLPEPFFVLATQNP  112 (131)
T ss_pred             CCHHHHHHHHHHHHCEEEEE-CCEEEECCCCEEEEECCCC
T ss_conf             99899999997632649977-9988527998499971698


No 66 
>CHL00176 ftsH cell division protein; Validated
Probab=99.32  E-value=5.6e-11  Score=98.03  Aligned_cols=162  Identities=30%  Similarity=0.426  Sum_probs=107.5

Q ss_pred             HHHHHCHHHHHHHHHHHHHHHHCCCCCCCC--------CCCEEEEECCCCHHHHHHHHHHHHHCCCCEEEEEHHHHHCCC
Q ss_conf             466534589999999998775204456578--------740688614320038899999873047733772068861246
Q gi|254780163|r  476 GTVVYGQEEAIKKLSSSIKIARAGLSDPNK--------PIGCYVFSGPTGVGKTEISKQLAFALGVQLLRFDMSEYMERH  547 (798)
Q Consensus       476 ~~~v~GQ~~ai~~v~~~i~~~~~gl~~~~r--------P~g~flf~GptGvGKTelak~la~~~~~~lir~dmsey~e~~  547 (798)
                      -+-|.|+++|.+.+.+.+--    |++|.|        |-| .||+||+|+|||.|||++|-..+.+|+.+.-|||.|. 
T Consensus       176 F~DVaG~~eaK~el~Eivdf----Lk~P~k~~~~Gak~PkG-vLL~GpPGTGKTlLAkAvAgEa~vpF~~~sgs~F~e~-  249 (631)
T CHL00176        176 FNDVAGVEEAKEELEEVVTF----LKKPERFTAVGAKIPKG-VLLVGPPGTGKTLLAKAIAGEAEVPFFSISGSEFVEM-  249 (631)
T ss_pred             CCCCCCCHHHHHHHHHHHHH----HCCHHHHHHCCCCCCCE-EEEECCCCCCHHHHHHHHHCCCCCCEEEEEHHHHHHH-
T ss_conf             53228858999999999998----35958876449968965-8988989987889999985655884699883785564-


Q ss_pred             CCCHHCCCCCHHCCCCCC--CCCCHHHHHCCCEEEEECCHHH-----------CCH---HHHHHHHHHHHHHHCCCCCCC
Q ss_conf             530110478000256444--3100355515851777404455-----------028---999999998777502177997
Q gi|254780163|r  548 AVSRLIGAPPGYVGFGQG--GILADSVDQNPYSVVLLDEIEK-----------SHP---DVLNILLQIMDYGILTDQSGK  611 (798)
Q Consensus       548 ~vs~LiGappGYvG~~eg--g~Lte~vr~~P~sVvl~DEiEK-----------Ah~---~v~~~llqild~G~ltd~~Gr  611 (798)
                                 |||-+..  -.|.+.-|++.-|||++|||+-           .|.   ..+|-||-=|| |.= .+   
T Consensus       250 -----------~vGvga~rVR~LF~~Ar~~aP~IiFIDEiDaig~~Rg~~~~gg~~e~e~tlnqLL~emD-Gf~-~~---  313 (631)
T CHL00176        250 -----------FVGVGAARVRDLFKKAKENSPCIVFIDEIDAVGRQRGAGVGGGNDEREQTLNQLLTEMD-GFE-GN---  313 (631)
T ss_pred             -----------HCCHHHHHHHHHHHHHHHCCCEEEEEEEEEEEEECCCCCCCCCCCHHHHHHHHHHHHHC-CCC-CC---
T ss_conf             -----------21555899999999998639969998710120114789888985089999999999842-888-78---


Q ss_pred             EECCCCEEEEEECCCCHHHHHHCCCCCCCCCCHHHHHHHHHHHCCHHHHCCCCEEEECCCCCHHHHHHHHHHHHH
Q ss_conf             761254299994242145533036898821114889999987288788177682896288999999999999999
Q gi|254780163|r  612 KISFRNVILIMTTNAGALEMSKARIGFGSSRNDDADKEALRNFLSPEFLNRLDSIIPFFPLSSDIIRQVVHKFIM  686 (798)
Q Consensus       612 ~vdf~n~iii~TsN~G~~~~~~~~~g~~~~~~~~~~~~~l~~~f~peflnRid~ii~F~~l~~~~~~~i~~~~l~  686 (798)
                          .+.|+|..+|---                 ...++|   .||   +|+|..|....-+......|+..+++
T Consensus       314 ----~gViViaATNrpd-----------------~LDpAL---lRP---GRFDR~I~V~lPD~~gR~~IL~vh~k  361 (631)
T CHL00176        314 ----KGVIVIAATNRID-----------------ILDAAL---LRP---GRFDRQVTVSLPDFEGRLDILKVHAR  361 (631)
T ss_pred             ----CCEEEEEECCCCC-----------------CCCHHH---CCC---CCCCEEEEECCCCHHHHHHHHHHHHH
T ss_conf             ----8869998258855-----------------456866---268---87754998269898999999999970


No 67 
>PRK06647 DNA polymerase III subunits gamma and tau; Validated
Probab=99.32  E-value=6.2e-11  Score=97.72  Aligned_cols=214  Identities=21%  Similarity=0.251  Sum_probs=143.9

Q ss_pred             HHHHHCCCCHHHHHHHHHHHHHHHHHHCCCCCCE-EEECCCCCHHHHHHHHHHHHHHCCCCCHH-----------H-H--
Q ss_conf             8877548611222178999999998622677874-89667641166899999999854898834-----------5-2--
Q gi|254780163|r  195 TEKVKKGKVDILVGRHEEINRTIQILCRRSKNNP-LYVGDPGVGKTAIAEGFAKQIVDGMVPDI-----------L-L--  259 (798)
Q Consensus       195 Te~AreGKLDPVIGRd~EI~riiqIL~RR~KNn~-~lvG~~gvGktaive~la~~i~~~~vp~~-----------l-~--  259 (798)
                      ..+-|=-.++-|||-+.-++.+-..+...+=.+. ++.|++|+|||+.+.-||+.+.-.+-|..           + .  
T Consensus         7 a~KYRP~~F~dvvGQe~vv~~L~nai~~~rl~HAyLFsGprG~GKTt~ArilAk~LnC~~~~~~~PCg~C~sC~~i~~g~   86 (560)
T PRK06647          7 ATKRRPRDFNSLEGQDFVVETLKHSIEKNKIANAYIFSGPRGVGKTSSARAFARCLNCVNGPTIMPCGECFSCKSIDNDS   86 (560)
T ss_pred             HHHHCCCCHHHHCCCHHHHHHHHHHHHCCCCCCEEEEECCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCCHHHHHHHCCC
T ss_conf             76428986544039499999999999749977436632899878999999999996599999988887887888874599


Q ss_pred             EEEEEEEEHHHHHCCCCCCCHHHHHHHHHHHHHCCC---C-CEEEEECCHHHHHCCCCCCCCCCCHHHHHHHHHC--CCC
Q ss_conf             014455404675306343123789999999872038---9-8399973616630155444344777888876630--266
Q gi|254780163|r  260 GARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIESY---A-NAILYIDEIHTLVGAGSASGISVDASNLLKPALS--SGA  333 (798)
Q Consensus       260 ~~~i~~ld~~~l~ag~~~rg~fe~r~~~~~~~~~~~---~-~~ilfideih~ligag~~~g~~~d~an~lkP~L~--rg~  333 (798)
                      ..-++++|.+      +-+|-  +-++.+++.+.-.   + --|..|||.|+|         +.+|+|-|.-.|.  -..
T Consensus        87 ~~DviEidaa------sn~~V--ddIR~l~e~v~~~P~~~~yKV~IIDEahmL---------t~~A~NALLKtLEEPP~~  149 (560)
T PRK06647         87 SLDVIEIDGA------SNTSV--QDVRQIKEEIMFPPASSRYRVYIIDEVHML---------SNSAFNALLKTIEEPPPY  149 (560)
T ss_pred             CCCEEEECCC------CCCCH--HHHHHHHHHHCCCCCCCCEEEEEECCHHHC---------CHHHHHHHHHHHHCCCCC
T ss_conf             9875764364------54888--999999998632876687069996465655---------999999999986348875


Q ss_pred             EEEEEECCHHHHHHHHHCCHHHHHHCEEEEECCCCHHHHHHHHHHHHHHHHHHCCCEECCHHHHHHHHHHHHHCCCCCCH
Q ss_conf             03887304899999852011143200144306878689999998612766541035121117899999865420155564
Q gi|254780163|r  334 VRCIGSTTYSEYRQFFEKDKALVRRFQKIDVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLP  413 (798)
Q Consensus       334 ~~~IgatT~~ey~~~~e~d~al~rrF~~i~v~ep~~~~~~~iL~~~~~~ye~~h~v~~~~~al~~av~ls~ryi~~r~lP  413 (798)
                      ..+|-+||..  +|...   ..-.|-|.......+.++-..-|+.+...    -++.|.++||...++.|.-=+.|    
T Consensus       150 ~~FILaTte~--~KI~~---TI~SRCQ~f~Fk~i~~~~I~~~L~~I~~~----E~i~~e~~AL~lIa~~a~Gs~RD----  216 (560)
T PRK06647        150 IVFIFATTEV--HKLPA---TIKSRCQHFNFRLLSLEKIYEMLKKVCLE----DDIKYEDEALKWIAYKSGGSVRD----  216 (560)
T ss_pred             EEEEEECCCH--HHCHH---HHHHHHEEEECCCCCHHHHHHHHHHHHHH----CCCCCCHHHHHHHHHHCCCCHHH----
T ss_conf             5999977994--76848---99965104105559999999999999986----79887999999999977895888----


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHH
Q ss_conf             67988998653333211443221136578999866
Q gi|254780163|r  414 DKAIDVIDEAGASQILQPLSKRRKFITEKDIKKTI  448 (798)
Q Consensus       414 dkAidllDea~a~~~~~~~~~~~~~~~~~~i~~~~  448 (798)
                        |..+||.+-|..        ...|+.++|.+.+
T Consensus       217 --alslldq~i~~~--------~~~i~~~~v~~~l  241 (560)
T PRK06647        217 --AYTLFDQIVSFS--------NSDITLEQIRSKM  241 (560)
T ss_pred             --HHHHHHHHHHCC--------CCCCCHHHHHHHH
T ss_conf             --999999999607--------9977899999986


No 68 
>PRK00411 cdc6 cell division control protein 6; Reviewed
Probab=99.32  E-value=2e-09  Score=86.93  Aligned_cols=228  Identities=21%  Similarity=0.297  Sum_probs=148.3

Q ss_pred             HHHHHHHHHHHHHHHHH----CCCCCCEEEECCCCCHHHHHHHHHHHHHHCCCCCHHHHEEEEEEEEHH----------H
Q ss_conf             22217899999999862----267787489667641166899999999854898834520144554046----------7
Q gi|254780163|r  205 ILVGRHEEINRTIQILC----RRSKNNPLYVGDPGVGKTAIAEGFAKQIVDGMVPDILLGARIFSLDMG----------N  270 (798)
Q Consensus       205 PVIGRd~EI~riiqIL~----RR~KNn~~lvG~~gvGktaive~la~~i~~~~vp~~l~~~~i~~ld~~----------~  270 (798)
                      -+.|||+|++++...|.    -..-+|.++.|+||+|||+.|..+...+.+...     +..++.+|-.          .
T Consensus        31 ~l~~Re~Ei~~l~~~l~~~l~g~~~~n~~I~G~pGTGKT~~vk~v~~~l~~~~~-----~~~~vyINc~~~~t~~~i~~~  105 (394)
T PRK00411         31 NLPHREEQIEELAFALRPALRGSRPSNVLILGPPGTGKTTTVKKVFEELEEAAL-----KVVYVYINCQIDRTRYAILSE  105 (394)
T ss_pred             CCCCHHHHHHHHHHHHHHHHCCCCCCCEEEECCCCCCHHHHHHHHHHHHHHHCC-----CCEEEEEECCCCCCHHHHHHH
T ss_conf             898859999999999999975999984799889999899999999999997468-----965999969668989999999


Q ss_pred             H---HCCCC--CCCH-HHHHHHHHHHHHCCCCC-EEEEECCHHHHHCCCCCCCCCCCHHHHHH-H-HHCCCCEEEEEECC
Q ss_conf             5---30634--3123-78999999987203898-39997361663015544434477788887-6-63026603887304
Q gi|254780163|r  271 L---IAGTR--YRGD-FEERIKKIVKEIESYAN-AILYIDEIHTLVGAGSASGISVDASNLLK-P-ALSSGAVRCIGSTT  341 (798)
Q Consensus       271 l---~ag~~--~rg~-fe~r~~~~~~~~~~~~~-~ilfideih~ligag~~~g~~~d~an~lk-P-~L~rg~~~~IgatT  341 (798)
                      +   +-|.+  .+|- +.+-+..+.+.+.+.+. +|+.+||+..|+   ...+.. -.=+++. | .+..-.+-+||.+.
T Consensus       106 i~~~L~~~~~p~~G~s~~~~~~~l~~~l~~~~~~~ivvLDEiD~L~---~~~~~~-vLY~L~r~~~~~~~~~~~vI~IsN  181 (394)
T PRK00411        106 IARSLFGHPPPSSGLSFDELFDKIAEYLDERDRVLIVALDDINYLV---EKEGND-VLYSLLRAHEEYPGARIGVIGISS  181 (394)
T ss_pred             HHHHHCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEEEEEECCCCCC---CCCCCH-HHHHHHHCCCCCCCCCEEEEEEEC
T ss_conf             9999569989877878999999999986166975899996554020---366508-999998540226887389999976


Q ss_pred             HHHHHHHHHCCHHHHHHC--EEEEECCCCHHHHHHHHHHHHHHHHHHCCCEECCHHHHHHHHHHHHHCCCCCCHHHHHHH
Q ss_conf             899999852011143200--144306878689999998612766541035121117899999865420155564679889
Q gi|254780163|r  342 YSEYRQFFEKDKALVRRF--QKIDVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLPDKAIDV  419 (798)
Q Consensus       342 ~~ey~~~~e~d~al~rrF--~~i~v~ep~~~~~~~iL~~~~~~ye~~h~v~~~~~al~~av~ls~ryi~~r~lPdkAidl  419 (798)
                      .-.+...+  |+.+..||  +.|.-.+=+.++-..||..-..  +.++.=.++++||..++.++++==-|   --||||+
T Consensus       182 ~~~~~~~L--dprv~S~l~~~~i~F~PY~~~qL~~IL~~R~~--~af~~gv~~~~~i~~~A~~~a~~~GD---aR~Aldl  254 (394)
T PRK00411        182 DLTFLYIL--DPRVKSVFGPEEIVFPPYTADEIFDILKDRVE--EGFYPGVVSDEVLELIADLTGREHGD---ARVAIDL  254 (394)
T ss_pred             CCCHHHHH--HHHHHCCCCCEEEEECCCCHHHHHHHHHHHHH--HCCCCCCCCHHHHHHHHHHHHHCCCC---HHHHHHH
T ss_conf             87177664--07775027862898589998999999999998--41455678978999999998550475---8999999


Q ss_pred             HHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHCC
Q ss_conf             986533332114432211365789998663102
Q gi|254780163|r  420 IDEAGASQILQPLSKRRKFITEKDIKKTIASMN  452 (798)
Q Consensus       420 lDea~a~~~~~~~~~~~~~~~~~~i~~~~~~~~  452 (798)
                      |-.|+-.+.    .+....|+.++|..+.....
T Consensus       255 lr~A~e~Ae----~~g~~~Vt~~hV~~A~~~~~  283 (394)
T PRK00411        255 LRRAGEIAE----REGSRKVTEEDVRKAYEKSE  283 (394)
T ss_pred             HHHHHHHHH----HHCCCCCCHHHHHHHHHHHH
T ss_conf             999999999----71899658999999999860


No 69 
>PRK10733 hflB ATP-dependent metalloprotease; Reviewed
Probab=99.32  E-value=6.1e-11  Score=97.79  Aligned_cols=125  Identities=28%  Similarity=0.474  Sum_probs=87.9

Q ss_pred             HHHHCHHHHHHHHHHHHHH-------HHCCCCCCCCCCCEEEEECCCCHHHHHHHHHHHHHCCCCEEEEEHHHHHCCCCC
Q ss_conf             6653458999999999877-------520445657874068861432003889999987304773377206886124653
Q gi|254780163|r  477 TVVYGQEEAIKKLSSSIKI-------ARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFALGVQLLRFDMSEYMERHAV  549 (798)
Q Consensus       477 ~~v~GQ~~ai~~v~~~i~~-------~~~gl~~~~rP~g~flf~GptGvGKTelak~la~~~~~~lir~dmsey~e~~~v  549 (798)
                      +-|.|+++|.+.+.+.+.-       .+.|-+-   |-|+ ||.||+|+|||.|||++|-..+.+|+.+..|||.|.   
T Consensus       152 ~DVaG~~eaK~el~EiVdfLk~P~k~~~~Gak~---PkGv-LL~GPPGtGKTlLAkAvAgEa~vpF~~~sgsef~e~---  224 (644)
T PRK10733        152 ADVAGCDEAKEEVAELVEYLREPSRFQKLGGKI---PKGV-LMVGPPGTGKTLLAKAIAGEAKVPFFTISGSDFVEM---  224 (644)
T ss_pred             CCCCCCHHHHHHHHHHHHHHHCHHHHHHCCCCC---CCCE-EEECCCCCCHHHHHHHHHCCCCCEEEEEEHHHHHHE---
T ss_conf             040897899999999999812979999749979---9851-777989987789999986455980899784773022---


Q ss_pred             CHHCCCCCHHCCCCCCC--CCCHHHHHCCCEEEEECCHHH-----------CCH---HHHHHHHHHHHHHHCCCCCCCEE
Q ss_conf             01104780002564443--100355515851777404455-----------028---99999999877750217799776
Q gi|254780163|r  550 SRLIGAPPGYVGFGQGG--ILADSVDQNPYSVVLLDEIEK-----------SHP---DVLNILLQIMDYGILTDQSGKKI  613 (798)
Q Consensus       550 s~LiGappGYvG~~egg--~Lte~vr~~P~sVvl~DEiEK-----------Ah~---~v~~~llqild~G~ltd~~Gr~v  613 (798)
                               |||-+..-  .|.+.-|++.-|||++|||+-           .|.   .++|-||-=|| |.-+ +.    
T Consensus       225 ---------~vGvga~rVR~lF~~Ar~~aP~IIFIDEiDaig~~R~~~~~gg~~e~~~tlNqlL~EmD-Gf~~-~~----  289 (644)
T PRK10733        225 ---------FVGVGASRVRDMFEQAKKAAPCIIFIDEIDAVGRQRGAGLGGGHDEREQTLNQMLVEMD-GFEG-NE----  289 (644)
T ss_pred             ---------EEECCHHHHHHHHHHHHHCCCEEEEEECHHCCCCCCCCCCCCCCHHHHHHHHHHHHHHH-CCCC-CC----
T ss_conf             ---------25306899999999999669979999532203666789888983288878999999954-8888-78----


Q ss_pred             CCCCEEEEEECCC
Q ss_conf             1254299994242
Q gi|254780163|r  614 SFRNVILIMTTNA  626 (798)
Q Consensus       614 df~n~iii~TsN~  626 (798)
                         +.|+|..+|-
T Consensus       290 ---~ViviaATNr  299 (644)
T PRK10733        290 ---GIIVIAATNR  299 (644)
T ss_pred             ---CEEEEEECCC
T ss_conf             ---7699962699


No 70 
>COG1222 RPT1 ATP-dependent 26S proteasome regulatory subunit [Posttranslational modification, protein turnover, chaperones]
Probab=99.32  E-value=1.3e-10  Score=95.41  Aligned_cols=145  Identities=28%  Similarity=0.448  Sum_probs=87.1

Q ss_pred             HCCCCCCCCCCCEEEEECCCCHHHHHHHHHHHHHCCCCEEEEEHHHHHCCCCCCHHCCCCCHHCCCCCCCCCC----HHH
Q ss_conf             2044565787406886143200388999998730477337720688612465301104780002564443100----355
Q gi|254780163|r  497 RAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFALGVQLLRFDMSEYMERHAVSRLIGAPPGYVGFGQGGILA----DSV  572 (798)
Q Consensus       497 ~~gl~~~~rP~g~flf~GptGvGKTelak~la~~~~~~lir~dmsey~e~~~vs~LiGappGYvG~~egg~Lt----e~v  572 (798)
                      +.|+.+|   -|++|+ ||+|+|||.|||++|-...-.|||+--||+-.+            |+|  ||..|.    +--
T Consensus       179 ~~GI~PP---KGVLLY-GPPGTGKTLLAkAVA~~T~AtFIrvvgSElVqK------------YiG--EGaRlVRelF~lA  240 (406)
T COG1222         179 ELGIDPP---KGVLLY-GPPGTGKTLLAKAVANQTDATFIRVVGSELVQK------------YIG--EGARLVRELFELA  240 (406)
T ss_pred             HCCCCCC---CCEEEE-CCCCCCHHHHHHHHHHCCCCEEEEECCHHHHHH------------HHC--CCHHHHHHHHHHH
T ss_conf             7499999---712766-899975889999987205866999421999999------------834--1169999999987


Q ss_pred             HHCCCEEEEECCHHH-----------CCHHHHHHHHHHHHHHHCCCCCCCEECCCCEEEEEECCCCHHHHHHCCCCCCCC
Q ss_conf             515851777404455-----------028999999998777502177997761254299994242145533036898821
Q gi|254780163|r  573 DQNPYSVVLLDEIEK-----------SHPDVLNILLQIMDYGILTDQSGKKISFRNVILIMTTNAGALEMSKARIGFGSS  641 (798)
Q Consensus       573 r~~P~sVvl~DEiEK-----------Ah~~v~~~llqild~G~ltd~~Gr~vdf~n~iii~TsN~G~~~~~~~~~g~~~~  641 (798)
                      |.+--|+|++|||+-           +..+|+..+||+|-+=-=.|..      .|.-|||.+|=-              
T Consensus       241 rekaPsIIFiDEIDAIg~kR~d~~t~gDrEVQRTmleLL~qlDGFD~~------~nvKVI~ATNR~--------------  300 (406)
T COG1222         241 REKAPSIIFIDEIDAIGAKRFDSGTSGDREVQRTMLELLNQLDGFDPR------GNVKVIMATNRP--------------  300 (406)
T ss_pred             HHCCCEEEEEECHHHHHCCCCCCCCCCHHHHHHHHHHHHHHCCCCCCC------CCEEEEEECCCC--------------
T ss_conf             414984999831122311113688885099999999999860588978------876899855885--------------


Q ss_pred             CCHHHHHHHHHHHCCHHHHCCCCEEEECCCCCHHHHHHHHHHHHHHH
Q ss_conf             11488999998728878817768289628899999999999999999
Q gi|254780163|r  642 RNDDADKEALRNFLSPEFLNRLDSIIPFFPLSSDIIRQVVHKFIMKL  688 (798)
Q Consensus       642 ~~~~~~~~~l~~~f~peflnRid~ii~F~~l~~~~~~~i~~~~l~~l  688 (798)
                         +...++   ..||   +|||..|-|-.-+.+.-.+|+.++-.+.
T Consensus       301 ---D~LDPA---LLRP---GR~DRkIEfplPd~~gR~~Il~IHtrkM  338 (406)
T COG1222         301 ---DILDPA---LLRP---GRFDRKIEFPLPDEEGRAEILKIHTRKM  338 (406)
T ss_pred             ---CCCCHH---HCCC---CCCCCEEECCCCCHHHHHHHHHHHHHHC
T ss_conf             ---555766---5088---7545301168989789999999876214


No 71 
>PRK00440 rfc replication factor C small subunit; Reviewed
Probab=99.31  E-value=6.4e-10  Score=90.43  Aligned_cols=194  Identities=24%  Similarity=0.360  Sum_probs=136.6

Q ss_pred             HHHHHCCCCHHHHHHHHHHHHHHHHHHCCCCCCEEEECCCCCHHHHHHHHHHHHHHCCCCCHHHHEEEEEEEEHHHHHCC
Q ss_conf             88775486112221789999999986226778748966764116689999999985489883452014455404675306
Q gi|254780163|r  195 TEKVKKGKVDILVGRHEEINRTIQILCRRSKNNPLYVGDPGVGKTAIAEGFAKQIVDGMVPDILLGARIFSLDMGNLIAG  274 (798)
Q Consensus       195 Te~AreGKLDPVIGRd~EI~riiqIL~RR~KNn~~lvG~~gvGktaive~la~~i~~~~vp~~l~~~~i~~ld~~~l~ag  274 (798)
                      +++-|=.++|-++|-+.-++++...+...+-.|-++-|+||+|||+++.-||..+......     ..+++++.+.    
T Consensus         7 ~eKYRP~~l~di~g~~~~~~~L~~~i~~~~~phlLf~GppG~GKTt~a~~la~~l~~~~~~-----~~~lelnasd----   77 (318)
T PRK00440          7 VEKYRPRSLDEVVGQEEIVERLKSFVKEKNMPHLLFAGPPGTGKTTAALALARELYGEYWR-----ENFLELNASD----   77 (318)
T ss_pred             HHCCCCCCHHHHCCCHHHHHHHHHHHHCCCCCEEEEECCCCCCHHHHHHHHHHHHCCCCCC-----CCEEEECCCC----
T ss_conf             4601989899941969999999999987998669888959988999999999997698643-----4768951645----


Q ss_pred             CCCCC--HHHHHHHHHHHHHC--CCCCEEEEECCHHHHHCCCCCCCCCCCHHHHHHHHHCC--CCEEEEEECCHHHHHHH
Q ss_conf             34312--37899999998720--38983999736166301554443447778888766302--66038873048999998
Q gi|254780163|r  275 TRYRG--DFEERIKKIVKEIE--SYANAILYIDEIHTLVGAGSASGISVDASNLLKPALSS--GAVRCIGSTTYSEYRQF  348 (798)
Q Consensus       275 ~~~rg--~fe~r~~~~~~~~~--~~~~~ilfideih~ligag~~~g~~~d~an~lkP~L~r--g~~~~IgatT~~ey~~~  348 (798)
                        .||  ...++++.......  ..+.-|++|||+|.+         +.++.|-|...|..  ...++|-.|+.  +.+.
T Consensus        78 --~r~id~vr~~i~~~~~~~~~~~~~~kiiiiDE~d~l---------~~~aq~aL~~~mE~~~~~~~fil~~n~--~~ki  144 (318)
T PRK00440         78 --ERGIDVIRNKIKEFARTAPVGGAPFKIIFLDEADNL---------TSDAQQALRRTMEMYSQTTRFILSCNY--SSKI  144 (318)
T ss_pred             --CCCHHHHHHHHHHHHHHCCCCCCCEEEEEEECCCCC---------CHHHHHHHHHHHHCCCCCCEEEEECCC--CCCC
T ss_conf             --667178999999999726778997389998685532---------255678887643105666258863488--3337


Q ss_pred             HHCCHHHHHHCEEEEECCCCHHHHHHHHHHHHHHHHHHCCCEECCHHHHHHHHHHHHHCCCCCCHHHHHHHHHHH
Q ss_conf             520111432001443068786899999986127665410351211178999998654201555646798899865
Q gi|254780163|r  349 FEKDKALVRRFQKIDVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLPDKAIDVIDEA  423 (798)
Q Consensus       349 ~e~d~al~rrF~~i~v~ep~~~~~~~iL~~~~~~ye~~h~v~~~~~al~~av~ls~ryi~~r~lPdkAidllDea  423 (798)
                      +   +++-.|.+.+....|+.++....|+.+..    ..++.++++++...+..|.-=      -.+||.+|..+
T Consensus       145 i---~~i~SRc~~i~f~~~~~~~i~~~L~~I~~----~E~i~~~~~~l~~i~~~s~gd------lR~ain~Lq~~  206 (318)
T PRK00440        145 I---DPIQSRCAVFRFSPLPKEAVIERLRYIAK----NEGLEITDDALEAIYYVSEGD------MRKAINALQAA  206 (318)
T ss_pred             C---CCHHHHHEEEECCCCCHHHHHHHHHHHHH----HCCCCCCHHHHHHHHHHCCCC------HHHHHHHHHHH
T ss_conf             6---15565510111578999999999999999----859998999999999864998------99999999999


No 72 
>PRK07270 DNA polymerase III subunits gamma and tau; Validated
Probab=99.30  E-value=6.7e-11  Score=97.47  Aligned_cols=200  Identities=23%  Similarity=0.257  Sum_probs=138.5

Q ss_pred             HHHHHHCCCCHHHHHHHHHHHHHHHHHHCCCCCCE-EEECCCCCHHHHHHHHHHHHHHCCCCCHH------------HHE
Q ss_conf             58877548611222178999999998622677874-89667641166899999999854898834------------520
Q gi|254780163|r  194 LTEKVKKGKVDILVGRHEEINRTIQILCRRSKNNP-LYVGDPGVGKTAIAEGFAKQIVDGMVPDI------------LLG  260 (798)
Q Consensus       194 LTe~AreGKLDPVIGRd~EI~riiqIL~RR~KNn~-~lvG~~gvGktaive~la~~i~~~~vp~~------------l~~  260 (798)
                      |..+-|-..+|-|||-+.-++.+-+.+.+.+=.+. ++.|++|||||+.+.-+|+.+...+-+..            ..+
T Consensus         5 LyrkyRP~~F~dvvGQe~i~~~L~nal~~~ri~HAyLF~GP~GtGKts~ArifAkaLnC~~~~~~~pC~~C~~C~~i~~g   84 (557)
T PRK07270          5 LYRKYRSQTFDEMVGQEVVATTLKQAVESGKISHAYLFSGPRGTGKTSAAKIFAKAMNCPNQVDGEPCNNCDICRDITNG   84 (557)
T ss_pred             HHHHHCCCCHHHHCCHHHHHHHHHHHHHCCCCCEEEEEECCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCCHHHHHHHCC
T ss_conf             67660899876714819999999999985995404421089986899999999999579998999988877799998758


Q ss_pred             --EEEEEEEHHHHHCCCCCCCHHHHHHHHHHHHHCCC----CCEEEEECCHHHHHCCCCCCCCCCCHHHHHHHHHC--CC
Q ss_conf             --14455404675306343123789999999872038----98399973616630155444344777888876630--26
Q gi|254780163|r  261 --ARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIESY----ANAILYIDEIHTLVGAGSASGISVDASNLLKPALS--SG  332 (798)
Q Consensus       261 --~~i~~ld~~~l~ag~~~rg~fe~r~~~~~~~~~~~----~~~ilfideih~ligag~~~g~~~d~an~lkP~L~--rg  332 (798)
                        ..++++|.      ++-+|-  +.++.+.+.+.-.    +--|..|||.|+|         +.+|+|-|.-.|.  ..
T Consensus        85 ~~~DviEida------as~~gV--d~IRei~~~~~~~P~~~~yKV~IIDEah~L---------s~~A~NALLKtLEEPP~  147 (557)
T PRK07270         85 SLEDVIEIDA------ASNNGV--DEIRDIRDKSTYAPSRATYKVYIIDEVHML---------STGAFNALLKTLEEPTE  147 (557)
T ss_pred             CCCCEEEECC------CCCCCH--HHHHHHHHHHCCCCCCCCEEEEEECCHHHC---------CHHHHHHHHHHHHCCCC
T ss_conf             9997487347------776788--999999998423877788389997144534---------99999989998528998


Q ss_pred             CEEEEEECCHHHHHHHHHCCHHHHHHCEEEEECCCCHHHHHHHHHHHHHHHHHHCCCEECCHHHHHHHHHHHHHCCCCCC
Q ss_conf             60388730489999985201114320014430687868999999861276654103512111789999986542015556
Q gi|254780163|r  333 AVRCIGSTTYSEYRQFFEKDKALVRRFQKIDVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKL  412 (798)
Q Consensus       333 ~~~~IgatT~~ey~~~~e~d~al~rrF~~i~v~ep~~~~~~~iL~~~~~~ye~~h~v~~~~~al~~av~ls~ryi~~r~l  412 (798)
                      ...+|-+||..+  |..   +.+-.|-|+..-..-+.++-+.-|+.+..    --++.|.++||..+++.|.-=+.    
T Consensus       148 ~~vFIL~Ttep~--kIl---~TI~SRCQrf~F~~i~~~~i~~~L~~I~~----~E~i~~~~~aL~~Ia~~a~G~mR----  214 (557)
T PRK07270        148 NVVFILATTELH--KIP---ATILSRVQRFEFKSIKTKAIREHLAWILD----KEGISFEVEALNLIARRAEGGMR----  214 (557)
T ss_pred             CEEEEEEECCHH--HCC---HHHHHHHHHCCCCCCCHHHHHHHHHHHHH----HCCCCCCHHHHHHHHHHCCCCHH----
T ss_conf             769999849947--592---88874300010888999999999999999----83998699999999997799687----


Q ss_pred             HHHHHHHHHHHHH
Q ss_conf             4679889986533
Q gi|254780163|r  413 PDKAIDVIDEAGA  425 (798)
Q Consensus       413 PdkAidllDea~a  425 (798)
                        .|+.+||.+-|
T Consensus       215 --dAlsiLdQ~~s  225 (557)
T PRK07270        215 --DALSILDQALS  225 (557)
T ss_pred             --HHHHHHHHHHH
T ss_conf             --89999999997


No 73 
>PRK06674 DNA polymerase III subunits gamma and tau; Validated
Probab=99.30  E-value=1.9e-10  Score=94.26  Aligned_cols=213  Identities=23%  Similarity=0.335  Sum_probs=140.3

Q ss_pred             HHHHCCCCHHHHHHHHHHHHHHHHHHCCCCCCE-EEECCCCCHHHHHHHHHHHHHHCCCCCHH-----------HHE---
Q ss_conf             877548611222178999999998622677874-89667641166899999999854898834-----------520---
Q gi|254780163|r  196 EKVKKGKVDILVGRHEEINRTIQILCRRSKNNP-LYVGDPGVGKTAIAEGFAKQIVDGMVPDI-----------LLG---  260 (798)
Q Consensus       196 e~AreGKLDPVIGRd~EI~riiqIL~RR~KNn~-~lvG~~gvGktaive~la~~i~~~~vp~~-----------l~~---  260 (798)
                      .+-|--.++-|||-+.-++.+-.-+...+=... ++.|++|||||+.+--+|+-+.-.+-|..           +.+   
T Consensus         8 rkyRP~~F~dvvGQ~~v~~~L~nai~~~ri~HAyLF~GprGtGKts~Ari~AkaLnC~~~~~~~pC~~C~~C~~i~~g~~   87 (563)
T PRK06674          8 RVFRPQKFEDVVGQEHVTKTLQNALLQEKVSHAYLFSGPRGTGKTSIAKVFAKAVNCEHAPVAEPCNECPSCLGITNGSI   87 (563)
T ss_pred             HHHCCCCHHHHCCHHHHHHHHHHHHHCCCCCCEEEEECCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCCHHHHHHHCCCC
T ss_conf             76389976552480999999999998499650343128998689999999999857999999887766878999855899


Q ss_pred             EEEEEEEHHHHHCCCCCCCHHHHHHHHHHHHHCC---CC-CEEEEECCHHHHHCCCCCCCCCCCHHHHHHHHHCC--CCE
Q ss_conf             1445540467530634312378999999987203---89-83999736166301554443447778888766302--660
Q gi|254780163|r  261 ARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIES---YA-NAILYIDEIHTLVGAGSASGISVDASNLLKPALSS--GAV  334 (798)
Q Consensus       261 ~~i~~ld~~~l~ag~~~rg~fe~r~~~~~~~~~~---~~-~~ilfideih~ligag~~~g~~~d~an~lkP~L~r--g~~  334 (798)
                      .-++++|.++      -+|-  +.++.+.+.+.-   .+ --|..|||.|+|         +.+|+|-|.-.|..  ...
T Consensus        88 ~DviEiDaas------n~gV--d~IR~i~~~v~~~P~~~~yKV~IIDeah~L---------t~~A~NALLKtLEEPP~~v  150 (563)
T PRK06674         88 SDVLEIDAAS------NNGV--DEIRDIRDKVKFAPSAVEYKVYIIDEVHML---------SIGAFNALLKTLEEPPGHV  150 (563)
T ss_pred             CCEEEECCCC------CCCH--HHHHHHHHHHCCCCCCCCEEEEEEECHHHC---------CHHHHHHHHHHHHCCCCCE
T ss_conf             8779852555------5787--999999998264886787379998545637---------9999999999863887564


Q ss_pred             EEEEECCHHHHHHHHHCCHHHHHHCEEEEECCCCHHHHHHHHHHHHHHHHHHCCCEECCHHHHHHHHHHHHHCCCCCCHH
Q ss_conf             38873048999998520111432001443068786899999986127665410351211178999998654201555646
Q gi|254780163|r  335 RCIGSTTYSEYRQFFEKDKALVRRFQKIDVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLPD  414 (798)
Q Consensus       335 ~~IgatT~~ey~~~~e~d~al~rrF~~i~v~ep~~~~~~~iL~~~~~~ye~~h~v~~~~~al~~av~ls~ryi~~r~lPd  414 (798)
                      .+|-+||..+  |.   -+..-.|-|+....--+.++-+.-|+.+..    .-++.|.++||...++.|.-=+.|     
T Consensus       151 iFILaTtep~--ki---~~TI~SRCQrf~F~ri~~~~i~~rL~~I~~----~E~i~~~~~aL~~Ia~~a~GsmRD-----  216 (563)
T PRK06674        151 IFILATTEPH--KI---PPTIISRCQRFDFRRISVNDIVERLSTVVT----NEGTQVEDEALQIIARAADGGMRD-----  216 (563)
T ss_pred             EEEEECCCHH--HC---CHHHHHHHEEEECCCCCHHHHHHHHHHHHH----HCCCCCCHHHHHHHHHHCCCCHHH-----
T ss_conf             9999659947--58---478873310312788999999999999999----849998788999999976997889-----


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHH
Q ss_conf             7988998653333211443221136578999866
Q gi|254780163|r  415 KAIDVIDEAGASQILQPLSKRRKFITEKDIKKTI  448 (798)
Q Consensus       415 kAidllDea~a~~~~~~~~~~~~~~~~~~i~~~~  448 (798)
                       |+.+||.+-|..        ...|+.+++..++
T Consensus       217 -AlsiLdQ~~s~~--------~~~i~~~~v~~~l  241 (563)
T PRK06674        217 -ALSLLDQAISFS--------DERVTTEDVLAVT  241 (563)
T ss_pred             -HHHHHHHHHHHC--------CCCCCHHHHHHHH
T ss_conf             -999999999715--------9976899999986


No 74 
>PRK05896 DNA polymerase III subunits gamma and tau; Validated
Probab=99.30  E-value=7.7e-11  Score=97.05  Aligned_cols=202  Identities=22%  Similarity=0.292  Sum_probs=139.1

Q ss_pred             HHHHHHHCCCCHHHHHHHHHHHHHHHHHHCCCCCC-EEEECCCCCHHHHHHHHHHHHHHCCCCCH--HH-----------
Q ss_conf             25887754861122217899999999862267787-48966764116689999999985489883--45-----------
Q gi|254780163|r  193 DLTEKVKKGKVDILVGRHEEINRTIQILCRRSKNN-PLYVGDPGVGKTAIAEGFAKQIVDGMVPD--IL-----------  258 (798)
Q Consensus       193 DLTe~AreGKLDPVIGRd~EI~riiqIL~RR~KNn-~~lvG~~gvGktaive~la~~i~~~~vp~--~l-----------  258 (798)
                      .|..+-|-..+|-|||-+.-++.+...+.+.+=.+ -++.|++|||||+++..+|..+...+.+.  ..           
T Consensus         5 alyrKYRPk~F~eIIGQe~iv~~L~nAI~~~RiaHAYLFsGPrGvGKTTlArifAkaLnC~~~~~~dpCg~C~sC~~I~~   84 (613)
T PRK05896          5 TFYRKYRPHNFKQIIGQELIKKILVNAILNNKLTHAYIFSGPRGIGKTSIAKIFAKAINCLNPKDGDCCNSCSVCESINT   84 (613)
T ss_pred             CHHHHCCCCCHHHHCCCHHHHHHHHHHHHCCCCCCEEEEECCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCCHHHHHHHC
T ss_conf             12450179976552382999999999998499762277558998488999999999966999999998888878999856


Q ss_pred             -HEEEEEEEEHHHHHCCCCCCCHHHHHHHHHHHHHCCC----CCEEEEECCHHHHHCCCCCCCCCCCHHHHHHHHHCC--
Q ss_conf             -2014455404675306343123789999999872038----983999736166301554443447778888766302--
Q gi|254780163|r  259 -LGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIESY----ANAILYIDEIHTLVGAGSASGISVDASNLLKPALSS--  331 (798)
Q Consensus       259 -~~~~i~~ld~~~l~ag~~~rg~fe~r~~~~~~~~~~~----~~~ilfideih~ligag~~~g~~~d~an~lkP~L~r--  331 (798)
                       ...-++++|.+      +.+|  =+.++.+++.+.-.    +.-|..|||.|+|         +..|+|-|.-.|.-  
T Consensus        85 g~h~DviEIdaa------sn~g--IDeIReLie~~~~~P~~gkyKV~IIDEah~L---------n~~AaNALLKtLEEPP  147 (613)
T PRK05896         85 NQSVDIVELDAA------SNNG--VDEIRNIIDNINYLPTTFKYKVYIIDEAHML---------STSAWNALLKTLEEPP  147 (613)
T ss_pred             CCCCCEEEEECC------CCCC--HHHHHHHHHHHCCCCCCCCCEEEEECCHHHC---------CHHHHHHHHHHCCCCC
T ss_conf             999986884065------5578--8999999997085875799459998162217---------9999999998534898


Q ss_pred             CCEEEEEECCHHHHHHHHHCCHHHHHHCEEEEECCCCHHHHHHHHHHHHHHHHHHCCCEECCHHHHHHHHHHHHHCCCCC
Q ss_conf             66038873048999998520111432001443068786899999986127665410351211178999998654201555
Q gi|254780163|r  332 GAVRCIGSTTYSEYRQFFEKDKALVRRFQKIDVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRK  411 (798)
Q Consensus       332 g~~~~IgatT~~ey~~~~e~d~al~rrF~~i~v~ep~~~~~~~iL~~~~~~ye~~h~v~~~~~al~~av~ls~ryi~~r~  411 (798)
                      ....+|-+||..+  +.   =+..-.|-|+....-.+.++-..-|+.+...    -++.|.++||...++.|.-=+.|  
T Consensus       148 ~~viFIL~Ttep~--KL---LpTIlSRCQrf~Fkri~~~~I~~~L~~I~~k----E~i~ie~~AL~~Ia~~adGs~RD--  216 (613)
T PRK05896        148 KHVVFIFATTEFQ--KI---PLTIISRCQRYNFKKLNNSELQELLKSIAKK----EKIKIEDNAIDKIADLADGSLRD--  216 (613)
T ss_pred             CCCEEEEEECCHH--HC---CHHHHHCCCCEECCCCCHHHHHHHHHHHHHH----CCCCCCHHHHHHHHHHCCCCHHH--
T ss_conf             7837999828815--49---3766403550017889989999999999997----39987899999999976884878--


Q ss_pred             CHHHHHHHHHHHHHH
Q ss_conf             646798899865333
Q gi|254780163|r  412 LPDKAIDVIDEAGAS  426 (798)
Q Consensus       412 lPdkAidllDea~a~  426 (798)
                          |..+||.+.+.
T Consensus       217 ----AlslLdQ~~~~  227 (613)
T PRK05896        217 ----GLSILDQLSTF  227 (613)
T ss_pred             ----HHHHHHHHHHH
T ss_conf             ----98899999983


No 75 
>COG1221 PspF Transcriptional regulators containing an AAA-type ATPase domain and a DNA-binding domain [Transcription / Signal transduction mechanisms]
Probab=99.30  E-value=2.3e-10  Score=93.60  Aligned_cols=224  Identities=21%  Similarity=0.332  Sum_probs=147.5

Q ss_pred             HCCHHHHHHHCHHHHHHHHHHHHHHHHCCCCCCCCCCCEEEEECCCCHHHHHHHHHHHHHC----CCCEEEEEHHHHHCC
Q ss_conf             0000246653458999999999877520445657874068861432003889999987304----773377206886124
Q gi|254780163|r  471 LEKNLGTVVYGQEEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFAL----GVQLLRFDMSEYMER  546 (798)
Q Consensus       471 l~~~l~~~v~GQ~~ai~~v~~~i~~~~~gl~~~~rP~g~flf~GptGvGKTelak~la~~~----~~~lir~dmsey~e~  546 (798)
                      +.......+||.+.+...+.+.+++    +.+.+.|   .|..|+||+||+-.|..+.+.+    +.+||.|||+.|.+.
T Consensus        72 ~~~~~~~~LIG~~~~~~~~~eqik~----~ap~~~~---vLi~GetGtGKel~A~~iH~~s~r~~~~PFI~~NCa~~~en  144 (403)
T COG1221          72 LKSEALDDLIGESPSLQELREQIKA----YAPSGLP---VLIIGETGTGKELFARLIHALSARRAEAPFIAFNCAAYSEN  144 (403)
T ss_pred             CCCHHHHHHHCCCHHHHHHHHHHHH----HCCCCCC---EEEECCCCCCHHHHHHHHHHHHHCCCCCCEEEEEHHHHCCC
T ss_conf             0221566663568889999999986----1899984---79866887538899999998612135898799777773767


Q ss_pred             CCCCHHCCCCCH-HCC--CCCCCCCCHHHHHCCCEEEEECCHHHCCHHHHHHHHHHHHHHHCC---CCCCCEECCCCEEE
Q ss_conf             653011047800-025--644431003555158517774044550289999999987775021---77997761254299
Q gi|254780163|r  547 HAVSRLIGAPPG-YVG--FGQGGILADSVDQNPYSVVLLDEIEKSHPDVLNILLQIMDYGILT---DQSGKKISFRNVIL  620 (798)
Q Consensus       547 ~~vs~LiGappG-YvG--~~egg~Lte~vr~~P~sVvl~DEiEKAh~~v~~~llqild~G~lt---d~~Gr~vdf~n~ii  620 (798)
                      .--+.|.|--.| |-|  ++..|.+-.    ---..+++|||--.-|.++..||+++|+|.++   +.+.+.+|++   +
T Consensus       145 ~~~~eLFG~~kGaftGa~~~k~Glfe~----A~GGtLfLDEI~~LP~~~Q~kLl~~le~g~~~rvG~~~~~~~dVR---l  217 (403)
T COG1221         145 LQEAELFGHEKGAFTGAQGGKAGLFEQ----ANGGTLFLDEIHRLPPEGQEKLLRVLEEGEYRRVGGSQPRPVDVR---L  217 (403)
T ss_pred             HHHHHHHCCCCCEEECCCCCCCCHHEE----CCCCEEEHHHHHHCCHHHHHHHHHHHHCCCEEECCCCCCCCCCCE---E
T ss_conf             777777320000002566786764205----279777656365379858999999987186576688888677740---4


Q ss_pred             EEECCCCHHHHHHCCCCCCCCCCHHHHHHHHHHHCCHHHHC-CCCEEEECCCCCHHHHHHHHHHHHHHHHHHHHHCCCEE
Q ss_conf             99424214553303689882111488999998728878817-76828962889999999999999999999998669889
Q gi|254780163|r  621 IMTTNAGALEMSKARIGFGSSRNDDADKEALRNFLSPEFLN-RLDSIIPFFPLSSDIIRQVVHKFIMKLELQLQEKGISF  699 (798)
Q Consensus       621 i~TsN~G~~~~~~~~~g~~~~~~~~~~~~~l~~~f~pefln-Rid~ii~F~~l~~~~~~~i~~~~l~~l~~~l~~~~i~l  699 (798)
                      |+-+|.--                   .+.+.+-  ..|.- |+..+|-.-||.+. ...|..+.--=+....++.++.+
T Consensus       218 i~AT~~~l-------------------~~~~~~g--~dl~~rl~~~~I~LPpLrER-~~Di~~L~e~Fl~~~~~~l~~~~  275 (403)
T COG1221         218 ICATTEDL-------------------EEAVLAG--ADLTRRLNILTITLPPLRER-KEDILLLAEHFLKSEARRLGLPL  275 (403)
T ss_pred             EECCCCCH-------------------HHHHHHH--CCHHHHHCCCEECCCCHHHC-HHHHHHHHHHHHHHHHHHCCCCC
T ss_conf             51356687-------------------9998740--52556416754318972435-55599999999999999739998


Q ss_pred             EECH-HHHHHHHHCCCCCCCCCHHHHHHHHHHHH
Q ss_conf             9988-99999997189810153267999998623
Q gi|254780163|r  700 HFSE-EVINWLVSHGYDVKMGARPLERIIKEHVK  732 (798)
Q Consensus       700 ~~~~-~~~~~l~~~~~~~~~GAR~l~r~i~~~i~  732 (798)
                      .... .+...|..  |+-.---|.|+..|+.-+.
T Consensus       276 ~~~~~~a~~~L~~--y~~pGNirELkN~Ve~~~~  307 (403)
T COG1221         276 SVDSPEALRALLA--YDWPGNIRELKNLVERAVA  307 (403)
T ss_pred             CCCCHHHHHHHHH--CCCCCCHHHHHHHHHHHHH
T ss_conf             8888999999984--8899839999999999999


No 76 
>PRK06305 DNA polymerase III subunits gamma and tau; Validated
Probab=99.30  E-value=9.8e-11  Score=96.29  Aligned_cols=215  Identities=22%  Similarity=0.256  Sum_probs=146.2

Q ss_pred             HHHHHHCCCCHHHHHHHHHHHHHHHHHHCCCCCCE-EEECCCCCHHHHHHHHHHHHHHCCC-CCHH------------H-
Q ss_conf             58877548611222178999999998622677874-8966764116689999999985489-8834------------5-
Q gi|254780163|r  194 LTEKVKKGKVDILVGRHEEINRTIQILCRRSKNNP-LYVGDPGVGKTAIAEGFAKQIVDGM-VPDI------------L-  258 (798)
Q Consensus       194 LTe~AreGKLDPVIGRd~EI~riiqIL~RR~KNn~-~lvG~~gvGktaive~la~~i~~~~-vp~~------------l-  258 (798)
                      |..+-|=..++-|||-+.-++.+...+...+=.+. ++.|++|||||+++.-||+.+.-.+ .++.            . 
T Consensus         7 larKYRP~~F~dvVGQ~~vv~~L~nai~~~ri~HAyLF~GprGtGKTT~ArilAkaLnC~~~~~~~~pCg~C~~C~~I~~   86 (462)
T PRK06305          7 SSRKYRPQTFSEILGQDAVVTVLKNALRFNRAAHAYLFSGIRGTGKTTLARIFAKALNCQNPTEDQEPCNQCAICKEISS   86 (462)
T ss_pred             HHHHHCCCCHHHHCCCHHHHHHHHHHHHCCCCCCEEEEECCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCCCHHHHHHHC
T ss_conf             88763889876604909999999999984997623430389985999999999999679999888898876688899863


Q ss_pred             -HEEEEEEEEHHHHHCCCCCCCHHHHHHHHHHHHHCC---CCC-EEEEECCHHHHHCCCCCCCCCCCHHHHHHHHHC--C
Q ss_conf             -201445540467530634312378999999987203---898-399973616630155444344777888876630--2
Q gi|254780163|r  259 -LGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIES---YAN-AILYIDEIHTLVGAGSASGISVDASNLLKPALS--S  331 (798)
Q Consensus       259 -~~~~i~~ld~~~l~ag~~~rg~fe~r~~~~~~~~~~---~~~-~ilfideih~ligag~~~g~~~d~an~lkP~L~--r  331 (798)
                       ...-++++|      +++.||=  +.++.+++.+.-   .++ -|..|||.|+|         +-+|.|-|.-.|.  -
T Consensus        87 g~~~DViEiD------aAs~~gV--ddIRel~e~v~~~P~~~~yKVyIIDEvhmL---------s~~AfNALLKtLEEPP  149 (462)
T PRK06305         87 GTSLDVIEID------GASHRGI--EDIRQINETVLFTPSKSQYKIYIIDEVHML---------TKEAFNSLLKTLEEPP  149 (462)
T ss_pred             CCCCCEEEEC------CCCCCCH--HHHHHHHHHHCCCCCCCCEEEEEEECHHHC---------CHHHHHHHHHHHHCCC
T ss_conf             8999868643------5534466--899999977100886775059998152117---------9999999999861898


Q ss_pred             CCEEEEEECCHHHHHHHHHCCHHHHHHCEEEEECCCCHHHHHHHHHHHHHHHHHHCCCEECCHHHHHHHHHHHHHCCCCC
Q ss_conf             66038873048999998520111432001443068786899999986127665410351211178999998654201555
Q gi|254780163|r  332 GAVRCIGSTTYSEYRQFFEKDKALVRRFQKIDVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRK  411 (798)
Q Consensus       332 g~~~~IgatT~~ey~~~~e~d~al~rrF~~i~v~ep~~~~~~~iL~~~~~~ye~~h~v~~~~~al~~av~ls~ryi~~r~  411 (798)
                      ....+|=+||..+  |..   +..-.|-|+......+.++-..-|+.+..    .-++.|.++||...++.|.-=+.|  
T Consensus       150 ~~v~FILaTTe~~--KIp---~TIlSRCQrf~F~~i~~~~I~~~L~~I~~----~E~i~~e~~AL~lIA~~a~GsmRD--  218 (462)
T PRK06305        150 QHVKFFLATTEIH--KIP---GTILSRCQKMHLKRIPEETIIDKLALIAQ----QDGIETSREALLPIARAAQGSLRD--  218 (462)
T ss_pred             CCEEEEEEECCHH--HCC---HHHHHHHHEEECCCCCHHHHHHHHHHHHH----HCCCCCCHHHHHHHHHHCCCCHHH--
T ss_conf             7749999818814--285---47876540233257999999999999999----839985999999999985895878--


Q ss_pred             CHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHH
Q ss_conf             6467988998653333211443221136578999866
Q gi|254780163|r  412 LPDKAIDVIDEAGASQILQPLSKRRKFITEKDIKKTI  448 (798)
Q Consensus       412 lPdkAidllDea~a~~~~~~~~~~~~~~~~~~i~~~~  448 (798)
                          |..+||.+-+..        ...|+.++|.+.+
T Consensus       219 ----AlslLDQ~i~~~--------~~~it~~~V~~~l  243 (462)
T PRK06305        219 ----AESLYDYVVGLF--------PKSLSPDTVAKAL  243 (462)
T ss_pred             ----HHHHHHHHHHHC--------CCCCCHHHHHHHH
T ss_conf             ----999999999847--------9986899999986


No 77 
>pfam00004 AAA ATPase family associated with various cellular activities (AAA). AAA family proteins often perform chaperone-like functions that assist in the assembly, operation, or disassembly of protein complexes.
Probab=99.28  E-value=1.2e-11  Score=102.89  Aligned_cols=115  Identities=34%  Similarity=0.524  Sum_probs=80.5

Q ss_pred             EEEECCCCHHHHHHHHHHHHHCCCCEEEEEHHHHHCCCCCCHHCCCCCHHCCCCCC---CCCCHHHHHCCCEEEEECCHH
Q ss_conf             88614320038899999873047733772068861246530110478000256444---310035551585177740445
Q gi|254780163|r  510 YVFSGPTGVGKTEISKQLAFALGVQLLRFDMSEYMERHAVSRLIGAPPGYVGFGQG---GILADSVDQNPYSVVLLDEIE  586 (798)
Q Consensus       510 flf~GptGvGKTelak~la~~~~~~lir~dmsey~e~~~vs~LiGappGYvG~~eg---g~Lte~vr~~P~sVvl~DEiE  586 (798)
                      .||.||+|+|||.+|+++|...+.+++.++++++..            .|+|..+.   ..+.++-+.+| ||+++||+|
T Consensus         1 iLl~GppGtGKT~~a~~la~~~~~~~~~v~~~~~~~------------~~~g~~~~~i~~~f~~a~~~~p-~Il~iDe~d   67 (131)
T pfam00004         1 LLLYGPPGTGKTTLAKAVAKELGAPFIEISGSELVS------------KYVGESEKRLRELFEAAKKLAP-CVIFIDEID   67 (131)
T ss_pred             CEEECCCCCCHHHHHHHHHHHHCCCCEECCCCCCCC------------CCCCHHHHHHHHHHHHHHHCCC-CEEEECHHH
T ss_conf             987899999999999999999789853324201222------------3345068889999999997499-189831167


Q ss_pred             HCCH-----------HHHHHHHHHHHHHHCCCCCCCEECCCCEEEEEECCCCHHHHHHCCCCCCCCCCHHHHHHHHHHHC
Q ss_conf             5028-----------99999999877750217799776125429999424214553303689882111488999998728
Q gi|254780163|r  587 KSHP-----------DVLNILLQIMDYGILTDQSGKKISFRNVILIMTTNAGALEMSKARIGFGSSRNDDADKEALRNFL  655 (798)
Q Consensus       587 KAh~-----------~v~~~llqild~G~ltd~~Gr~vdf~n~iii~TsN~G~~~~~~~~~g~~~~~~~~~~~~~l~~~f  655 (798)
                      .-.+           .+.+.||+.||.        ...+..+.++|+|||-=                         ..+
T Consensus        68 ~l~~~~~~~~~~~~~~~~~~ll~~ld~--------~~~~~~~v~~I~tTN~~-------------------------~~l  114 (131)
T pfam00004        68 ALAGSRGSGGDSESRRVVNQLLTELDG--------FTSSLSKVIVIAATNRP-------------------------DKL  114 (131)
T ss_pred             HHHCCCCCCCCCCCHHHHHHHHHHHHH--------CCCCCCCEEEEEECCCH-------------------------HHC
T ss_conf             775167888887513268789999850--------22468876999975990-------------------------449


Q ss_pred             CHHHH-CCCCEEEECC
Q ss_conf             87881-7768289628
Q gi|254780163|r  656 SPEFL-NRLDSIIPFF  670 (798)
Q Consensus       656 ~pefl-nRid~ii~F~  670 (798)
                      .|+++ +|+|.+|.|-
T Consensus       115 d~al~r~Rfd~~i~~p  130 (131)
T pfam00004       115 DPALLRGRFDRIIEFP  130 (131)
T ss_pred             CHHHHCCCCEEEEEEC
T ss_conf             9779628332899806


No 78 
>KOG2028 consensus
Probab=99.28  E-value=1.9e-10  Score=94.29  Aligned_cols=397  Identities=20%  Similarity=0.268  Sum_probs=201.8

Q ss_pred             CCCHHHHHH-------HHHHHHHCCCCHHHHHHHHHHHH--HHHHH-HCCCCCCEEEECCCCCHHHHHHHHHHHHHHCCC
Q ss_conf             530356544-------25887754861122217899999--99986-226778748966764116689999999985489
Q gi|254780163|r  184 FPALSAYCV-------DLTEKVKKGKVDILVGRHEEINR--TIQIL-CRRSKNNPLYVGDPGVGKTAIAEGFAKQIVDGM  253 (798)
Q Consensus       184 ~~~LdkFg~-------DLTe~AreGKLDPVIGRd~EI~r--iiqIL-~RR~KNn~~lvG~~gvGktaive~la~~i~~~~  253 (798)
                      ...|..+-.       -|.+.+|-..||-++|-+.-+-+  ++.-| ---+=+..||-|+||+|||+|+.-+|.--   .
T Consensus       111 ~~~l~~~e~R~~~qh~PLaermRPktL~dyvGQ~hlv~q~gllrs~ieq~~ipSmIlWGppG~GKTtlArlia~ts---k  187 (554)
T KOG2028         111 KRALAAEEIRQMLQHKPLAERMRPKTLDDYVGQSHLVGQDGLLRSLIEQNRIPSMILWGPPGTGKTTLARLIASTS---K  187 (554)
T ss_pred             CCHHHHHHHHHHHCCCCHHHHCCCCHHHHHCCHHHHCCCCHHHHHHHHCCCCCCEEEECCCCCCHHHHHHHHHHHC---C
T ss_conf             2112048888775169745541843687750534414832689999870888705886699876588999998605---7


Q ss_pred             CCHHHHEEEEEEEEHHHHHCCCC-CCCHHHHHHHHHHHHHCCCCCEEEEECCHHHHHCCCCCCCCCCCHHHHHHHHHCCC
Q ss_conf             88345201445540467530634-31237899999998720389839997361663015544434477788887663026
Q gi|254780163|r  254 VPDILLGARIFSLDMGNLIAGTR-YRGDFEERIKKIVKEIESYANAILYIDEIHTLVGAGSASGISVDASNLLKPALSSG  332 (798)
Q Consensus       254 vp~~l~~~~i~~ld~~~l~ag~~-~rg~fe~r~~~~~~~~~~~~~~ilfideih~ligag~~~g~~~d~an~lkP~L~rg  332 (798)
                      -+    -.++++++..  -|+++ .|+-||.- ++....  .....||||||||-.-   ++   .-|   ++.|....|
T Consensus       188 ~~----SyrfvelSAt--~a~t~dvR~ife~a-q~~~~l--~krkTilFiDEiHRFN---ks---QQD---~fLP~VE~G  249 (554)
T KOG2028         188 KH----SYRFVELSAT--NAKTNDVRDIFEQA-QNEKSL--TKRKTILFIDEIHRFN---KS---QQD---TFLPHVENG  249 (554)
T ss_pred             CC----CEEEEEEECC--CCCHHHHHHHHHHH-HHHHHH--HCCEEEEEEHHHHHHH---HH---HHH---CCCCEECCC
T ss_conf             77----4279997414--56618899999998-878765--2440698737765532---32---110---034213067


Q ss_pred             CEEEEEECCHHHHHHHHHCCHHHHHHCEEEEECCCCHHHHHHHHHHHHHHH---HH------HCCCEECCHHHHHHHHHH
Q ss_conf             603887304899999852011143200144306878689999998612766---54------103512111789999986
Q gi|254780163|r  333 AVRCIGSTTYSEYRQFFEKDKALVRRFQKIDVSEPSIEDAIEIVKGIKPYF---EE------HHQLRYSKEAIRAAVQLS  403 (798)
Q Consensus       333 ~~~~IgatT~~ey~~~~e~d~al~rrF~~i~v~ep~~~~~~~iL~~~~~~y---e~------~h~v~~~~~al~~av~ls  403 (798)
                      .|..|||||..-   .|.-+.||-.|-.++.++...++.-..||+.-...+   |.      +.-+.+.+.+|++.+.+|
T Consensus       250 ~I~lIGATTENP---SFqln~aLlSRC~VfvLekL~~n~v~~iL~raia~l~dser~~~~l~n~s~~ve~siidyla~ls  326 (554)
T KOG2028         250 DITLIGATTENP---SFQLNAALLSRCRVFVLEKLPVNAVVTILMRAIASLGDSERPTDPLPNSSMFVEDSIIDYLAYLS  326 (554)
T ss_pred             CEEEEECCCCCC---CCCHHHHHHHCCCEEEECCCCHHHHHHHHHHHHHHHCCCCCCCCCCCCCCHHHHHHHHHHHHHHC
T ss_conf             069985366897---60112778731606673368889999999999876321025688999831245688999998704


Q ss_pred             HHHCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHCCCCCCHHHHHCCHHHHHHHHCCHHHHHHHCHH
Q ss_conf             54201555646798899865333321144322113657899986631024531011100112334210000246653458
Q gi|254780163|r  404 VRHFTSRKLPDKAIDVIDEAGASQILQPLSKRRKFITEKDIKKTIASMNRSIHTTSFSRDDDSVLSNLEKNLGTVVYGQE  483 (798)
Q Consensus       404 ~ryi~~r~lPdkAidllDea~a~~~~~~~~~~~~~~~~~~i~~~~~~~~~gip~~~~~~~~~~~l~~l~~~l~~~v~GQ~  483 (798)
                      .--      -.-|..-|.-+.+..-.......+..++.+||.+.+..-.  +---+..    +.-.+.-..|++.+-|-|
T Consensus       327 dGD------aR~aLN~Lems~~m~~tr~g~~~~~~lSidDvke~lq~s~--~~YDr~G----e~HYntISA~HKSmRG~D  394 (554)
T KOG2028         327 DGD------ARAALNALEMSLSMFCTRSGQSSRVLLSIDDVKEGLQRSH--ILYDRAG----EEHYNTISALHKSMRGSD  394 (554)
T ss_pred             CCH------HHHHHHHHHHHHHHHHHHCCCCCCCEECHHHHHHHHHHCC--CEECCCC----HHHHHHHHHHHHHHCCCC
T ss_conf             731------8888778999999887524776564002888999985312--0004553----057789999987601776


Q ss_pred             H--HHHHHHHHHHHHHCCCCCCCCCCCEEEEECCCCHHHHHHHHHHH-HHCCC------CEEEEEHHHHHCCCCCCHHCC
Q ss_conf             9--99999999877520445657874068861432003889999987-30477------337720688612465301104
Q gi|254780163|r  484 E--AIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLA-FALGV------QLLRFDMSEYMERHAVSRLIG  554 (798)
Q Consensus       484 ~--ai~~v~~~i~~~~~gl~~~~rP~g~flf~GptGvGKTelak~la-~~~~~------~lir~dmsey~e~~~vs~LiG  554 (798)
                      +  ++--+++-       |....-|+              ..|+.|- |.+|+      +++..-.+-|+    ....+|
T Consensus       395 ~nAslY~LaRM-------LegGEdPL--------------YVARRlvR~ASEDIGlaD~S~L~~Avaa~q----av~~vG  449 (554)
T KOG2028         395 QNASLYWLARM-------LEGGEDPL--------------YVARRLVRFASEDIGLADPSALTQAVAAYQ----AVHFVG  449 (554)
T ss_pred             CCHHHHHHHHH-------HCCCCCCH--------------HHHHHHHHHHHCCCCCCCCHHHHHHHHHHH----HHHHHC
T ss_conf             55279999999-------71688707--------------999999987510337678036688999988----888808


Q ss_pred             CCCHHCCCCCCCCCCHHHHHCCCEEEEECCHHHCCHHHHHHHHHHHHHHHCCCCC--CCEECCCCEEEEEECCCCHHHHH
Q ss_conf             7800025644431003555158517774044550289999999987775021779--97761254299994242145533
Q gi|254780163|r  555 APPGYVGFGQGGILADSVDQNPYSVVLLDEIEKSHPDVLNILLQIMDYGILTDQS--GKKISFRNVILIMTTNAGALEMS  632 (798)
Q Consensus       555 appGYvG~~egg~Lte~vr~~P~sVvl~DEiEKAh~~v~~~llqild~G~ltd~~--Gr~vdf~n~iii~TsN~G~~~~~  632 (798)
                      -|-.-|=-   -|.+-++.+.|-||-+.-    |    +|.+-.+|.+   .++.  +--...||        +-...+.
T Consensus       450 mPE~dviL---AqC~v~lA~APKSievYr----a----~~~vka~ls~---~~~~~~~vPlHlRN--------APTkLMk  507 (554)
T KOG2028         450 MPECDVIL---AQCVVYLARAPKSIEVYR----A----YNAVKACLSN---HQGPLPEVPLHLRN--------APTKLMK  507 (554)
T ss_pred             CCHHHHHH---HHHHHHHHHCCCHHHHHH----H----HHHHHHHHHC---CCCCCCCCCCHHHC--------CCHHHHH
T ss_conf             93588899---999999984863039999----9----9999999743---25788888730302--------7378999


Q ss_pred             HCCCCCCCCC---CHHHHHHHHHHHCCHHHHCCCCE
Q ss_conf             0368988211---14889999987288788177682
Q gi|254780163|r  633 KARIGFGSSR---NDDADKEALRNFLSPEFLNRLDS  665 (798)
Q Consensus       633 ~~~~g~~~~~---~~~~~~~~l~~~f~peflnRid~  665 (798)
                      +  +|++..-   .+-.....-+.+|++|+++...+
T Consensus       508 e--LGY~KgYkYnPdy~~g~v~Qeylp~ell~~~~~  541 (554)
T KOG2028         508 E--LGYGKGYKYNPDYISGPVDQEYLPEELLEKCPN  541 (554)
T ss_pred             H--HCCCCCCCCCCCCCCCCCCHHHCCHHHHHHCCC
T ss_conf             8--376877557986655522044456999863655


No 79 
>PRK00080 ruvB Holliday junction DNA helicase RuvB; Reviewed
Probab=99.28  E-value=8.8e-11  Score=96.65  Aligned_cols=223  Identities=22%  Similarity=0.308  Sum_probs=111.0

Q ss_pred             CCHHHHHHHHHHHHHHHHH---HCCCCC---CEEEECCCCCHHHHHHHHHHHHHHCCCCCHHHHEEEEEEEEHHHHHCCC
Q ss_conf             6112221789999999986---226778---7489667641166899999999854898834520144554046753063
Q gi|254780163|r  202 KVDILVGRHEEINRTIQIL---CRRSKN---NPLYVGDPGVGKTAIAEGFAKQIVDGMVPDILLGARIFSLDMGNLIAGT  275 (798)
Q Consensus       202 KLDPVIGRd~EI~riiqIL---~RR~KN---n~~lvG~~gvGktaive~la~~i~~~~vp~~l~~~~i~~ld~~~l~ag~  275 (798)
                      .++-.||-++-.+++ .|.   +++++.   ..+|-|+||.|||+++.=+|..+..          .+...+..++--  
T Consensus        23 ~l~efiGQ~~i~~~L-~v~i~Aak~r~e~ldH~Ll~GPPGlGKTTLA~iiA~E~~~----------~~~~tsGP~lek--   89 (328)
T PRK00080         23 SLDEFIGQEKVKENL-KIFIEAAKKRGEALDHVLLYGPPGLGKTTLANIIANEMGV----------NIRITSGPALEK--   89 (328)
T ss_pred             CHHHCCCHHHHHHHH-HHHHHHHHHCCCCCCCEEEECCCCCCHHHHHHHHHHHHCC----------CCEECCCCCCCC--
T ss_conf             576635959999999-9999999964999880576588998899999999998688----------815624500167--


Q ss_pred             CCCCHHHHHHHHHHHHHCCCCCEEEEECCHHHHHCCCCCCCCCCCHHHHHHHHHCC--------------------CCEE
Q ss_conf             43123789999999872038983999736166301554443447778888766302--------------------6603
Q gi|254780163|r  276 RYRGDFEERIKKIVKEIESYANAILYIDEIHTLVGAGSASGISVDASNLLKPALSS--------------------GAVR  335 (798)
Q Consensus       276 ~~rg~fe~r~~~~~~~~~~~~~~ilfideih~ligag~~~g~~~d~an~lkP~L~r--------------------g~~~  335 (798)
                            -.-+-+++.-++  .+-||||||||-|         +-.+-.+|-|||.-                    -.+.
T Consensus        90 ------~~DL~~iLt~l~--~~dvLFIDEIHRl---------~~~vEE~LY~AMEDf~iDi~iG~g~~Ar~~~i~L~pFT  152 (328)
T PRK00080         90 ------AGDLAALLTNLE--EGDVLFIDEIHRL---------SPVVEEILYPAMEDFRLDIMIGKGPAARSIRLDLPPFT  152 (328)
T ss_pred             ------HHHHHHHHHHCC--CCCEEEEHHHHHC---------CHHHHHHHHHHHHHCEEEEEECCCCCCEEEECCCCCEE
T ss_conf             ------478999996088--7876765065324---------88899885798775234578647865324555899834


Q ss_pred             EEEECCHHHHHHHHHCCHHHHHHCEEEE-ECCCCHHHHHHHHHHHHHHHHHHCCCEECCHHHHHHHHHHHHHCCCCCCHH
Q ss_conf             8873048999998520111432001443-068786899999986127665410351211178999998654201555646
Q gi|254780163|r  336 CIGSTTYSEYRQFFEKDKALVRRFQKID-VSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLPD  414 (798)
Q Consensus       336 ~IgatT~~ey~~~~e~d~al~rrF~~i~-v~ep~~~~~~~iL~~~~~~ye~~h~v~~~~~al~~av~ls~ryi~~r~lPd  414 (798)
                      .|||||-..-     --..|..||-.+. ++.-+.++-.+|++.....+    ++.+++++......-|      |--|.
T Consensus       153 LIGATTr~g~-----Ls~PLrdRFGi~~~l~~Y~~eeL~~Ii~rsa~~l----~i~i~~~~~~eIA~rS------RGTPR  217 (328)
T PRK00080        153 LIGATTRAGL-----LTSPLRDRFGIVQRLEFYTVEELEKIVKRSARIL----GIEIDEEGALEIARRS------RGTPR  217 (328)
T ss_pred             EEECCCCCCC-----CCHHHHHHCCCEEEECCCCHHHHHHHHHHHHHHH----CCCCCHHHHHHHHHHC------CCCCH
T ss_conf             7401367665-----7767897579336634589999999999999983----9887899999999863------89839


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHCCCCCCHHHHHCCHHHHHHHHCCHH
Q ss_conf             7988998653333211443221136578999866310245310111001123342100002
Q gi|254780163|r  415 KAIDVIDEAGASQILQPLSKRRKFITEKDIKKTIASMNRSIHTTSFSRDDDSVLSNLEKNL  475 (798)
Q Consensus       415 kAidllDea~a~~~~~~~~~~~~~~~~~~i~~~~~~~~~gip~~~~~~~~~~~l~~l~~~l  475 (798)
                      -|..||..+--.+.+    +....|+.+.+...+..+  ||-..-+..-+...|..|-+..
T Consensus       218 iAnrLLrRvrDfa~v----~~~~~I~~~~~~~aL~~l--~ID~~GLd~~Dr~~L~~l~~~f  272 (328)
T PRK00080        218 IANRLLRRVRDFAQV----KGDGIITREIADKALDML--GVDELGLDEMDRKYLLTIIEKF  272 (328)
T ss_pred             HHHHHHHHHHHHHHH----CCCCCCCHHHHHHHHHHC--CCCCCCCCHHHHHHHHHHHHHC
T ss_conf             999999999999998----379965999999999956--9863489988999999999852


No 80 
>pfam01078 Mg_chelatase Magnesium chelatase, subunit ChlI. Magnesium-chelatase is a three-component enzyme that catalyses the insertion of Mg2+ into protoporphyrin IX. This is the first unique step in the synthesis of (bacterio)chlorophyll. Due to this, it is thought that Mg-chelatase has an important role in channelling inter- mediates into the (bacterio)chlorophyll branch in response to conditions suitable for photosynthetic growth. ChlI and BchD have molecular weight between 38-42 kDa.
Probab=99.27  E-value=1.9e-10  Score=94.20  Aligned_cols=178  Identities=28%  Similarity=0.331  Sum_probs=112.1

Q ss_pred             HHHHCHHHHHHHHHHHHHHHHCCCCCCCCCCCEEEEECCCCHHHHHHHHHHHHHCCCCEEEEEHHHHHCCCCCCH-----
Q ss_conf             665345899999999987752044565787406886143200388999998730477337720688612465301-----
Q gi|254780163|r  477 TVVYGQEEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFALGVQLLRFDMSEYMERHAVSR-----  551 (798)
Q Consensus       477 ~~v~GQ~~ai~~v~~~i~~~~~gl~~~~rP~g~flf~GptGvGKTelak~la~~~~~~lir~dmsey~e~~~vs~-----  551 (798)
                      ..|+||+.|..++.-|    -+|-+       .+|+.||.|+|||.+|+.+...+.. |-.-.+-|...-||++.     
T Consensus         3 ~di~GQ~~akrAl~iA----aaG~H-------~lLl~GpPG~GKTmlA~rl~~iLP~-l~~~e~le~~~i~S~~g~~~~~   70 (207)
T pfam01078         3 ADVKGQEQAKRALEIA----AAGGH-------NLLMIGPPGSGKTMLAKRLPGILPP-LTEQEALEVTAIHSVAGLGGDG   70 (207)
T ss_pred             HHHCCCHHHHHHHHHH----HCCCC-------CEEEECCCCCCHHHHHHHHHCCCCC-CCHHHHHHHHHHHCCCCCCCCC
T ss_conf             6863859999999998----54787-------5897889980299999763014899-8789988777642303687777


Q ss_pred             -HCCCC-----------CHHCCCC---CCCCCCHHHHHCCCEEEEECCHHHCCHHHHHHHHHHHHHHHCCCCC-CCEECC
Q ss_conf             -10478-----------0002564---4431003555158517774044550289999999987775021779-977612
Q gi|254780163|r  552 -LIGAP-----------PGYVGFG---QGGILADSVDQNPYSVVLLDEIEKSHPDVLNILLQIMDYGILTDQS-GKKISF  615 (798)
Q Consensus       552 -LiGap-----------pGYvG~~---egg~Lte~vr~~P~sVvl~DEiEKAh~~v~~~llqild~G~ltd~~-Gr~vdf  615 (798)
                       ++..|           .+.+|-+   .-|.+|-|    -..|++|||+-.-+++|++.|+|.|++|+++=+. |.++.|
T Consensus        71 ~l~~~rPfr~PHhs~s~~aliGGg~~~~PGeIslA----H~GVLFLDE~~Ef~~~vle~LrqpLE~~~v~IsRa~~~~~~  146 (207)
T pfam01078        71 GLIRRRPFRAPHHSASAAALVGGGSIPRPGEISLA----HNGVLFLDELPEFSRRVLESLRQPLEDGEITISRARAKVTF  146 (207)
T ss_pred             CCCCCCCCCCCCCCCCHHHCCCCCCCCCCCCEEEC----CCCEEEECCHHHCCHHHHHHHHHHHCCCCEEEEECCCEEEE
T ss_conf             74457986578876436332268888999706663----68788847646539889999987660494899956758986


Q ss_pred             -CCEEEEEECCCCHHHHHHCCCCCCCCCC-----HHHHHHHHHHHCCHHHHCCCCEEEECCCCCHHHH
Q ss_conf             -5429999424214553303689882111-----4889999987288788177682896288999999
Q gi|254780163|r  616 -RNVILIMTTNAGALEMSKARIGFGSSRN-----DDADKEALRNFLSPEFLNRLDSIIPFFPLSSDII  677 (798)
Q Consensus       616 -~n~iii~TsN~G~~~~~~~~~g~~~~~~-----~~~~~~~l~~~f~peflnRid~ii~F~~l~~~~~  677 (798)
                       .+.++|+++|-=       ..|+-.+..     .......-.+.++--++.|||-.|.-.+++.+++
T Consensus       147 PA~f~LvaA~NPC-------pCG~~~~~~~~C~C~~~~~~~Y~~rlSgPllDRiDl~v~~~~~~~~~l  207 (207)
T pfam01078       147 PARFQLVAAMNPC-------PCGYLGDPDKRCRCTPRQIRRYLSRLSGPLLDRIDLQVEVPRLSAEEL  207 (207)
T ss_pred             CCCEEEEEECCCC-------CCCCCCCCCCCCCCCHHHHHHHHHHCCHHHHCCEEEEEECCCCCHHHC
T ss_conf             0434888850577-------778788999975788999999987645220206878997789995769


No 81 
>CHL00095 clpC Clp protease ATP binding subunit
Probab=99.27  E-value=1.6e-07  Score=73.24  Aligned_cols=65  Identities=23%  Similarity=0.221  Sum_probs=55.6

Q ss_pred             CCCHHHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHCCCCHHHHHHHHCCCCHHHHHHHHHHHCC
Q ss_conf             46989999999999999980998125999878787377429999999849998999999983000
Q gi|254780163|r   81 KPTSSFQRVVQRAVLHVQSTGRGIVTGANILVALFSEPDSHATYFLQEQEMTLYDAVNFISHGIS  145 (798)
Q Consensus        81 ~~S~~l~rVL~~A~~~A~~~G~~~I~~eHLLLALL~e~ds~a~~iL~~~gis~~~v~~~i~~~~~  145 (798)
                      .||+.++++|..|...|..+++.+|+++|||+||+.+.++.+..+|..++++...+...+...+.
T Consensus         4 kfT~~a~~~L~~A~~~A~~~~h~~V~~eHLLlaLl~~~~~~~~~~L~~~~vd~~~l~~~l~~~~~   68 (823)
T CHL00095          4 RFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAARALKSLNVNLKDARKEVEKYIG   68 (823)
T ss_pred             HHHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHCCCCCHHHHHHHHCCCCHHHHHHHHHHHHH
T ss_conf             36699999999999999985989408999999997499847999999869999999999999984


No 82 
>PRK07940 DNA polymerase III subunit delta'; Validated
Probab=99.27  E-value=9.3e-11  Score=96.48  Aligned_cols=160  Identities=16%  Similarity=0.299  Sum_probs=104.8

Q ss_pred             HHHHCHHHHHHHHHHHHHHHHCCC----CCCCCCCCEEEEECCCCHHHHHHHHHHHHHC--CCC-----EEEEEHHHHHC
Q ss_conf             665345899999999987752044----5657874068861432003889999987304--773-----37720688612
Q gi|254780163|r  477 TVVYGQEEAIKKLSSSIKIARAGL----SDPNKPIGCYVFSGPTGVGKTEISKQLAFAL--GVQ-----LLRFDMSEYME  545 (798)
Q Consensus       477 ~~v~GQ~~ai~~v~~~i~~~~~gl----~~~~rP~g~flf~GptGvGKTelak~la~~~--~~~-----lir~dmsey~e  545 (798)
                      ..|+||+++|..+-+|++..|+|+    ..+++..-.|||+||.|+|||.+|+.+|..+  +..     -..-.|-.+. 
T Consensus         5 ~~ivGQe~v~~~L~~A~~~~R~~~~~~~~~~~~~~HAyLF~Gp~G~Gk~~~A~~~A~~l~C~~~~~~~cg~C~~C~~i~-   83 (395)
T PRK07940          5 DRLVGQDAVVAELRAAARAARADSAHSAAAGSGMTHAWLFTGPPGSGRSNAARAFAAALQCTDPGVPGCGECRACRTVL-   83 (395)
T ss_pred             HHHCCCHHHHHHHHHHHHHCCCCCCCCCCCCCCCCEEEEEECCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHH-
T ss_conf             1315929999999999983634344333346876603763689987889999999999669999999998787899987-


Q ss_pred             CCCCCHHCCCCCHH---------CCCCCCCCCCHHHHHCC----CEEEEECCHHHCCHHHHHHHHHHHHHHHCCCCCCCE
Q ss_conf             46530110478000---------25644431003555158----517774044550289999999987775021779977
Q gi|254780163|r  546 RHAVSRLIGAPPGY---------VGFGQGGILADSVDQNP----YSVVLLDEIEKSHPDVLNILLQIMDYGILTDQSGKK  612 (798)
Q Consensus       546 ~~~vs~LiGappGY---------vG~~egg~Lte~vr~~P----~sVvl~DEiEKAh~~v~~~llqild~G~ltd~~Gr~  612 (798)
                             -|+-|-+         +|-|+==.|.+.+..+|    |-|+++|+.|+-.+.-+|.||..|+|--        
T Consensus        84 -------~g~hpDv~~i~p~~~~i~id~iR~l~~~~~~~p~~~~~kv~ii~~a~~m~~~a~NalLKtLEEPp--------  148 (395)
T PRK07940         84 -------AGTHPDVRVVVPEGLSIGVDEVREIVQIAARRPTTGRWRIVVIEDADRLTERAANALLKAVEEPP--------  148 (395)
T ss_pred             -------CCCCCCEEEEECCCCCCCHHHHHHHHHHHHHCCCCCCCEEEEEECHHHHCHHHHHHHHHHHCCCC--------
T ss_conf             -------68998718982687768899999999998527303795599980778748999999998521788--------


Q ss_pred             ECCCCEEEEEECCCCHHHHHHCCCCCCCCCCHHHHHHHHHHHCCHHHHCCCCEEEECCCCCHHHHHHHH
Q ss_conf             612542999942421455330368988211148899999872887881776828962889999999999
Q gi|254780163|r  613 ISFRNVILIMTTNAGALEMSKARIGFGSSRNDDADKEALRNFLSPEFLNRLDSIIPFFPLSSDIIRQVV  681 (798)
Q Consensus       613 vdf~n~iii~TsN~G~~~~~~~~~g~~~~~~~~~~~~~l~~~f~peflnRid~ii~F~~l~~~~~~~i~  681 (798)
                         .+++||++++--                         ..+.|--+.|. ..+.|+|++.+++.+.+
T Consensus       149 ---~~~~fiL~t~~~-------------------------~~llpTI~SRc-q~~~f~~~~~~~i~~~L  188 (395)
T PRK07940        149 ---PRTVWLLCAPSV-------------------------EDVLPTIRSRC-RHVALRTPSVEAVADVL  188 (395)
T ss_pred             ---CCEEEEEEECCH-------------------------HHHHHHHHHHH-EECCCCCCCHHHHHHHH
T ss_conf             ---886999873997-------------------------87446887440-00237999999999999


No 83 
>PRK00440 rfc replication factor C small subunit; Reviewed
Probab=99.27  E-value=6.6e-11  Score=97.52  Aligned_cols=173  Identities=21%  Similarity=0.381  Sum_probs=108.4

Q ss_pred             HHHHCHHHHHHHHHHHHHHHHCCCCCCCCCCCEEEEECCCCHHHHHHHHHHH---HHC--CCCEEEEEHHHHHCCCCCCH
Q ss_conf             6653458999999999877520445657874068861432003889999987---304--77337720688612465301
Q gi|254780163|r  477 TVVYGQEEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLA---FAL--GVQLLRFDMSEYMERHAVSR  551 (798)
Q Consensus       477 ~~v~GQ~~ai~~v~~~i~~~~~gl~~~~rP~g~flf~GptGvGKTelak~la---~~~--~~~lir~dmsey~e~~~vs~  551 (798)
                      ..++||++++..+...+..       .+-|  .+||.||+|+|||-+|++||   |+.  ..+++.+|-|+-..-..|..
T Consensus        16 ~di~g~~~~~~~L~~~i~~-------~~~p--hlLf~GppG~GKTt~a~~la~~l~~~~~~~~~lelnasd~r~id~vr~   86 (318)
T PRK00440         16 DEVVGQEEIVERLKSFVKE-------KNMP--HLLFAGPPGTGKTTAALALARELYGEYWRENFLELNASDERGIDVIRN   86 (318)
T ss_pred             HHHCCCHHHHHHHHHHHHC-------CCCC--EEEEECCCCCCHHHHHHHHHHHHCCCCCCCCEEEECCCCCCCHHHHHH
T ss_conf             9941969999999999987-------9986--698889599889999999999976986434768951645667178999


Q ss_pred             HCCCCCHHCCCCCCCCCCHHHHHCCCEEEEECCHHHCCHHHHHHHHHHHHHHHCCCCCCCEECCCCEEEEEECCCCHHHH
Q ss_conf             10478000256444310035551585177740445502899999999877750217799776125429999424214553
Q gi|254780163|r  552 LIGAPPGYVGFGQGGILADSVDQNPYSVVLLDEIEKSHPDVLNILLQIMDYGILTDQSGKKISFRNVILIMTTNAGALEM  631 (798)
Q Consensus       552 LiGappGYvG~~egg~Lte~vr~~P~sVvl~DEiEKAh~~v~~~llqild~G~ltd~~Gr~vdf~n~iii~TsN~G~~~~  631 (798)
                      .|..   |.       -+..+...||-|+++||++.-+.+-++.|+.++++-           -+||.+|+++|--+.. 
T Consensus        87 ~i~~---~~-------~~~~~~~~~~kiiiiDE~d~l~~~aq~aL~~~mE~~-----------~~~~~fil~~n~~~ki-  144 (318)
T PRK00440         87 KIKE---FA-------RTAPVGGAPFKIIFLDEADNLTSDAQQALRRTMEMY-----------SQTTRFILSCNYSSKI-  144 (318)
T ss_pred             HHHH---HH-------HHCCCCCCCEEEEEEECCCCCCHHHHHHHHHHHHCC-----------CCCCEEEEECCCCCCC-
T ss_conf             9999---99-------726778997389998685532255678887643105-----------6662588634883337-


Q ss_pred             HHCCCCCCCCCCHHHHHHHHHHHCCHHHHCCCCEEEECCCCCHHHHHHHHHHHHHHHHHHHHHCCCEEEECHHHHHHHHH
Q ss_conf             30368988211148899999872887881776828962889999999999999999999998669889998899999997
Q gi|254780163|r  632 SKARIGFGSSRNDDADKEALRNFLSPEFLNRLDSIIPFFPLSSDIIRQVVHKFIMKLELQLQEKGISFHFSEEVINWLVS  711 (798)
Q Consensus       632 ~~~~~g~~~~~~~~~~~~~l~~~f~peflnRid~ii~F~~l~~~~~~~i~~~~l~~l~~~l~~~~i~l~~~~~~~~~l~~  711 (798)
                                      .+        ...+|. ..+-|+|++.+++...+..    +.   ...|  +.+++++++.|+.
T Consensus       145 ----------------i~--------~i~SRc-~~i~f~~~~~~~i~~~L~~----I~---~~E~--i~~~~~~l~~i~~  190 (318)
T PRK00440        145 ----------------ID--------PIQSRC-AVFRFSPLPKEAVIERLRY----IA---KNEG--LEITDDALEAIYY  190 (318)
T ss_pred             ----------------CC--------CHHHHH-EEEECCCCCHHHHHHHHHH----HH---HHCC--CCCCHHHHHHHHH
T ss_conf             ----------------61--------556551-0111578999999999999----99---9859--9989999999998


Q ss_pred             CCC
Q ss_conf             189
Q gi|254780163|r  712 HGY  714 (798)
Q Consensus       712 ~~~  714 (798)
                      .+.
T Consensus       191 ~s~  193 (318)
T PRK00440        191 VSE  193 (318)
T ss_pred             HCC
T ss_conf             649


No 84 
>pfam00158 Sigma54_activat Sigma-54 interaction domain.
Probab=99.26  E-value=2.9e-11  Score=100.14  Aligned_cols=159  Identities=20%  Similarity=0.320  Sum_probs=113.6

Q ss_pred             HHCHHHHHHHHHHHHHHHHCCCCCCCCCCCEEEEECCCCHHHHHHHHHHHHHC---CCCEEEEEHHHHHCCCCCCHHCCC
Q ss_conf             53458999999999877520445657874068861432003889999987304---773377206886124653011047
Q gi|254780163|r  479 VYGQEEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFAL---GVQLLRFDMSEYMERHAVSRLIGA  555 (798)
Q Consensus       479 v~GQ~~ai~~v~~~i~~~~~gl~~~~rP~g~flf~GptGvGKTelak~la~~~---~~~lir~dmsey~e~~~vs~LiGa  555 (798)
                      +||+..++..+.+.+.+.    ...+.|   .|..|++|+||+.+|+++-..+   ..+|+++||+.+.+.---+.|.|.
T Consensus         1 lIG~S~~m~~l~~~i~~~----a~~~~p---VLI~GE~GtGK~~lAr~IH~~S~r~~~pfi~vnc~~~~~~~le~~LFG~   73 (168)
T pfam00158         1 LIGESPAMQEVLELAKRV----APTDAT---VLITGESGTGKELFARAIHQLSPRADGPFVAVNCAAIPEELLESELFGH   73 (168)
T ss_pred             CEECCHHHHHHHHHHHHH----HCCCCC---EEEECCCCCCHHHHHHHHHHHCCCCCCCCCCCCCCCCCHHHHHHHHCCC
T ss_conf             973899999999999999----588998---8998999888899999999852435688312567899877999987587


Q ss_pred             CCH-HCCCC--CCCCCCHHHHHCCCEEEEECCHHHCCHHHHHHHHHHHHHHHCCCCCCCEECCCCEEEEEECCCCHHHHH
Q ss_conf             800-02564--443100355515851777404455028999999998777502177997761254299994242145533
Q gi|254780163|r  556 PPG-YVGFG--QGGILADSVDQNPYSVVLLDEIEKSHPDVLNILLQIMDYGILTDQSGKKISFRNVILIMTTNAGALEMS  632 (798)
Q Consensus       556 ppG-YvG~~--egg~Lte~vr~~P~sVvl~DEiEKAh~~v~~~llqild~G~ltd~~Gr~vdf~n~iii~TsN~G~~~~~  632 (798)
                      -+| |-|-.  .-|.|    .+.....++||||+...++++.-||+++++|..+--.+.+---.|+=||.||+.-     
T Consensus        74 ~~g~f~ga~~~~~G~l----e~A~gGTL~LdeI~~L~~~~Q~~Ll~~L~~~~~~~~g~~~~~~~~vRiIast~~~-----  144 (168)
T pfam00158        74 EKGAFTGAVSDRKGLF----ELADGGTLFLDEIGELPLELQAKLLRVLQEGEFERVGGTKPIKVDVRIIAATNRD-----  144 (168)
T ss_pred             CCCCCCCCCCCCCCCE----EECCCCEEECCCHHHCCHHHHHHHHHHHHCCEEEECCCCCEEEEEEEEEEECCCC-----
T ss_conf             6676689875789964----2269987880244139999999999998579699779984588854999965988-----


Q ss_pred             HCCCCCCCCCCHHHHHHH-HHHHCCHHHHCCCCEEEE
Q ss_conf             036898821114889999-987288788177682896
Q gi|254780163|r  633 KARIGFGSSRNDDADKEA-LRNFLSPEFLNRLDSIIP  668 (798)
Q Consensus       633 ~~~~g~~~~~~~~~~~~~-l~~~f~peflnRid~ii~  668 (798)
                                    ..+. -+..|+++++-||. |++
T Consensus       145 --------------L~~~v~~G~Fr~DLyyrLn-v~~  166 (168)
T pfam00158       145 --------------LEEAVAEGRFREDLYYRLN-VVP  166 (168)
T ss_pred             --------------HHHHHHCCCCHHHHHHHHC-EEE
T ss_conf             --------------9999883996399888865-232


No 85 
>TIGR02928 TIGR02928 orc1/cdc6 family replication initiation protein; InterPro: IPR014277   This set of DNA binding proteins shows homology to the origin recognition complex subunit 1/cell division control protein 6 family in eukaryotes. The proteins in this entry are found exclusively in the archaea. Several members may be found in a genome and interact with each other..
Probab=99.26  E-value=2.1e-09  Score=86.79  Aligned_cols=318  Identities=21%  Similarity=0.265  Sum_probs=193.8

Q ss_pred             HHHHHHHHHHHHHHH----HH-CCCCCCEEEECCCCCHHHHHHHHHHHHHHCC----C---CCHHHHEEEEEEEE-----
Q ss_conf             222178999999998----62-2677874896676411668999999998548----9---88345201445540-----
Q gi|254780163|r  205 ILVGRHEEINRTIQI----LC-RRSKNNPLYVGDPGVGKTAIAEGFAKQIVDG----M---VPDILLGARIFSLD-----  267 (798)
Q Consensus       205 PVIGRd~EI~riiqI----L~-RR~KNn~~lvG~~gvGktaive~la~~i~~~----~---vp~~l~~~~i~~ld-----  267 (798)
                      -+.|||+||+.+...    |. -.+=+|+++-|++|+||||++.-+.+++.+.    +   |--.--||..++-.     
T Consensus        18 ~i~hRdeqI~~l~~~L~~~l~PG~~P~Ni~iYGkTGtGKT~vt~~v~~~l~~~~~~~d~~D~~~~~~NC~~~~T~y~~~~   97 (383)
T TIGR02928        18 RIVHRDEQIEELAKALRPILRPGSRPSNIFIYGKTGTGKTAVTKYVMKELEEAAEDRDVRDVSTVYINCQILDTSYQVLV   97 (383)
T ss_pred             CCCCCHHHHHHHHHHHHHHHCCCCCCCCEEEECCCCCCHHHHHHHHHHHHHHHHHCCCCCCEEEEEECCCCCCCHHHHHH
T ss_conf             46686789999999988750674898725887888987889999999999998622699715899977854684699999


Q ss_pred             -HHHHH--CCC----CCCCH-HHHHHHHHHHHHC-CCCC-EEEEECCHHHHHCCCCCCCCCCCHHHHH----HH----HH
Q ss_conf             -46753--063----43123-7899999998720-3898-3999736166301554443447778888----76----63
Q gi|254780163|r  268 -MGNLI--AGT----RYRGD-FEERIKKIVKEIE-SYAN-AILYIDEIHTLVGAGSASGISVDASNLL----KP----AL  329 (798)
Q Consensus       268 -~~~l~--ag~----~~rg~-fe~r~~~~~~~~~-~~~~-~ilfideih~ligag~~~g~~~d~an~l----kP----~L  329 (798)
                       +..=+  ++.    .++|= +.+-++.+.+++. +.+. +|...|||-.|| -+..+.-  --|.+|    +=    .+
T Consensus        98 ~L~~~ln~~~~~~~vP~tG~s~~~~~~~l~~~l~~~~~~~~~ivLDEiD~Lv-~~~~d~P--AyS~~LY~L~Ra~~~~~~  174 (383)
T TIGR02928        98 ELANQLNRRGSGEEVPTTGLSTSEVFRELYKELNRERGDSLIIVLDEIDKLV-RKDDDDP--AYSKLLYQLSRARENGDL  174 (383)
T ss_pred             HHHHHHCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHCCCEEEEEECCCCHHH-CCCCCCH--HHHHHHHHHHHHHHCCCC
T ss_conf             9999851577888898877878999999999983201887999862310221-5888880--787885343310003577


Q ss_pred             CCCCEEEEEECCHHHHHHHHHCCHHHHHHCEE--EEECCCCHHHHHHHHHHHHHHH-H-HHCCCEECCHHHHHHHHHHHH
Q ss_conf             02660388730489999985201114320014--4306878689999998612766-5-410351211178999998654
Q gi|254780163|r  330 SSGAVRCIGSTTYSEYRQFFEKDKALVRRFQK--IDVSEPSIEDAIEIVKGIKPYF-E-EHHQLRYSKEAIRAAVQLSVR  405 (798)
Q Consensus       330 ~rg~~~~IgatT~~ey~~~~e~d~al~rrF~~--i~v~ep~~~~~~~iL~~~~~~y-e-~~h~v~~~~~al~~av~ls~r  405 (798)
                      ....+-+||.|---.|+..+  |+--...|++  |.=++=+.++=..||.   .|- | +||.=-++|++|..|+.++++
T Consensus       175 ~~~~vgvIgISND~~f~~~L--d~RVkSsL~~eei~FpPYdA~eL~~IL~---~R~v~~AF~dGvl~d~VI~lcAA~aAq  249 (383)
T TIGR02928       175 ENAKVGVIGISNDLKFRENL--DPRVKSSLCEEEIVFPPYDAEELRDILE---NRAVEKAFYDGVLDDGVIPLCAALAAQ  249 (383)
T ss_pred             CCCCEEEEEEECCCHHHHHC--CCCEECCCCCCCCEECCCCHHHHHHHHH---HHHHHHCCCCCCCCHHHHHHHHHHHHC
T ss_conf             88534899986571436445--7530132487400407988699999997---203120336885462279999998620


Q ss_pred             HCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHC-CCCCCHHHHHCCHHHHHHHHCCHHHHHHHCHHH
Q ss_conf             2015556467988998653333211443221136578999866310-245310111001123342100002466534589
Q gi|254780163|r  406 HFTSRKLPDKAIDVIDEAGASQILQPLSKRRKFITEKDIKKTIASM-NRSIHTTSFSRDDDSVLSNLEKNLGTVVYGQEE  484 (798)
Q Consensus       406 yi~~r~lPdkAidllDea~a~~~~~~~~~~~~~~~~~~i~~~~~~~-~~gip~~~~~~~~~~~l~~l~~~l~~~v~GQ~~  484 (798)
                      ==-|   =-||||||-.||=-+.    .+....|+++||.+.-.+. ..                   .++.+.|-|.+.
T Consensus       250 ~hGD---AR~AiDLLR~AGe~A~----~~g~~~Vt~~HV~~A~e~~PE~-------------------~r~~e~~~~Lp~  303 (383)
T TIGR02928       250 EHGD---ARKAIDLLRVAGEIAE----REGAERVTEDHVEEAQEKIPEV-------------------DRVLELIRGLPT  303 (383)
T ss_pred             CCCC---HHHHHHHHHHHHHHHH----HCCCCCCHHHHHHHHHHHCCHH-------------------HHHHHHHHCCCH
T ss_conf             6787---8999999998768753----1576310088899999832228-------------------899998607986


Q ss_pred             HHHHHHHHHHHHHCCCCCCCCCCCEEEEECCCCHHHHHHHHHHH-HHCCCCEEEEEHHHHHCCCCCCHHCCCCCHHCCCC
Q ss_conf             99999999877520445657874068861432003889999987-30477337720688612465301104780002564
Q gi|254780163|r  485 AIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLA-FALGVQLLRFDMSEYMERHAVSRLIGAPPGYVGFG  563 (798)
Q Consensus       485 ai~~v~~~i~~~~~gl~~~~rP~g~flf~GptGvGKTelak~la-~~~~~~lir~dmsey~e~~~vs~LiGappGYvG~~  563 (798)
                      -=..+..|+.....  ..|++.   +.   .||..= +.=+.+| ...-+++-+==|++|+.+.+.--|+.+-  ..+.+
T Consensus       304 h~k~~L~A~~~l~~--~~~~~~---~~---~t~~vY-~~Y~~~c~~~~~dpl~~rR~~~~l~eL~~LG~~~~~--~~~~G  372 (383)
T TIGR02928       304 HSKLVLLAIANLAA--ESPEED---PF---RTGEVY-EVYKELCEDIGVDPLTQRRISDLLNELDMLGLVEAE--ERNKG  372 (383)
T ss_pred             HHHHHHHHHHHHHH--HCCCCC---EE---EEHHHH-HHHHHHHHHHCCCCCCHHHHHHHHHHHHHCCCEEEE--EEECC
T ss_conf             79999999999985--167887---36---612778-999999876267766146799988767660733456--77426


Q ss_pred             C-CCC
Q ss_conf             4-431
Q gi|254780163|r  564 Q-GGI  567 (798)
Q Consensus       564 e-gg~  567 (798)
                      . +|.
T Consensus       373 ~g~G~  377 (383)
T TIGR02928       373 RGGGR  377 (383)
T ss_pred             CCCCE
T ss_conf             77643


No 86 
>PRK00080 ruvB Holliday junction DNA helicase RuvB; Reviewed
Probab=99.25  E-value=1.1e-09  Score=88.84  Aligned_cols=200  Identities=21%  Similarity=0.287  Sum_probs=132.3

Q ss_pred             HHCCHHHHHHHCHHHHHHHHHHHHHHHHCCCCCCCCCCCEEEEECCCCHHHHHHHHHHHHHCCCCEEEEEHHHHHCCCCC
Q ss_conf             10000246653458999999999877520445657874068861432003889999987304773377206886124653
Q gi|254780163|r  470 NLEKNLGTVVYGQEEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFALGVQLLRFDMSEYMERHAV  549 (798)
Q Consensus       470 ~l~~~l~~~v~GQ~~ai~~v~~~i~~~~~gl~~~~rP~g~flf~GptGvGKTelak~la~~~~~~lir~dmsey~e~~~v  549 (798)
                      .|.-.--..+|||++.++.+.-.|.-++    ..+.|+.-.||.||+|.|||.||..+|..++.++-...-.-..-+.  
T Consensus        18 ~lRP~~l~efiGQ~~i~~~L~v~i~Aak----~r~e~ldH~Ll~GPPGlGKTTLA~iiA~E~~~~~~~tsGP~lek~~--   91 (328)
T PRK00080         18 SLRPKSLDEFIGQEKVKENLKIFIEAAK----KRGEALDHVLLYGPPGLGKTTLANIIANEMGVNIRITSGPALEKAG--   91 (328)
T ss_pred             CCCCCCHHHCCCHHHHHHHHHHHHHHHH----HCCCCCCCEEEECCCCCCHHHHHHHHHHHHCCCCEECCCCCCCCHH--
T ss_conf             5598857663595999999999999999----6499988057658899889999999999868881562450016747--


Q ss_pred             CHHCCCCCHHCCCCCCCCCCHHHHHCCCEEEEECCHHHCCHHHHHHHHHHHHHHHCCC--CCC---CEE--CCCC-EEEE
Q ss_conf             0110478000256444310035551585177740445502899999999877750217--799---776--1254-2999
Q gi|254780163|r  550 SRLIGAPPGYVGFGQGGILADSVDQNPYSVVLLDEIEKSHPDVLNILLQIMDYGILTD--QSG---KKI--SFRN-VILI  621 (798)
Q Consensus       550 s~LiGappGYvG~~egg~Lte~vr~~P~sVvl~DEiEKAh~~v~~~llqild~G~ltd--~~G---r~v--df~n-~iii  621 (798)
                                   |=-+.||.   -+|..|++.|||..-++.|-.+|+..|+|.++.=  +.|   |.+  +... |+|=
T Consensus        92 -------------DL~~iLt~---l~~~dvLFIDEIHRl~~~vEE~LY~AMEDf~iDi~iG~g~~Ar~~~i~L~pFTLIG  155 (328)
T PRK00080         92 -------------DLAALLTN---LEEGDVLFIDEIHRLSPVVEEILYPAMEDFRLDIMIGKGPAARSIRLDLPPFTLIG  155 (328)
T ss_pred             -------------HHHHHHHH---CCCCCEEEEHHHHHCCHHHHHHHHHHHHHCEEEEEECCCCCCEEEECCCCCEEEEE
T ss_conf             -------------89999960---88787676506532488899885798775234578647865324555899834740


Q ss_pred             EECCCCHHHHHHCCCCCCCCCCHHHHHHHHHHHCCHHHHCCCCEEEECCCCCHHHHHHHHHHHHHHHHHHHHHCCCEEEE
Q ss_conf             94242145533036898821114889999987288788177682896288999999999999999999999866988999
Q gi|254780163|r  622 MTTNAGALEMSKARIGFGSSRNDDADKEALRNFLSPEFLNRLDSIIPFFPLSSDIIRQVVHKFIMKLELQLQEKGISFHF  701 (798)
Q Consensus       622 ~TsN~G~~~~~~~~~g~~~~~~~~~~~~~l~~~f~peflnRid~ii~F~~l~~~~~~~i~~~~l~~l~~~l~~~~i~l~~  701 (798)
                      -|+-.|                          ..+..|.+|+--+.-|...+.+++.+|+...-+.         ..+.+
T Consensus       156 ATTr~g--------------------------~Ls~PLrdRFGi~~~l~~Y~~eeL~~Ii~rsa~~---------l~i~i  200 (328)
T PRK00080        156 ATTRAG--------------------------LLTSPLRDRFGIVQRLEFYTVEELEKIVKRSARI---------LGIEI  200 (328)
T ss_pred             CCCCCC--------------------------CCCHHHHHHCCCEEEECCCCHHHHHHHHHHHHHH---------HCCCC
T ss_conf             136766--------------------------5776789757933663458999999999999998---------39887


Q ss_pred             CHHHHHHHHHCCC-CCCCCCHHHHHH
Q ss_conf             8899999997189-810153267999
Q gi|254780163|r  702 SEEVINWLVSHGY-DVKMGARPLERI  726 (798)
Q Consensus       702 ~~~~~~~l~~~~~-~~~~GAR~l~r~  726 (798)
                      ++++...|++++- .|.---|-|+|+
T Consensus       201 ~~~~~~eIA~rSRGTPRiAnrLLrRv  226 (328)
T PRK00080        201 DEEGALEIARRSRGTPRIANRLLRRV  226 (328)
T ss_pred             CHHHHHHHHHHCCCCCHHHHHHHHHH
T ss_conf             89999999986389839999999999


No 87 
>TIGR02640 gas_vesic_GvpN gas vesicle protein GvpN; InterPro: IPR013462    The GvpN protein is associated with the production of gas vesicles produced in some prokaryotes to give cells buoyancy , . It belongs to a larger family of ATPases .; GO: 0000166 nucleotide binding, 0005524 ATP binding, 0031412 gas vesicle organization and biogenesis, 0031411 gas vesicle.
Probab=99.24  E-value=6.2e-11  Score=97.71  Aligned_cols=130  Identities=25%  Similarity=0.478  Sum_probs=96.9

Q ss_pred             HHHHHHHHHHHHHHHHCCCCCCCCCCCEEEEECCCCHHHHHHHHHHHHHCCCCEEEEEHHHHHCCCCCCHHCCCCCHHCC
Q ss_conf             58999999999877520445657874068861432003889999987304773377206886124653011047800025
Q gi|254780163|r  482 QEEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFALGVQLLRFDMSEYMERHAVSRLIGAPPGYVG  561 (798)
Q Consensus       482 Q~~ai~~v~~~i~~~~~gl~~~~rP~g~flf~GptGvGKTelak~la~~~~~~lir~dmsey~e~~~vs~LiGappGYvG  561 (798)
                      |+++|..|.....+.   |+ .++|+   =|.||+|+|||-||..||...+.+.+-+.=-   ..-.-|=|||+-.||--
T Consensus         3 ~t~~v~~v~~R~l~y---L~-~G~Pv---Hl~GPaG~GKT~LA~hvA~~r~RPV~l~~Gd---~eL~~~DLvG~~~g~~~   72 (265)
T TIGR02640         3 ETDAVKRVTSRALRY---LK-SGYPV---HLRGPAGTGKTTLAMHVARKRDRPVVLINGD---AELTTSDLVGSYAGYTR   72 (265)
T ss_pred             CCHHHHHHHHHHHHH---HC-CCCCE---EEECCCCCCHHHHHHHHHHHCCCCEEEEECC---CCCCCCCCCCCCCCCEE
T ss_conf             772379999987663---22-78866---7447888556899999997368968998658---23265442315467522


Q ss_pred             -------------CCC-------CCCCCHHHHHCCCEEEEECCHHHCCHHHHHHHHHHHHHHHCCC----CCCCEE----
Q ss_conf             -------------644-------4310035551585177740445502899999999877750217----799776----
Q gi|254780163|r  562 -------------FGQ-------GGILADSVDQNPYSVVLLDEIEKSHPDVLNILLQIMDYGILTD----QSGKKI----  613 (798)
Q Consensus       562 -------------~~e-------gg~Lte~vr~~P~sVvl~DEiEKAh~~v~~~llqild~G~ltd----~~Gr~v----  613 (798)
                                   -+|       -+.||.||| .-|+ +..|||-..-|.+.|+||.||+||.|.=    ++-+-|    
T Consensus        73 ~kv~DqfihnV~K~~d~~~~~W~D~rLt~Av~-eG~T-LVYdEF~RskP~~nNVLLSvlEE~vL~LPg~~~~~~Yv~VhP  150 (265)
T TIGR02640        73 KKVVDQFIHNVVKLEDIVRQNWVDNRLTLAVR-EGFT-LVYDEFTRSKPETNNVLLSVLEEGVLELPGKRGESRYVDVHP  150 (265)
T ss_pred             EEEEECCEEEEECCCCCCCCCCCCCHHHHHHH-CCCE-EEECCCCCCCCHHHHHHHHHHHHHHHCCCCCCCCCCCEEECC
T ss_conf             22320121113425122002667835789975-6972-766475788620456567555523215888787787225788


Q ss_pred             CCCCEEEEEECCC
Q ss_conf             1254299994242
Q gi|254780163|r  614 SFRNVILIMTTNA  626 (798)
Q Consensus       614 df~n~iii~TsN~  626 (798)
                      +||   .|+|||-
T Consensus       151 ~FR---~IfTSNp  160 (265)
T TIGR02640       151 EFR---VIFTSNP  160 (265)
T ss_pred             CCC---EEECCCC
T ss_conf             702---4631487


No 88 
>PRK09112 DNA polymerase III subunit delta'; Validated
Probab=99.24  E-value=1.4e-10  Score=95.20  Aligned_cols=164  Identities=21%  Similarity=0.362  Sum_probs=100.3

Q ss_pred             HHHHHHCHHHHHHHHHHHHHHHHCCCCCCCCCCCEEEEECCCCHHHHHHHHHHH-HHCCCCEEE---EEHHHHHCCCCCC
Q ss_conf             246653458999999999877520445657874068861432003889999987-304773377---2068861246530
Q gi|254780163|r  475 LGTVVYGQEEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLA-FALGVQLLR---FDMSEYMERHAVS  550 (798)
Q Consensus       475 l~~~v~GQ~~ai~~v~~~i~~~~~gl~~~~rP~g~flf~GptGvGKTelak~la-~~~~~~lir---~dmsey~e~~~vs  550 (798)
                      --.++|||++++..+.+++...|.        --.|||.||.|||||-+|..+| +-+..+--.   -..++-.-.+.+.
T Consensus        21 ~~~~liGq~~~~~~L~~a~~~gRl--------~HA~Lf~GP~GiGKaTlA~~~A~~Ll~~~~~~~~~~~~~~pd~~~~~~   92 (352)
T PRK09112         21 ENNRLFGHEEARAFLAQAYREGRL--------HHALLFEGPEGIGKATLAFHLANHILSHPDPNEAPETLADPDPASPLW   92 (352)
T ss_pred             CHHHHCCHHHHHHHHHHHHHCCCC--------CCEEEEECCCCCCHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCHHH
T ss_conf             464627869999999999984996--------524653589980899999999999866998666865567888787789


Q ss_pred             HHC--CCCCHHC----CCCCC-CC------------CCHHHHHCC----CEEEEECCHHHCCHHHHHHHHHHHHHHHCCC
Q ss_conf             110--4780002----56444-31------------003555158----5177740445502899999999877750217
Q gi|254780163|r  551 RLI--GAPPGYV----GFGQG-GI------------LADSVDQNP----YSVVLLDEIEKSHPDVLNILLQIMDYGILTD  607 (798)
Q Consensus       551 ~Li--GappGYv----G~~eg-g~------------Lte~vr~~P----~sVvl~DEiEKAh~~v~~~llqild~G~ltd  607 (798)
                      |.|  |+.|+.+    .+++. +.            |.+.+...|    |-|+++||.|+-+.+-+|.||.+|+|=    
T Consensus        93 r~i~~g~hpdl~~i~r~~d~k~~~~~~~I~vd~iR~l~~~~~~~~~~~~~kv~Iid~ad~m~~~aaNALLK~LEEP----  168 (352)
T PRK09112         93 RQIAQGAHPNLLHLTRPFDEKTGKFKTAITVDEIRRVTHFLSQTSGDGNWRIVIIDPADDMNRNAANAILKTLEEP----  168 (352)
T ss_pred             HHHHCCCCCCEEEEECCCCHHHHHHHCCCCHHHHHHHHHHHCCCCCCCCEEEEEECCHHHHHHHHHHHHHHHHHCC----
T ss_conf             9997489999565534322021454335777999999998454886688069998187874699999999985348----


Q ss_pred             CCCCEECCCCEEEEEECCCCHHHHHHCCCCCCCCCCHHHHHHHHHHHCCHHHHCCCCEEEECCCCCHHHHHHHHHH
Q ss_conf             7997761254299994242145533036898821114889999987288788177682896288999999999999
Q gi|254780163|r  608 QSGKKISFRNVILIMTTNAGALEMSKARIGFGSSRNDDADKEALRNFLSPEFLNRLDSIIPFFPLSSDIIRQVVHK  683 (798)
Q Consensus       608 ~~Gr~vdf~n~iii~TsN~G~~~~~~~~~g~~~~~~~~~~~~~l~~~f~peflnRid~ii~F~~l~~~~~~~i~~~  683 (798)
                             =.||++|+.||--.                 .+.        |-...|. ..+.|+||+.+++.+.+..
T Consensus       169 -------p~~~~fiLit~~~~-----------------~ll--------~TI~SRC-q~~~f~pL~~~di~~~L~~  211 (352)
T PRK09112        169 -------PARALFILISHSSG-----------------RLL--------PTIRSRC-QPISLKPLDDDELKKALSH  211 (352)
T ss_pred             -------CCCEEEEEEECCHH-----------------HCH--------HHHHHHC-CCCCCCCCCHHHHHHHHHH
T ss_conf             -------98748998869977-----------------776--------8999743-3214889398999999998


No 89 
>COG1223 Predicted ATPase (AAA+ superfamily) [General function prediction only]
Probab=99.23  E-value=4.9e-10  Score=91.26  Aligned_cols=203  Identities=28%  Similarity=0.411  Sum_probs=131.9

Q ss_pred             HHHHHHCHHHHHHHHHHHHHHHHCCCCCCCC-----CCCEEEEECCCCHHHHHHHHHHHHHCCCCEEEEEHHHHHCCCCC
Q ss_conf             2466534589999999998775204456578-----74068861432003889999987304773377206886124653
Q gi|254780163|r  475 LGTVVYGQEEAIKKLSSSIKIARAGLSDPNK-----PIGCYVFSGPTGVGKTEISKQLAFALGVQLLRFDMSEYMERHAV  549 (798)
Q Consensus       475 l~~~v~GQ~~ai~~v~~~i~~~~~gl~~~~r-----P~g~flf~GptGvGKTelak~la~~~~~~lir~dmsey~e~~~v  549 (798)
                      --.-||||++|-.+-.-.+.-    |.+|.+     |- ..||-||+|+|||.+||+||-....+++-+.-.        
T Consensus       119 t~ddViGqEeAK~kcrli~~y----LenPe~Fg~WAPk-nVLFyGppGTGKTm~Akalane~kvp~l~vkat--------  185 (368)
T COG1223         119 TLDDVIGQEEAKRKCRLIMEY----LENPERFGDWAPK-NVLFYGPPGTGKTMMAKALANEAKVPLLLVKAT--------  185 (368)
T ss_pred             CHHHHHCHHHHHHHHHHHHHH----HHCHHHHCCCCCC-EEEEECCCCCCHHHHHHHHHCCCCCCEEEECHH--------
T ss_conf             176641639888887999999----6496876345754-168778999648799998725457854871168--------


Q ss_pred             CHHCCCCCHHCCCCC--CCCCCHHHHHCCCEEEEECCHHHCC------------HHHHHHHHHHHHHHHCCCCCCCEECC
Q ss_conf             011047800025644--4310035551585177740445502------------89999999987775021779977612
Q gi|254780163|r  550 SRLIGAPPGYVGFGQ--GGILADSVDQNPYSVVLLDEIEKSH------------PDVLNILLQIMDYGILTDQSGKKISF  615 (798)
Q Consensus       550 s~LiGappGYvG~~e--gg~Lte~vr~~P~sVvl~DEiEKAh------------~~v~~~llqild~G~ltd~~Gr~vdf  615 (798)
                       .|||-   |||-+.  =.+|-+.-++..-|||++||++--.            .+|.|.||.=|| |. ..+.|     
T Consensus       186 -~liGe---hVGdgar~Ihely~rA~~~aPcivFiDE~DAiaLdRryQelRGDVsEiVNALLTelD-gi-~eneG-----  254 (368)
T COG1223         186 -ELIGE---HVGDGARRIHELYERARKAAPCIVFIDELDAIALDRRYQELRGDVSEIVNALLTELD-GI-KENEG-----  254 (368)
T ss_pred             -HHHHH---HHHHHHHHHHHHHHHHHHCCCEEEEEHHHHHHHHHHHHHHHCCCHHHHHHHHHHHCC-CC-CCCCC-----
T ss_conf             -88887---743598999999998875198499840024555304578864549999999998501-74-45775-----


Q ss_pred             CCEEEEEECCCCHHHHHHCCCCCCCCCCHHHHHHHHHHHCCHHHHCCCCEEEECCCCCHHHHHHHHHHHHHHHHHHHHHC
Q ss_conf             54299994242145533036898821114889999987288788177682896288999999999999999999999866
Q gi|254780163|r  616 RNVILIMTTNAGALEMSKARIGFGSSRNDDADKEALRNFLSPEFLNRLDSIIPFFPLSSDIIRQVVHKFIMKLELQLQEK  695 (798)
Q Consensus       616 ~n~iii~TsN~G~~~~~~~~~g~~~~~~~~~~~~~l~~~f~peflnRid~ii~F~~l~~~~~~~i~~~~l~~l~~~l~~~  695 (798)
                        .+.|..+|                 .-+....+++        +|+.+=|-|.--+.++...|++..+..+       
T Consensus       255 --VvtIaaTN-----------------~p~~LD~aiR--------sRFEeEIEF~LP~~eEr~~ile~y~k~~-------  300 (368)
T COG1223         255 --VVTIAATN-----------------RPELLDPAIR--------SRFEEEIEFKLPNDEERLEILEYYAKKF-------  300 (368)
T ss_pred             --EEEEEECC-----------------CHHHCCHHHH--------HHHHHEEEEECCCHHHHHHHHHHHHHHC-------
T ss_conf             --69995059-----------------8465078888--------6556506564888589999999989858-------


Q ss_pred             CCEEEECHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHHHHHHHHHCCC
Q ss_conf             988999889999999718981015326799999862359999996296
Q gi|254780163|r  696 GISFHFSEEVINWLVSHGYDVKMGARPLERIIKEHVKVPLADEILFGK  743 (798)
Q Consensus       696 ~i~l~~~~~~~~~l~~~~~~~~~GAR~l~r~i~~~i~~~la~~il~~~  743 (798)
                      -+.+...   .++++++.  ..+..|.   +.++.++..|-++|..|+
T Consensus       301 Plpv~~~---~~~~~~~t--~g~SgRd---ikekvlK~aLh~Ai~ed~  340 (368)
T COG1223         301 PLPVDAD---LRYLAAKT--KGMSGRD---IKEKVLKTALHRAIAEDR  340 (368)
T ss_pred             CCCCCCC---HHHHHHHH--CCCCCHH---HHHHHHHHHHHHHHHHCH
T ss_conf             9765568---99999984--7877206---899999999999987134


No 90 
>COG2256 MGS1 ATPase related to the helicase subunit of the Holliday junction resolvase [DNA replication, recombination, and repair]
Probab=99.23  E-value=1e-10  Score=96.15  Aligned_cols=188  Identities=22%  Similarity=0.341  Sum_probs=121.0

Q ss_pred             HHHHCHHHHHHHHHHHHHHHHCCCCCCCCCCCEEEEECCCCHHHHHHHHHHHHHCCCCEEEEEHHHHHCCCCCCHHCCCC
Q ss_conf             66534589999999998775204456578740688614320038899999873047733772068861246530110478
Q gi|254780163|r  477 TVVYGQEEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFALGVQLLRFDMSEYMERHAVSRLIGAP  556 (798)
Q Consensus       477 ~~v~GQ~~ai~~v~~~i~~~~~gl~~~~rP~g~flf~GptGvGKTelak~la~~~~~~lir~dmsey~e~~~vs~LiGap  556 (798)
                      ..|+||++-+.. -..++|+-   .  ..-+.|+.|-||+|||||-+|+.+|-....+|..|+--    .++|..+-   
T Consensus        24 de~vGQ~HLlg~-~~~lrr~v---~--~~~l~SmIl~GPPG~GKTTlA~liA~~~~~~f~~~sAv----~~gvkdlr---   90 (436)
T COG2256          24 DEVVGQEHLLGE-GKPLRRAV---E--AGHLHSMILWGPPGTGKTTLARLIAGTTNAAFEALSAV----TSGVKDLR---   90 (436)
T ss_pred             HHHCCHHHHHCC-CCHHHHHH---H--CCCCCEEEEECCCCCCHHHHHHHHHHHHCCCEEEECCC----CCCHHHHH---
T ss_conf             785571866189-94389999---6--49986057778999888899999987617766995152----34679999---


Q ss_pred             CHHCCCCCCCCCCHHHHHCC----CEEEEECCHHHCCHHHHHHHHHHHHHHHCCCCCCCEECCCCEEEEEECCCCHHHHH
Q ss_conf             00025644431003555158----51777404455028999999998777502177997761254299994242145533
Q gi|254780163|r  557 PGYVGFGQGGILADSVDQNP----YSVVLLDEIEKSHPDVLNILLQIMDYGILTDQSGKKISFRNVILIMTTNAGALEMS  632 (798)
Q Consensus       557 pGYvG~~egg~Lte~vr~~P----~sVvl~DEiEKAh~~v~~~llqild~G~ltd~~Gr~vdf~n~iii~TsN~G~~~~~  632 (798)
                                ...|.-++.-    -.|+++|||..=...=++.||-.+++|+++            +|=-|+        
T Consensus        91 ----------~i~e~a~~~~~~gr~tiLflDEIHRfnK~QQD~lLp~vE~G~ii------------lIGATT--------  140 (436)
T COG2256          91 ----------EIIEEARKNRLLGRRTILFLDEIHRFNKAQQDALLPHVENGTII------------LIGATT--------  140 (436)
T ss_pred             ----------HHHHHHHHHHHCCCCEEEEEEHHHHCCHHHHHHHHHHHCCCEEE------------EEECCC--------
T ss_conf             ----------99999999872588349987225333744565510332488689------------996267--------


Q ss_pred             HCCCCCCCCCCHHHHHHHHHHHCCHHHHCCCCEEEECCCCCHHHHHHHHHHHHHHHHHHHHHCCCEEEECHHHHHHHHHC
Q ss_conf             03689882111488999998728878817768289628899999999999999999999986698899988999999971
Q gi|254780163|r  633 KARIGFGSSRNDDADKEALRNFLSPEFLNRLDSIIPFFPLSSDIIRQVVHKFIMKLELQLQEKGISFHFSEEVINWLVSH  712 (798)
Q Consensus       633 ~~~~g~~~~~~~~~~~~~l~~~f~peflnRid~ii~F~~l~~~~~~~i~~~~l~~l~~~l~~~~i~l~~~~~~~~~l~~~  712 (798)
                              +.+.=.+        .|.++.|. .|+.|.||+.+++.+++.+-+....+.+.  +..+.++++++++|+..
T Consensus       141 --------ENPsF~l--------n~ALlSR~-~vf~lk~L~~~di~~~l~ra~~~~~rgl~--~~~~~i~~~a~~~l~~~  201 (436)
T COG2256         141 --------ENPSFEL--------NPALLSRA-RVFELKPLSSEDIKKLLKRALLDEERGLG--GQIIVLDEEALDYLVRL  201 (436)
T ss_pred             --------CCCCEEE--------CHHHHHHH-HEEEEECCCHHHHHHHHHHHHHHHHCCCC--CCCCCCCHHHHHHHHHH
T ss_conf             --------8987140--------38886110-41565169989999999999865413777--65566888999999986


Q ss_pred             CCCCCCCCHHHHHHHHH
Q ss_conf             89810153267999998
Q gi|254780163|r  713 GYDVKMGARPLERIIKE  729 (798)
Q Consensus       713 ~~~~~~GAR~l~r~i~~  729 (798)
                      .--   -||..-..++-
T Consensus       202 s~G---D~R~aLN~LE~  215 (436)
T COG2256         202 SNG---DARRALNLLEL  215 (436)
T ss_pred             CCC---HHHHHHHHHHH
T ss_conf             286---19999889999


No 91 
>PRK08451 DNA polymerase III subunits gamma and tau; Validated
Probab=99.23  E-value=2.3e-10  Score=93.61  Aligned_cols=215  Identities=23%  Similarity=0.301  Sum_probs=144.7

Q ss_pred             HHHHHHCCCCHHHHHHHHHHHHHHHHHHCCCCCCE-EEECCCCCHHHHHHHHHHHHHHCCCCCHH------------HHE
Q ss_conf             58877548611222178999999998622677874-89667641166899999999854898834------------520
Q gi|254780163|r  194 LTEKVKKGKVDILVGRHEEINRTIQILCRRSKNNP-LYVGDPGVGKTAIAEGFAKQIVDGMVPDI------------LLG  260 (798)
Q Consensus       194 LTe~AreGKLDPVIGRd~EI~riiqIL~RR~KNn~-~lvG~~gvGktaive~la~~i~~~~vp~~------------l~~  260 (798)
                      |..+-|=-.+|-|||-+.-++.+...+...+=.+. ++.|++|||||+++..+|..+.-.+-|..            ..+
T Consensus         4 LarKYRP~~F~evIGQe~iv~~L~nAi~~~Rl~HAYLFsGPrGvGKTt~ArifAkaLnC~~~~~~~PCg~C~sC~~i~~g   83 (523)
T PRK08451          4 LALKYRPKHFDELIGQESVSKTLSLALDNNRLAHAYLFSGLRGSGKTSSARIFSRALVCEQGPSSTPCGTCAQCQAALEG   83 (523)
T ss_pred             HHHHHCCCCHHHCCCCHHHHHHHHHHHHCCCCCCEEEEECCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCCHHHHHHHCC
T ss_conf             44420899654404949999999999985996715875789986889999999999759999998988878889998648


Q ss_pred             --EEEEEEEHHHHHCCCCCCCHHHHHHHHHHHHHCC----CCCEEEEECCHHHHHCCCCCCCCCCCHHHHHHHHHC--CC
Q ss_conf             --1445540467530634312378999999987203----898399973616630155444344777888876630--26
Q gi|254780163|r  261 --ARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIES----YANAILYIDEIHTLVGAGSASGISVDASNLLKPALS--SG  332 (798)
Q Consensus       261 --~~i~~ld~~~l~ag~~~rg~fe~r~~~~~~~~~~----~~~~ilfideih~ligag~~~g~~~d~an~lkP~L~--rg  332 (798)
                        .-++++|      +++-||  =+.++.+++.+.-    .+--|..|||.|+|         +..|+|-|.-.|.  -.
T Consensus        84 ~hpDViEiD------aasn~g--ID~IReLie~~~~~P~~gryKV~IIDEah~L---------t~~A~NALLKTLEEPP~  146 (523)
T PRK08451         84 RHIDIIEMD------AASNRG--IDDIRNLIEQTKYKPSMARFKIFIIDEVHML---------TKEAFNALLKTLEEPPS  146 (523)
T ss_pred             CCCCEEEEC------CCCCCC--HHHHHHHHHHHCCCCCCCCEEEEEEECCCCC---------CHHHHHHHHHHCCCCCC
T ss_conf             999855105------533368--9999999997235886797279998260304---------89999999997038987


Q ss_pred             CEEEEEECCHHHHHHHHHCCHHHHHHCEEEEECCCCHHHHHHHHHHHHHHHHHHCCCEECCHHHHHHHHHHHHHCCCCCC
Q ss_conf             60388730489999985201114320014430687868999999861276654103512111789999986542015556
Q gi|254780163|r  333 AVRCIGSTTYSEYRQFFEKDKALVRRFQKIDVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKL  412 (798)
Q Consensus       333 ~~~~IgatT~~ey~~~~e~d~al~rrF~~i~v~ep~~~~~~~iL~~~~~~ye~~h~v~~~~~al~~av~ls~ryi~~r~l  412 (798)
                      ...+|-+||..  +|..   +..-.|-|.......+.++-+.-|+.+...    -++.|.++||...++.|.-=+.|   
T Consensus       147 ~vvFILaTTep--~KLp---~TIlSRCQ~f~Fk~I~~~~I~~~L~~I~~~----E~i~~e~~AL~~IA~~a~GslRD---  214 (523)
T PRK08451        147 YVKFILATTDP--LKLP---ATILSRTQHFRFKQIPQNSIISHLKTILNK----EGVSYEPEALEILARSGSGSLRD---  214 (523)
T ss_pred             CCEEEEECCCH--HHCH---HHHHHHHHCCCCCCCCHHHHHHHHHHHHHH----CCCCCCHHHHHHHHHHCCCCHHH---
T ss_conf             83799975994--7684---888742031103379999999999999998----39987999999999977894868---


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHH
Q ss_conf             467988998653333211443221136578999866
Q gi|254780163|r  413 PDKAIDVIDEAGASQILQPLSKRRKFITEKDIKKTI  448 (798)
Q Consensus       413 PdkAidllDea~a~~~~~~~~~~~~~~~~~~i~~~~  448 (798)
                         |..+||.|-+..        ...++.++|.+++
T Consensus       215 ---alslLdQ~i~~~--------~~~i~~~~v~~~l  239 (523)
T PRK08451        215 ---TLTLLDQAIIFC--------KNAITESKVADML  239 (523)
T ss_pred             ---HHHHHHHHHHHC--------CCCCCHHHHHHHH
T ss_conf             ---987999999847--------9987799999985


No 92 
>TIGR02902 spore_lonB ATP-dependent protease LonB; InterPro: IPR014251   This entry represents LonB, a paralog of the ATP-dependent protease La (LonA, IPR004815 from INTERPRO). LonB proteins are unassigned peptidases belonging to the MEROPS peptidase family S16 (lon protease family, clan SJ) and are found strictly, and almost universally, in endospore-forming bacteria. This protease was shown, in Bacillus subtilis, to be expressed specifically in the forespore during sporulation, under control of sigmaF . The lonB gene, despite being located immediately upstream of lonA, was shown to be monocistronic. LonB appears to be involved in the post-translation control of sigmaH, but lonB mutation did not produce an obvious sporulation defect under the conditions tested . Note that additional paralogs of LonA and LonB occur in the Clostridium lineage and these are excluded from this entry. .
Probab=99.22  E-value=1.7e-10  Score=94.63  Aligned_cols=205  Identities=26%  Similarity=0.484  Sum_probs=132.1

Q ss_pred             HHHHCHHHHHHHHHHHHHHHHCCCCCCCCCCCEEEEECCCCHHHHHHHHHH---H-------HHCCCCEEEEEHH--HHH
Q ss_conf             665345899999999987752044565787406886143200388999998---7-------3047733772068--861
Q gi|254780163|r  477 TVVYGQEEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQL---A-------FALGVQLLRFDMS--EYM  544 (798)
Q Consensus       477 ~~v~GQ~~ai~~v~~~i~~~~~gl~~~~rP~g~flf~GptGvGKTelak~l---a-------~~~~~~lir~dms--ey~  544 (798)
                      ..||||++-|++       .||.|.-|| |-=+.++ ||+|||||=-|+..   |       |..+-.||-+|-.  =|=
T Consensus        65 ~EIiGQe~GI~A-------LKAALCGPN-PQHVIiY-GPPGVGKTAAARLVLeeAKk~~~SPFke~A~FVEiDATT~RFD  135 (532)
T TIGR02902        65 DEIIGQEEGIKA-------LKAALCGPN-PQHVIIY-GPPGVGKTAAARLVLEEAKKNPASPFKEEAAFVEIDATTARFD  135 (532)
T ss_pred             CCCCCCHHHHHH-------HHHHCCCCC-CCEEEEE-CCCCCCHHHHHHHHHHHHHCCCCCCCCCCCEEEEEECCCCCCC
T ss_conf             325673556899-------998606868-9638987-8869617899999999865087537898866898505103602


Q ss_pred             CCCCCCHHCCC--CCHHCCCCCCCC------CCHHHHHCCCEEEEECCHHHCCHHHHHHHHHHHHHHHCCCCCCCEECCC
Q ss_conf             24653011047--800025644431------0035551585177740445502899999999877750217799776125
Q gi|254780163|r  545 ERHAVSRLIGA--PPGYVGFGQGGI------LADSVDQNPYSVVLLDEIEKSHPDVLNILLQIMDYGILTDQSGKKISFR  616 (798)
Q Consensus       545 e~~~vs~LiGa--ppGYvG~~egg~------Lte~vr~~P~sVvl~DEiEKAh~~v~~~llqild~G~ltd~~Gr~vdf~  616 (798)
                      |+.=..=||||  -|=|=|-+.=|+      =.=||-|--=.|+++|||==-||=-+|=||.||+|        |+|=|-
T Consensus       136 ERGIADPLIGSVHDPIYQGAGplG~AGIPQPK~GAVT~AHGGvLFIDEIGELHP~~MNKLLKVLED--------RKVFLd  207 (532)
T TIGR02902       136 ERGIADPLIGSVHDPIYQGAGPLGVAGIPQPKPGAVTKAHGGVLFIDEIGELHPVQMNKLLKVLED--------RKVFLD  207 (532)
T ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCEEEECCCCCCCHHHHHHHHHHHHC--------CCCHHH
T ss_conf             146666567761585333765457885575877763202586551212466582435314113302--------220000


Q ss_pred             CEEEEEECCCCHHHHHHCCCCCCCCCCHHHHHHHHHH-----------------HCCHHHHCCCCEEEECCCCCHHHHHH
Q ss_conf             4299994242145533036898821114889999987-----------------28878817768289628899999999
Q gi|254780163|r  617 NVILIMTTNAGALEMSKARIGFGSSRNDDADKEALRN-----------------FLSPEFLNRLDSIIPFFPLSSDIIRQ  679 (798)
Q Consensus       617 n~iii~TsN~G~~~~~~~~~g~~~~~~~~~~~~~l~~-----------------~f~peflnRid~ii~F~~l~~~~~~~  679 (798)
                      .+..- .||               ...-+..++.-.+                 -.+|.+..|+=+|+ |++|..++++.
T Consensus       208 SAYY~-s~~---------------pniP~hI~dIFqnGlPADFRLiGATTR~PeEIpPAlRSRC~EIF-FR~L~~EEi~~  270 (532)
T TIGR02902       208 SAYYS-SED---------------PNIPSHIRDIFQNGLPADFRLIGATTRNPEEIPPALRSRCVEIF-FRPLLKEEIKE  270 (532)
T ss_pred             CCCCC-CCC---------------CCCCHHHHHHHCCCCCCCEECCCCCCCCCCCCCHHHHCCCEEEE-ECCCCHHHHHH
T ss_conf             12358-777---------------86542789972067873401213336987767834650522677-16888789999


Q ss_pred             HHHHHHHHHHHHHHHCCCEEEECHHHHHHHHHCCCCCCCCCHHHHHHHH
Q ss_conf             9999999999999866988999889999999718981015326799999
Q gi|254780163|r  680 VVHKFIMKLELQLQEKGISFHFSEEVINWLVSHGYDVKMGARPLERIIK  728 (798)
Q Consensus       680 i~~~~l~~l~~~l~~~~i~l~~~~~~~~~l~~~~~~~~~GAR~l~r~i~  728 (798)
                      |+++-.         .+|.+.+++++++.|.....+   | |..=..||
T Consensus       271 iAk~Aa---------eKIg~~l~~~Al~~I~~Ya~n---G-REAvN~~Q  306 (532)
T TIGR02902       271 IAKNAA---------EKIGLNLEKEALDLIAKYASN---G-REAVNLVQ  306 (532)
T ss_pred             HHHHHH---------HHCCCCCCHHHHHHHHHHHCC---C-CHHHHHHH
T ss_conf             987656---------530465475479999987405---4-06778999


No 93 
>PRK05563 DNA polymerase III subunits gamma and tau; Validated
Probab=99.22  E-value=2.8e-10  Score=93.04  Aligned_cols=199  Identities=20%  Similarity=0.269  Sum_probs=140.8

Q ss_pred             HHHHCCCCHHHHHHHHHHHHHHHHHHCCCCCCE-EEECCCCCHHHHHHHHHHHHHHCCCCCHH------------HHE--
Q ss_conf             877548611222178999999998622677874-89667641166899999999854898834------------520--
Q gi|254780163|r  196 EKVKKGKVDILVGRHEEINRTIQILCRRSKNNP-LYVGDPGVGKTAIAEGFAKQIVDGMVPDI------------LLG--  260 (798)
Q Consensus       196 e~AreGKLDPVIGRd~EI~riiqIL~RR~KNn~-~lvG~~gvGktaive~la~~i~~~~vp~~------------l~~--  260 (798)
                      .+-|--.++-|||-+.-++.+...+...+-.+. ++-|++|||||+.+.-||.-+.--+-|..            -.|  
T Consensus         8 rkyRP~~f~dvvgQ~~v~~~L~n~i~~~~i~hayLf~GprG~GKTs~Ari~akalnc~~~~~~~pC~~C~~C~~i~~g~~   87 (541)
T PRK05563          8 REWRPRTFEDVVGQEHITTTLKNQIINNRIAHAYLFCGTRGTGKTSTAKIFAKAVNCLNPQDGEPCNECEICKKINEGLL   87 (541)
T ss_pred             HHHCCCCHHHHCCCHHHHHHHHHHHHCCCCCEEEEEECCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCCHHHHHHHCCCC
T ss_conf             76489977662484999999999998499320453038799589999999999957999888985751488999856898


Q ss_pred             EEEEEEEHHHHHCCCCCCCHHHHHHHHHHHHHCC---CCC-EEEEECCHHHHHCCCCCCCCCCCHHHHHHHHHCC--CCE
Q ss_conf             1445540467530634312378999999987203---898-3999736166301554443447778888766302--660
Q gi|254780163|r  261 ARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIES---YAN-AILYIDEIHTLVGAGSASGISVDASNLLKPALSS--GAV  334 (798)
Q Consensus       261 ~~i~~ld~~~l~ag~~~rg~fe~r~~~~~~~~~~---~~~-~ilfideih~ligag~~~g~~~d~an~lkP~L~r--g~~  334 (798)
                      .-++++|.      ++-||-  +-++.+.+.+.-   .++ -|.-|||.|+|         +.+|.|-|.-.|..  ...
T Consensus        88 ~Dv~Eida------as~~gv--d~iR~~~~~~~~~p~~~~~Kv~IiDEvhml---------s~~a~nallKtlEePp~~~  150 (541)
T PRK05563         88 MDVIEIDA------ASNNGV--DDIREIIENVKYPPQEGKYKVYIMDEVHML---------SQGAVNAFLKTLEEPPSNV  150 (541)
T ss_pred             CCEEEECC------CCCCCH--HHHHHHHHHCEECCCCCCEEEEEEECCCCC---------CHHHHHHHHHHHHCCCCCC
T ss_conf             87366244------444788--999999976104876787059999772338---------9999999999985487775


Q ss_pred             EEEEECCHHHHHHHHHCCHHHHHHCEEEEECCCCHHHHHHHHHHHHHHHHHHCCCEECCHHHHHHHHHHHHHCCCCCCHH
Q ss_conf             38873048999998520111432001443068786899999986127665410351211178999998654201555646
Q gi|254780163|r  335 RCIGSTTYSEYRQFFEKDKALVRRFQKIDVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLPD  414 (798)
Q Consensus       335 ~~IgatT~~ey~~~~e~d~al~rrF~~i~v~ep~~~~~~~iL~~~~~~ye~~h~v~~~~~al~~av~ls~ryi~~r~lPd  414 (798)
                      .+|-|||.  ++|..   +.+-.|-|+......+.++-..-|+.+...    -++.|+++||...++.|.-=+.|     
T Consensus       151 ~Filatte--~~ki~---~tI~SRcq~f~f~~i~~~~i~~~L~~I~~~----E~i~~~~~al~lIa~~s~GsmRD-----  216 (541)
T PRK05563        151 IFILATTD--PQKLP---ITILSRCQRFDFKRIKVKDIFKRLRKIVEE----QGIFADDKSLNLIARMSDGAMRD-----  216 (541)
T ss_pred             EEEEECCC--CCCCC---HHHHHHEEEEEEEECCHHHHHHHHHHHHHH----CCCCCCHHHHHHHHHHCCCCHHH-----
T ss_conf             69997698--44274---556742135775438999999999999998----49998789999999745997788-----


Q ss_pred             HHHHHHHHHHHH
Q ss_conf             798899865333
Q gi|254780163|r  415 KAIDVIDEAGAS  426 (798)
Q Consensus       415 kAidllDea~a~  426 (798)
                       |+.+||.+-|.
T Consensus       217 -AlslLdQ~is~  227 (541)
T PRK05563        217 -ALSILDQAISM  227 (541)
T ss_pred             -HHHHHHHHHHH
T ss_conf             -99999999983


No 94 
>PRK12402 replication factor C small subunit 2; Reviewed
Probab=99.20  E-value=1.1e-09  Score=88.66  Aligned_cols=189  Identities=23%  Similarity=0.325  Sum_probs=119.4

Q ss_pred             HHHHCHHHHHHHHHHHHHHHHCCCCCCCCCCCEEEEECCCCHHHHHHHHHHHHHC-----CCCEEEEEHHHHHCCCCC--
Q ss_conf             6653458999999999877520445657874068861432003889999987304-----773377206886124653--
Q gi|254780163|r  477 TVVYGQEEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFAL-----GVQLLRFDMSEYMERHAV--  549 (798)
Q Consensus       477 ~~v~GQ~~ai~~v~~~i~~~~~gl~~~~rP~g~flf~GptGvGKTelak~la~~~-----~~~lir~dmsey~e~~~v--  549 (798)
                      ..|+||+++++.+...+..       .+-|  .+||.||+|+|||-+|+++|..+     +.+...++.|++.+....  
T Consensus        15 ~dvvGq~~i~~~L~~~~~~-------~~~p--hlLf~GPpG~GKTt~A~~lA~~l~~~~~~~~~~~~nasd~~~~~~~~i   85 (337)
T PRK12402         15 EDILGQESVVDHLSALAAS-------GNLP--HLVVYGPSGSGKTAAVRALARELYGDPWENNFTYFNVSDFFDQGKKYL   85 (337)
T ss_pred             HHHCCCHHHHHHHHHHHHC-------CCCC--EEEEECCCCCCHHHHHHHHHHHHCCCCCCCCCCEECCCCCCCCCCCEE
T ss_conf             9803979999999999977-------9987--698889298489999999999967997567833311653113564001


Q ss_pred             ------CHHCCCCCHHCCCCCCCCCCHHH----HH----CCCEEEEECCHHHCCHHHHHHHHHHHHHHHCCCCCCCEECC
Q ss_conf             ------01104780002564443100355----51----58517774044550289999999987775021779977612
Q gi|254780163|r  550 ------SRLIGAPPGYVGFGQGGILADSV----DQ----NPYSVVLLDEIEKSHPDVLNILLQIMDYGILTDQSGKKISF  615 (798)
Q Consensus       550 ------s~LiGappGYvG~~egg~Lte~v----r~----~P~sVvl~DEiEKAh~~v~~~llqild~G~ltd~~Gr~vdf  615 (798)
                            ...++.|. -.|-..-..+.+.+    ..    .+|-|+++||.+.-.++-+|.|+.++++-           =
T Consensus        86 ~~~~~~~~~~~~~~-~~~~~~~d~i~~ii~~~a~~~p~~~~~KiiIlDEad~lt~~Aq~aLlk~lEe~-----------~  153 (337)
T PRK12402         86 VEDPRFAHFYDDPK-RKYKSVIDNFKHILKEYASMRPLSADYKLILFDNAEALREDAQQALRRIMERY-----------S  153 (337)
T ss_pred             ECCCCHHHHHCCHH-HCCCCHHHHHHHHHHHHHCCCCCCCCEEEEEEECCCCCCHHHHHHHHHHHHCC-----------C
T ss_conf             01664234420153-32773789999999998614887788049997071317999999999887408-----------8


Q ss_pred             CCEEEEEECCCCHHHHHHCCCCCCCCCCHHHHHHHHHHHCCHHHHCCCCEEEECCCCCHHHHHHHHHHHHHHHHHHHHHC
Q ss_conf             54299994242145533036898821114889999987288788177682896288999999999999999999999866
Q gi|254780163|r  616 RNVILIMTTNAGALEMSKARIGFGSSRNDDADKEALRNFLSPEFLNRLDSIIPFFPLSSDIIRQVVHKFIMKLELQLQEK  695 (798)
Q Consensus       616 ~n~iii~TsN~G~~~~~~~~~g~~~~~~~~~~~~~l~~~f~peflnRid~ii~F~~l~~~~~~~i~~~~l~~l~~~l~~~  695 (798)
                      .+|.+|+++|--+.                         ..|...+|. ..+.|+|++.+++...+..    +   ....
T Consensus       154 ~~~~fIl~t~~~~~-------------------------ii~tI~SRC-~~i~F~~~s~~~i~~~L~~----I---~~~E  200 (337)
T PRK12402        154 ETCRFIFSTTQPSK-------------------------LIPPIRSRC-LPLFFRPVPDDEIRSVLES----I---AAAE  200 (337)
T ss_pred             CCEEEEEECCCCCC-------------------------CCHHHHHHC-EEEECCCCCHHHHHHHHHH----H---HHHC
T ss_conf             76699872386444-------------------------752477624-4543589899999999999----9---9984


Q ss_pred             CCEEEECHHHHHHHHHCCCCCCCCCHHHHHHH
Q ss_conf             98899988999999971898101532679999
Q gi|254780163|r  696 GISFHFSEEVINWLVSHGYDVKMGARPLERII  727 (798)
Q Consensus       696 ~i~l~~~~~~~~~l~~~~~~~~~GAR~l~r~i  727 (798)
                      |  +.+++++++.|++.+.      ..+|+.|
T Consensus       201 ~--i~~~~~~l~~ia~~s~------GdlR~ai  224 (337)
T PRK12402        201 G--VEISDDGLDLIAYYAE------GDLRKAI  224 (337)
T ss_pred             C--CCCCHHHHHHHHHHCC------CCHHHHH
T ss_conf             9--9989999999999869------9899999


No 95 
>KOG0738 consensus
Probab=99.20  E-value=3.4e-10  Score=92.46  Aligned_cols=222  Identities=25%  Similarity=0.389  Sum_probs=140.3

Q ss_pred             HCCCCHHHHHHHHHHHHHHH--HH----------HCCCCCCEEEECCCCCHHHHHHHHHHHHHHCCCCCHHHHEEEEEEE
Q ss_conf             54861122217899999999--86----------2267787489667641166899999999854898834520144554
Q gi|254780163|r  199 KKGKVDILVGRHEEINRTIQ--IL----------CRRSKNNPLYVGDPGVGKTAIAEGFAKQIVDGMVPDILLGARIFSL  266 (798)
Q Consensus       199 reGKLDPVIGRd~EI~riiq--IL----------~RR~KNn~~lvG~~gvGktaive~la~~i~~~~vp~~l~~~~i~~l  266 (798)
                      -.=+.|-|.|=.+-.+-+-+  +|          .||-=..++|+|+||.|||-|+..+|--          .+..+|.+
T Consensus       207 p~ikW~DIagl~~AK~lL~EAVvlPi~mPe~F~GirrPWkgvLm~GPPGTGKTlLAKAvATE----------c~tTFFNV  276 (491)
T KOG0738         207 PNIKWDDIAGLHEAKKLLKEAVVLPIWMPEFFKGIRRPWKGVLMVGPPGTGKTLLAKAVATE----------CGTTFFNV  276 (491)
T ss_pred             CCCCHHHHCCHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCEEEEECCCCCCHHHHHHHHHHH----------HCCEEEEE
T ss_conf             98676763164999999998875444248887424465300055679997478999999886----------16727874


Q ss_pred             EHHHHHCCCCCCCHHHHHHHHHHHHHCCCCCEEEEECCHHHHHCCCCCCCCCCCHHHHHHHHH-----------CC-CCE
Q ss_conf             046753063431237899999998720389839997361663015544434477788887663-----------02-660
Q gi|254780163|r  267 DMGNLIAGTRYRGDFEERIKKIVKEIESYANAILYIDEIHTLVGAGSASGISVDASNLLKPAL-----------SS-GAV  334 (798)
Q Consensus       267 d~~~l~ag~~~rg~fe~r~~~~~~~~~~~~~~ilfideih~ligag~~~g~~~d~an~lkP~L-----------~r-g~~  334 (798)
                      +-+.|  -.|||||-|.-++-+++-++...+.++|||||.+|.+--++++ .-.|+-=+|--|           .. .-+
T Consensus       277 Ssstl--tSKwRGeSEKlvRlLFemARfyAPStIFiDEIDslcs~RG~s~-EHEaSRRvKsELLvQmDG~~~t~e~~k~V  353 (491)
T KOG0738         277 SSSTL--TSKWRGESEKLVRLLFEMARFYAPSTIFIDEIDSLCSQRGGSS-EHEASRRVKSELLVQMDGVQGTLENSKVV  353 (491)
T ss_pred             CHHHH--HHHHCCCHHHHHHHHHHHHHHHCCCEEEHHHHHHHHHCCCCCC-CHHHHHHHHHHHHHHHHCCCCCCCCCEEE
T ss_conf             02456--5553252699999999999874885353356778872579865-03678888889999863344444565169


Q ss_pred             EEEEECCHHHHHHHHHCCHHHHHHCEE-EEECCCCHHHHHHHHH---------------HHHHHHHHHCCCEECCHHHHH
Q ss_conf             388730489999985201114320014-4306878689999998---------------612766541035121117899
Q gi|254780163|r  335 RCIGSTTYSEYRQFFEKDKALVRRFQK-IDVSEPSIEDAIEIVK---------------GIKPYFEEHHQLRYSKEAIRA  398 (798)
Q Consensus       335 ~~IgatT~~ey~~~~e~d~al~rrF~~-i~v~ep~~~~~~~iL~---------------~~~~~ye~~h~v~~~~~al~~  398 (798)
                      -+.+||..-     -+-|.||-|||++ |.|.=|+.+.--.+|+               -+..+.|.|.|-.|+.-+-++
T Consensus       354 mVLAATN~P-----WdiDEAlrRRlEKRIyIPLP~~~~R~~Li~~~l~~~~~~~~~~~~~lae~~eGySGaDI~nvCreA  428 (491)
T KOG0738         354 MVLAATNFP-----WDIDEALRRRLEKRIYIPLPDAEARSALIKILLRSVELDDPVNLEDLAERSEGYSGADITNVCREA  428 (491)
T ss_pred             EEEECCCCC-----CCHHHHHHHHHHHHEEEECCCHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHCCCCHHHHHHHHHHH
T ss_conf             998436898-----205799999876303312878789999999762356688875699999985688737799999999


Q ss_pred             HHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHH
Q ss_conf             9998654201555646798899865333321144322113657899986631
Q gi|254780163|r  399 AVQLSVRHFTSRKLPDKAIDVIDEAGASQILQPLSKRRKFITEKDIKKTIAS  450 (798)
Q Consensus       399 av~ls~ryi~~r~lPdkAidllDea~a~~~~~~~~~~~~~~~~~~i~~~~~~  450 (798)
                      +..--.|||... .|+ -|-.+          +.+....-|+..|+...+.+
T Consensus       429 sm~~mRR~i~g~-~~~-ei~~l----------akE~~~~pv~~~Dfe~Al~~  468 (491)
T KOG0738         429 SMMAMRRKIAGL-TPR-EIRQL----------AKEEPKMPVTNEDFEEALRK  468 (491)
T ss_pred             HHHHHHHHHHCC-CCH-HHHHH----------HHHCCCCCCCHHHHHHHHHH
T ss_conf             999999997247-917-76443----------23143456515659999997


No 96 
>PRK00411 cdc6 cell division control protein 6; Reviewed
Probab=99.20  E-value=1.6e-09  Score=87.59  Aligned_cols=214  Identities=20%  Similarity=0.254  Sum_probs=135.1

Q ss_pred             CHHHHHHHCHHHHHHHHHHHHHHHHCCCCCCCCCCCEEEEECCCCHHHHHHHHHHHHHC-----CCCEEEEEHHHHHCCC
Q ss_conf             00246653458999999999877520445657874068861432003889999987304-----7733772068861246
Q gi|254780163|r  473 KNLGTVVYGQEEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFAL-----GVQLLRFDMSEYMERH  547 (798)
Q Consensus       473 ~~l~~~v~GQ~~ai~~v~~~i~~~~~gl~~~~rP~g~flf~GptGvGKTelak~la~~~-----~~~lir~dmsey~e~~  547 (798)
                      .....++.|-++-++.+...+.-.--    .++|- +.+..||||+|||-++|.+...+     .-..+.+||..+..++
T Consensus        26 ~yvP~~l~~Re~Ei~~l~~~l~~~l~----g~~~~-n~~I~G~pGTGKT~~vk~v~~~l~~~~~~~~~vyINc~~~~t~~  100 (394)
T PRK00411         26 DYVPENLPHREEQIEELAFALRPALR----GSRPS-NVLILGPPGTGKTTTVKKVFEELEEAALKVVYVYINCQIDRTRY  100 (394)
T ss_pred             CCCCCCCCCHHHHHHHHHHHHHHHHC----CCCCC-CEEEECCCCCCHHHHHHHHHHHHHHHCCCCEEEEEECCCCCCHH
T ss_conf             88899898859999999999999975----99998-47998899998999999999999974689659999696689899


Q ss_pred             CCC-----HHCCCCCHHCCCCCCCC---CCHHH-HHCCCEEEEECCHHHC-CHHHHHHHHHHHHHHHCCCCCCCEECCCC
Q ss_conf             530-----11047800025644431---00355-5158517774044550-28999999998777502177997761254
Q gi|254780163|r  548 AVS-----RLIGAPPGYVGFGQGGI---LADSV-DQNPYSVVLLDEIEKS-HPDVLNILLQIMDYGILTDQSGKKISFRN  617 (798)
Q Consensus       548 ~vs-----~LiGappGYvG~~egg~---Lte~v-r~~P~sVvl~DEiEKA-h~~v~~~llqild~G~ltd~~Gr~vdf~n  617 (798)
                      .+.     .|-|.++-.-|+...-.   +.+.+ .+..+.||++|||++- ..+-.++|++++.--   +    ...-..
T Consensus       101 ~i~~~i~~~L~~~~~p~~G~s~~~~~~~l~~~l~~~~~~~ivvLDEiD~L~~~~~~~vLY~L~r~~---~----~~~~~~  173 (394)
T PRK00411        101 AILSEIARSLFGHPPPSSGLSFDELFDKIAEYLDERDRVLIVALDDINYLVEKEGNDVLYSLLRAH---E----EYPGAR  173 (394)
T ss_pred             HHHHHHHHHHCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEEEEEECCCCCCCCCCCHHHHHHHHCC---C----CCCCCC
T ss_conf             999999999569989877878999999999986166975899996554020366508999998540---2----268873


Q ss_pred             EEEEEECCCCHHHHHHCCCCCCCCCCHHHHHHHHHHHCCHHHHCCCCEEEECCCCCHHHHHHHHHHHHHHHHHHHHHCCC
Q ss_conf             29999424214553303689882111488999998728878817768289628899999999999999999999986698
Q gi|254780163|r  618 VILIMTTNAGALEMSKARIGFGSSRNDDADKEALRNFLSPEFLNRLDSIIPFFPLSSDIIRQVVHKFIMKLELQLQEKGI  697 (798)
Q Consensus       618 ~iii~TsN~G~~~~~~~~~g~~~~~~~~~~~~~l~~~f~peflnRid~ii~F~~l~~~~~~~i~~~~l~~l~~~l~~~~i  697 (798)
                      +.+|+-||-         +.|     .+...+.++..|.|       ..|.|.|.+.+++..|+...++...   . .| 
T Consensus       174 ~~vI~IsN~---------~~~-----~~~Ldprv~S~l~~-------~~i~F~PY~~~qL~~IL~~R~~~af---~-~g-  227 (394)
T PRK00411        174 IGVIGISSD---------LTF-----LYILDPRVKSVFGP-------EEIVFPPYTADEIFDILKDRVEEGF---Y-PG-  227 (394)
T ss_pred             EEEEEEECC---------CCH-----HHHHHHHHHCCCCC-------EEEEECCCCHHHHHHHHHHHHHHCC---C-CC-
T ss_conf             899999768---------717-----76640777502786-------2898589998999999999998414---5-56-


Q ss_pred             EEEECHHHHHHHHHCCCCCCCCCHHHHHH
Q ss_conf             89998899999997189810153267999
Q gi|254780163|r  698 SFHFSEEVINWLVSHGYDVKMGARPLERI  726 (798)
Q Consensus       698 ~l~~~~~~~~~l~~~~~~~~~GAR~l~r~  726 (798)
                        .++++++.+++.+.-...--||---.+
T Consensus       228 --v~~~~~i~~~A~~~a~~~GDaR~Aldl  254 (394)
T PRK00411        228 --VVSDEVLELIADLTGREHGDARVAIDL  254 (394)
T ss_pred             --CCCHHHHHHHHHHHHHCCCCHHHHHHH
T ss_conf             --789789999999985504758999999


No 97 
>PRK07471 DNA polymerase III subunit delta'; Validated
Probab=99.19  E-value=3.5e-10  Score=92.34  Aligned_cols=161  Identities=23%  Similarity=0.368  Sum_probs=104.5

Q ss_pred             HHHHHCHHHHHHHHHHHHHHHHCCCCCCCCCCCEEEEECCCCHHHHHHHHHHHH-HCC----CCEEEEEH---HHHHCCC
Q ss_conf             466534589999999998775204456578740688614320038899999873-047----73377206---8861246
Q gi|254780163|r  476 GTVVYGQEEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAF-ALG----VQLLRFDM---SEYMERH  547 (798)
Q Consensus       476 ~~~v~GQ~~ai~~v~~~i~~~~~gl~~~~rP~g~flf~GptGvGKTelak~la~-~~~----~~lir~dm---sey~e~~  547 (798)
                      -..||||++++..+.+++...|        ---+|||.||.|+|||-+|..+|. -+.    ...-.-.+   -+....|
T Consensus        16 ~~~liGqe~~~~~L~~a~~~gr--------l~HA~Lf~Gp~GiGK~tlA~~~A~~ll~~~~~~~~~~~~~~~~l~~~~~~   87 (363)
T PRK07471         16 TTALFGHAAAEAALLDAYRSGR--------LHHAWLIGGPQGIGKATLAYRMARFLLATPPPGGDAVFPPPASLAVDPDH   87 (363)
T ss_pred             CCCCCCHHHHHHHHHHHHHCCC--------CCCEEEEECCCCCCHHHHHHHHHHHHHCCCCCCCCCCCCCHHHHCCCCCC
T ss_conf             2731681999999999998599--------76458767999818899999999998579997777767870531258777


Q ss_pred             CCCHHC--CCCCHHCC----CCCCC-C-----CCHHHH-------HCC----CEEEEECCHHHCCHHHHHHHHHHHHHHH
Q ss_conf             530110--47800025----64443-1-----003555-------158----5177740445502899999999877750
Q gi|254780163|r  548 AVSRLI--GAPPGYVG----FGQGG-I-----LADSVD-------QNP----YSVVLLDEIEKSHPDVLNILLQIMDYGI  604 (798)
Q Consensus       548 ~vs~Li--GappGYvG----~~egg-~-----Lte~vr-------~~P----~sVvl~DEiEKAh~~v~~~llqild~G~  604 (798)
                      .+.+.|  |+-|++..    +++.+ .     -.+.||       ..|    |-|+++|+.|+-+.+-.|.||.+|+|= 
T Consensus        88 p~~r~i~~~~hpdl~~i~r~~d~k~~~~~~~I~Vd~iR~l~~~~~~~p~~g~~kV~IId~ad~mn~~aaNALLK~LEEP-  166 (363)
T PRK07471         88 PVARRIAAGAHGGLLTLERSWNEKGKRLRTVITVDEVRETIGFFGLTAAEGGWRVVIVDTADEMNANAANALLKVLEEP-  166 (363)
T ss_pred             CHHHHHHCCCCCCEEEEECCCCCCCCCCCCCCCHHHHHHHHHHHCCCCCCCCCEEEEEECHHHHCHHHHHHHHHHHCCC-
T ss_conf             2899995269998466762001133321244539999999999724852489669998687873889999999972158-


Q ss_pred             CCCCCCCEECCCCEEEEEECCCCHHHHHHCCCCCCCCCCHHHHHHHHHHHCCHHHHCCCCEEEECCCCCHHHHHHHH
Q ss_conf             21779977612542999942421455330368988211148899999872887881776828962889999999999
Q gi|254780163|r  605 LTDQSGKKISFRNVILIMTTNAGALEMSKARIGFGSSRNDDADKEALRNFLSPEFLNRLDSIIPFFPLSSDIIRQVV  681 (798)
Q Consensus       605 ltd~~Gr~vdf~n~iii~TsN~G~~~~~~~~~g~~~~~~~~~~~~~l~~~f~peflnRid~ii~F~~l~~~~~~~i~  681 (798)
                                =.||++||.|+--..                         +.|--+.|. ..+.|+||+++++.+.+
T Consensus       167 ----------P~~t~fiLit~~~~~-------------------------llpTI~SRC-q~~~~~~l~~~~~~~~L  207 (363)
T PRK07471        167 ----------PARSLLLLVSHAPAR-------------------------LLPTIRSRC-RKLRLRPLAPEDVIAAL  207 (363)
T ss_pred             ----------CCCEEEEEEECCHHH-------------------------CHHHHHHHC-CCCCCCCCCHHHHHHHH
T ss_conf             ----------988389986399777-------------------------779999735-24258995999999999


No 98 
>cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold. The ASCE division also includes ABC, RecA-like, VirD4-like, PilT-like, and SF1/2 helicases. Members of the AAA+ ATPases function as molecular chaperons, ATPase subunits of proteases, helicases, or nucleic-acid stimulated ATPases. The AAA+ proteins contain several distinct features in addition to the conserved alpha-beta-alpha core domain structure and the Walker A and B motifs of the P-loop NTPases.
Probab=99.19  E-value=9.2e-11  Score=96.51  Aligned_cols=140  Identities=29%  Similarity=0.390  Sum_probs=97.4

Q ss_pred             HHHHHHHHHHHHHHHCCCCCCEEEECCCCCHHHHHHHHHHHHHHCCCCCHHHHEEEEEEEEHHHHHCCCCCCCHHHHHHH
Q ss_conf             21789999999986226778748966764116689999999985489883452014455404675306343123789999
Q gi|254780163|r  207 VGRHEEINRTIQILCRRSKNNPLYVGDPGVGKTAIAEGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGDFEERIK  286 (798)
Q Consensus       207 IGRd~EI~riiqIL~RR~KNn~~lvG~~gvGktaive~la~~i~~~~vp~~l~~~~i~~ld~~~l~ag~~~rg~fe~r~~  286 (798)
                      .|++.+++.+.+.+......|.+|.|+||+|||.+++.+|+...       ..+..++.++.+.+..+....+++.....
T Consensus         1 ~~~~~~~~~l~~~~~~~~~~~ill~GppGtGKT~la~~ia~~~~-------~~~~~~~~~~~~~~~~~~~~~~~~~~~~~   73 (151)
T cd00009           1 VGQEEAIEALREALELPPPKNLLLYGPPGTGKTTLARAIANELF-------RPGAPFLYLNASDLLEGLVVAELFGHFLV   73 (151)
T ss_pred             CCCHHHHHHHHHHHHCCCCCEEEEECCCCCCHHHHHHHHHHHHC-------CCCCCEEEEEHHHCCHHHHHHHHHHHHHH
T ss_conf             98579999999998187998089989999886599999999712-------13798278547770467777576057788


Q ss_pred             HHHHH-HCCCCCEEEEECCHHHHHCCCCCCCCCCCHHHHHHHHH----CCCCEEEEEECCHHHHHHHHHCCHHHHHHCEE
Q ss_conf             99987-20389839997361663015544434477788887663----02660388730489999985201114320014
Q gi|254780163|r  287 KIVKE-IESYANAILYIDEIHTLVGAGSASGISVDASNLLKPAL----SSGAVRCIGSTTYSEYRQFFEKDKALVRRFQK  361 (798)
Q Consensus       287 ~~~~~-~~~~~~~ilfideih~ligag~~~g~~~d~an~lkP~L----~rg~~~~IgatT~~ey~~~~e~d~al~rrF~~  361 (798)
                      ..... .....+.||||||++.+- . ....   ...++|.-.+    .++.+++|++|+..+.   ...+.++..||..
T Consensus        74 ~~~~~~~~~~~~~vl~iDEi~~l~-~-~~~~---~~~~~l~~~~~~~~~~~~~~vI~~tn~~~~---~~~~~~~~~R~~~  145 (151)
T cd00009          74 RLLFELAEKAKPGVLFIDEIDSLS-R-GAQN---ALLRVLETLNDLRIDRENVRVIGATNRPLL---GDLDRALYDRLDI  145 (151)
T ss_pred             HHHHHHHHHCCCCEEEEECHHHCC-H-HHHH---HHHHHHHHHCCCCCCCCCEEEEEEECCCCC---CCHHHHHHCCCCE
T ss_conf             989999997699869820166559-9-9999---999999871575406788899995289988---6837764255986


No 99 
>PRK07764 DNA polymerase III subunits gamma and tau; Validated
Probab=99.19  E-value=1.4e-10  Score=95.30  Aligned_cols=200  Identities=17%  Similarity=0.169  Sum_probs=129.8

Q ss_pred             HHHHHHCCCCHHHHHHHHHHHHHHHHHHCCCCCCE-EEECCCCCHHHHHHHHHHHHHHCCCCCH-----------HHH--
Q ss_conf             58877548611222178999999998622677874-8966764116689999999985489883-----------452--
Q gi|254780163|r  194 LTEKVKKGKVDILVGRHEEINRTIQILCRRSKNNP-LYVGDPGVGKTAIAEGFAKQIVDGMVPD-----------ILL--  259 (798)
Q Consensus       194 LTe~AreGKLDPVIGRd~EI~riiqIL~RR~KNn~-~lvG~~gvGktaive~la~~i~~~~vp~-----------~l~--  259 (798)
                      |-.+-|-..++-|||-+.-++.+..-+...+=++. |+.|+-|||||+++.-||+.+.-.+-|.           .+.  
T Consensus         5 LyrkyRP~~F~eviGQe~v~~~L~~Ai~~gri~HAYLFsGprG~GKTt~ARilAkaLNC~~~~~~~PCg~C~sC~~i~~g   84 (775)
T PRK07764          5 LYRRYRPATFAEVVGQEHVTEPLSTALDSGRINHAYLFSGPRGCGKTSSARILARSLNCAQGPTSTPCGVCDSCVALAPG   84 (775)
T ss_pred             HHHHHCCCCHHHHCCCHHHHHHHHHHHHCCCCCCEEEEECCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCCHHHHHHHCC
T ss_conf             66550788766622859999999999981997633762378887888999999999668999998988887637888638


Q ss_pred             ---EEEEEEEEHHHHHCCCCCCCHHHHHHHHHHHHHCC----CCCEEEEECCHHHHHCCCCCCCCCCCHHHHHHHHHC--
Q ss_conf             ---01445540467530634312378999999987203----898399973616630155444344777888876630--
Q gi|254780163|r  260 ---GARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIES----YANAILYIDEIHTLVGAGSASGISVDASNLLKPALS--  330 (798)
Q Consensus       260 ---~~~i~~ld~~~l~ag~~~rg~fe~r~~~~~~~~~~----~~~~ilfideih~ligag~~~g~~~d~an~lkP~L~--  330 (798)
                         +.-++++|      +++++|-  +.++.|++.+.-    ..--|..|||.|+|         +-.+.|-|.-.|.  
T Consensus        85 ~~~~~DviEiD------AAS~~gV--ddiReL~e~~~y~P~~~ryKVyIIDEaHml---------s~~afNALLKtLEEP  147 (775)
T PRK07764         85 GPGSLDVVEID------AASHGGV--DDARELRERAFFAPAQSRYRIFIIDEAHMV---------TTAGFNALLKIVEEP  147 (775)
T ss_pred             CCCCCCEEEEC------CCCCCCH--HHHHHHHHHCCCCCCCCCEEEEEEECHHHH---------CHHHHHHHHHHHCCC
T ss_conf             98888668731------5655688--999999985476876786359998535440---------799999998862278


Q ss_pred             CCCEEEEEECCHHHHHHHHHCCHHHHHHCEEEEECCCCHHHHHHHHHHHHHHHHHHCCCEECCHHHHHHHHHHHHHCCCC
Q ss_conf             26603887304899999852011143200144306878689999998612766541035121117899999865420155
Q gi|254780163|r  331 SGAVRCIGSTTYSEYRQFFEKDKALVRRFQKIDVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSR  410 (798)
Q Consensus       331 rg~~~~IgatT~~ey~~~~e~d~al~rrF~~i~v~ep~~~~~~~iL~~~~~~ye~~h~v~~~~~al~~av~ls~ryi~~r  410 (798)
                      -..+.+|=+||.-+  |...   -.-.|-|.....--+.++-..-|..+.    ..-+|.|.+++|..+++.+.--+.| 
T Consensus       148 P~hvvFIlaTTep~--kip~---TI~SRcq~f~Fr~i~~~~~~~~l~~i~----~~E~i~~~~~al~li~r~~~Gs~RD-  217 (775)
T PRK07764        148 PEHLIFIFATTEPE--KVIG---TIRSRTHHYPFRLVPPGTMRPYLERIC----AQEGVVVDDAVLPLVIRAGGGSPRD-  217 (775)
T ss_pred             CCCEEEEEECCCHH--HCCH---HHHHHCCCCCCCCCCHHHHHHHHHHHH----HHCCCCCCHHHHHHHHHHCCCCHHH-
T ss_conf             64627999548735--4716---776410234526699999999999999----9839987989999999982896676-


Q ss_pred             CCHHHHHHHHHHHHH
Q ss_conf             564679889986533
Q gi|254780163|r  411 KLPDKAIDVIDEAGA  425 (798)
Q Consensus       411 ~lPdkAidllDea~a  425 (798)
                           |+.|||.+-|
T Consensus       218 -----alS~ldQl~a  227 (775)
T PRK07764        218 -----TLSVLDQLLA  227 (775)
T ss_pred             -----HHHHHHHHHH
T ss_conf             -----8999999984


No 100
>KOG0740 consensus
Probab=99.18  E-value=3.8e-10  Score=92.08  Aligned_cols=160  Identities=27%  Similarity=0.345  Sum_probs=124.4

Q ss_pred             CEEEECCCCCHHHHHHHHHHHHHHCCCCCHHHHEEEEEEEEHHHHHCCCCCCCHHHHHHHHHHHHHCCCCCEEEEECCHH
Q ss_conf             74896676411668999999998548988345201445540467530634312378999999987203898399973616
Q gi|254780163|r  227 NPLYVGDPGVGKTAIAEGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIESYANAILYIDEIH  306 (798)
Q Consensus       227 n~~lvG~~gvGktaive~la~~i~~~~vp~~l~~~~i~~ld~~~l~ag~~~rg~fe~r~~~~~~~~~~~~~~ilfideih  306 (798)
                      ..+|.|+||.|||+|++.+|.-          .+..++.+...+|  -.||.|+-|.-+..|+.-++....-|.||||+|
T Consensus       188 glLLfGPpgtGKtmL~~aiAsE----------~~atff~iSassL--tsK~~Ge~eK~vralf~vAr~~qPsvifidEid  255 (428)
T KOG0740         188 GLLLFGPPGTGKTMLAKAIATE----------SGATFFNISASSL--TSKYVGESEKLVRALFKVARSLQPSVIFIDEID  255 (428)
T ss_pred             HHHEECCCCCCHHHHHHHHHHH----------HCCEEEECCHHHH--HHHCCCHHHHHHHHHHHHHHHCCCEEEEECHHH
T ss_conf             1120058988447999999862----------0665763068886--532467077899999999871397089840256


Q ss_pred             HHHCCCCCCCCCCCHH----------HHHHHHHCCCCEEEEEECCHHHHHHHHHCCHHHHHHCEE-EEECCCCHHHHHHH
Q ss_conf             6301554443447778----------888766302660388730489999985201114320014-43068786899999
Q gi|254780163|r  307 TLVGAGSASGISVDAS----------NLLKPALSSGAVRCIGSTTYSEYRQFFEKDKALVRRFQK-IDVSEPSIEDAIEI  375 (798)
Q Consensus       307 ~ligag~~~g~~~d~a----------n~lkP~L~rg~~~~IgatT~~ey~~~~e~d~al~rrF~~-i~v~ep~~~~~~~i  375 (798)
                      .++..-  +....+.+          -..++--+...+.+||||-.     ..|-|-|.-|||++ +.|+-|+.++-..+
T Consensus       256 slls~R--s~~e~e~srr~ktefLiq~~~~~s~~~drvlvigaTN~-----P~e~Dea~~Rrf~kr~yiplPd~etr~~~  328 (428)
T KOG0740         256 SLLSKR--SDNEHESSRRLKTEFLLQFDGKNSAPDDRVLVIGATNR-----PWELDEAARRRFVKRLYIPLPDYETRSLL  328 (428)
T ss_pred             HHHHHC--CCCCCCCCHHHHHHHHHHHCCCCCCCCCEEEEEECCCC-----CHHHHHHHHHHHCCEEEECCCCHHHHHHH
T ss_conf             788636--87545445556557776540445788870799815888-----36778888887103155359887899999


Q ss_pred             HHHHHHHHHHHCCCEECCHHHHHHHHHHHHHCCC
Q ss_conf             9861276654103512111789999986542015
Q gi|254780163|r  376 VKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTS  409 (798)
Q Consensus       376 L~~~~~~ye~~h~v~~~~~al~~av~ls~ryi~~  409 (798)
                      +.++-..+    +...++..+...+++.+-|-..
T Consensus       329 ~~~ll~~~----~~~l~~~d~~~l~~~Tegysgs  358 (428)
T KOG0740         329 WKQLLKEQ----PNGLSDLDISLLAKVTEGYSGS  358 (428)
T ss_pred             HHHHHHHC----CCCCCHHHHHHHHHHHCCCCCC
T ss_conf             99999768----7874177899999886175622


No 101
>PRK05564 DNA polymerase III subunit delta'; Validated
Probab=99.18  E-value=2.2e-10  Score=93.72  Aligned_cols=153  Identities=20%  Similarity=0.302  Sum_probs=76.2

Q ss_pred             HHHHCHHHHHHHHHHHHHHHHCCCCCCCCCCCEEEEECCCCHHHHHHHHHHHHHC-CCC--EEEEEHHHHHCCCCCCHHC
Q ss_conf             6653458999999999877520445657874068861432003889999987304-773--3772068861246530110
Q gi|254780163|r  477 TVVYGQEEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFAL-GVQ--LLRFDMSEYMERHAVSRLI  553 (798)
Q Consensus       477 ~~v~GQ~~ai~~v~~~i~~~~~gl~~~~rP~g~flf~GptGvGKTelak~la~~~-~~~--lir~dmsey~e~~~vs~Li  553 (798)
                      ..|+||++++..+.+++...+        ---++||+||.|||||.+|+.+|..+ ...  --..|+-++.-.       
T Consensus         4 ~~iiGq~~i~~~L~~~i~~~r--------l~HAyLF~Gp~G~GK~~~A~~~A~~ll~~~~~~~~~D~~~~~~~-------   68 (313)
T PRK05564          4 RTIIGHENIKNRIDNSIIKGK--------FSHASLIVGEDGIGKSILAKEIANKILGKSEQREYVDIIEYKPI-------   68 (313)
T ss_pred             HHCCCHHHHHHHHHHHHHCCC--------CCCEEEEECCCCCCHHHHHHHHHHHHHCCCCCCCCCCEEEEECC-------
T ss_conf             232682999999999998799--------87504327999850999999999998289977889865886332-------


Q ss_pred             CCCCHHCCCCCCCCCCHHHHHCCC----EEEEECCHHHCCHHHHHHHHHHHHHHHCCCCCCCEECCCCEEEEEECCCCHH
Q ss_conf             478000256444310035551585----1777404455028999999998777502177997761254299994242145
Q gi|254780163|r  554 GAPPGYVGFGQGGILADSVDQNPY----SVVLLDEIEKSHPDVLNILLQIMDYGILTDQSGKKISFRNVILIMTTNAGAL  629 (798)
Q Consensus       554 GappGYvG~~egg~Lte~vr~~P~----sVvl~DEiEKAh~~v~~~llqild~G~ltd~~Gr~vdf~n~iii~TsN~G~~  629 (798)
                        ...-+|-|+=-.|.+.+..+|+    -|+++||.|+-+.+=.|.||..|+|=           -.+|++||+|+--  
T Consensus        69 --~~~~I~vd~IR~l~~~~~~~p~~g~~KV~II~~ae~m~~~AaNALLKtLEEP-----------P~~t~fIL~t~~~--  133 (313)
T PRK05564         69 --NKKSIGVDDIRNIIEEVNKKPYEGDKKVIIIYKSEKMTEQAQNAFLKTIEEP-----------PKGVFIILLCENL--  133 (313)
T ss_pred             --CCCCCCHHHHHHHHHHHHHCCCCCCCEEEEECCHHHHCHHHHHHHHHCCCCC-----------CCCEEEEEEECCH--
T ss_conf             --2569998999999999840862589569998077775899999984550368-----------9985899864983--


Q ss_pred             HHHHCCCCCCCCCCHHHHHHHHHHHCCHHHHCCCCEEEECCCCCHHHHHHHHHH
Q ss_conf             533036898821114889999987288788177682896288999999999999
Q gi|254780163|r  630 EMSKARIGFGSSRNDDADKEALRNFLSPEFLNRLDSIIPFFPLSSDIIRQVVHK  683 (798)
Q Consensus       630 ~~~~~~~g~~~~~~~~~~~~~l~~~f~peflnRid~ii~F~~l~~~~~~~i~~~  683 (798)
                                             ....|--+.|. .++.|+|++.+++...+..
T Consensus       134 -----------------------~~lLpTI~SRC-Q~~~f~~l~~~~i~~~L~~  163 (313)
T PRK05564        134 -----------------------EQILDTIKSRC-QIYKLNRLSKEDIEKFISY  163 (313)
T ss_pred             -----------------------HHCCCHHHCCC-EEEECCCCCHHHHHHHHHH
T ss_conf             -----------------------54757787065-3566899899999999998


No 102
>PRK04195 replication factor C large subunit; Provisional
Probab=99.17  E-value=1.1e-09  Score=88.81  Aligned_cols=186  Identities=25%  Similarity=0.393  Sum_probs=120.9

Q ss_pred             HHHHCHHHHHHHHHHHHHHHHCCCCCCCCCCCEEEEECCCCHHHHHHHHHHHHHCCCCEEEEEHHHHHCCCCCCHHCCCC
Q ss_conf             66534589999999998775204456578740688614320038899999873047733772068861246530110478
Q gi|254780163|r  477 TVVYGQEEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFALGVQLLRFDMSEYMERHAVSRLIGAP  556 (798)
Q Consensus       477 ~~v~GQ~~ai~~v~~~i~~~~~gl~~~~rP~g~flf~GptGvGKTelak~la~~~~~~lir~dmsey~e~~~vs~LiGap  556 (798)
                      ..|+||+.++..+..-+..-..| ..+.   -.+||.||+|||||-+|.+||...+-.++-+|-|+.-....+.+.++.-
T Consensus        14 ~divg~~~~v~~l~~Wl~~w~~g-~~~~---k~lLL~GPpGvGKTT~a~~lAk~~g~~viElNASD~R~~~~I~~~i~~~   89 (403)
T PRK04195         14 SDVVGNEKAKKQLREWIESWLKG-KPPK---KALLLYGPPGVGKTSLAHALANDYGWEVIELNASDQRTKDVIERVAGEA   89 (403)
T ss_pred             HHHHCCHHHHHHHHHHHHHHHCC-CCCC---CEEEEECCCCCCHHHHHHHHHHHHCCCEEEECCCCCCCHHHHHHHHHHH
T ss_conf             99858899999999999998739-9657---4699889399879999999999849985997710114789999999987


Q ss_pred             CHHCCCCCCCCCCHHHHHCCCEEEEECCHHHCCHH----HHHHHHHHHHHHHCCCCCCCEECCCCEEEEEECCCCHHHHH
Q ss_conf             00025644431003555158517774044550289----99999998777502177997761254299994242145533
Q gi|254780163|r  557 PGYVGFGQGGILADSVDQNPYSVVLLDEIEKSHPD----VLNILLQIMDYGILTDQSGKKISFRNVILIMTTNAGALEMS  632 (798)
Q Consensus       557 pGYvG~~egg~Lte~vr~~P~sVvl~DEiEKAh~~----v~~~llqild~G~ltd~~Gr~vdf~n~iii~TsN~G~~~~~  632 (798)
                      -      ..+-|+    ..++-+|++||++--|..    -...+++++.+.             ..-|||++|=    . 
T Consensus        90 ~------~~~sl~----~~~~KlIIlDEvD~l~~~~d~gg~~al~~~ik~s-------------~~PiIli~Nd----~-  141 (403)
T PRK04195         90 S------TSGSLF----GAKRKLILLDEVDGIHGNADRGGVRAILEIIKKA-------------KNPIILTAND----P-  141 (403)
T ss_pred             H------HCCCCC----CCCCEEEEEECCCCCCCHHHHHHHHHHHHHHHCC-------------CCEEEEEECC----C-
T ss_conf             6------068877----8873499963434457244479999999998548-------------8708998268----4-


Q ss_pred             HCCCCCCCCCCHHHHHHHHHHHCCHHHHCCCCEEEECCCCCHHHHHHHHHHHHHHHHHHHHHCCCEEEECHHHHHHHHHC
Q ss_conf             03689882111488999998728878817768289628899999999999999999999986698899988999999971
Q gi|254780163|r  633 KARIGFGSSRNDDADKEALRNFLSPEFLNRLDSIIPFFPLSSDIIRQVVHKFIMKLELQLQEKGISFHFSEEVINWLVSH  712 (798)
Q Consensus       633 ~~~~g~~~~~~~~~~~~~l~~~f~peflnRid~ii~F~~l~~~~~~~i~~~~l~~l~~~l~~~~i~l~~~~~~~~~l~~~  712 (798)
                           ..  .            ..+.+.+|. .++.|+|++..++...+..    +.   ...|+  .+++++++.|++.
T Consensus       142 -----~~--~------------~~~~lrs~c-~~i~F~~~~~~~I~~~L~~----I~---~~Egi--~i~~~aL~~Ia~~  192 (403)
T PRK04195        142 -----YD--P------------SLRPLRNAC-LMIEFKRLSKRSIVPVLKR----IC---RKEGI--ECEEEALREIAER  192 (403)
T ss_pred             -----CC--C------------CHHHHHHHH-HHCCCCCCCHHHHHHHHHH----HH---HHCCC--CCCHHHHHHHHHH
T ss_conf             -----55--6------------717799766-1221799499999999999----99---97699--9999999999998


Q ss_pred             CCCCCCCCHHHHHHHHH
Q ss_conf             89810153267999998
Q gi|254780163|r  713 GYDVKMGARPLERIIKE  729 (798)
Q Consensus       713 ~~~~~~GAR~l~r~i~~  729 (798)
                      +-.      .||..|..
T Consensus       193 s~G------DlR~aIN~  203 (403)
T PRK04195        193 SGG------DLRSAIND  203 (403)
T ss_pred             CCC------HHHHHHHH
T ss_conf             797------39999999


No 103
>PRK13407 bchI magnesium chelatase subunit I; Provisional
Probab=99.16  E-value=2.3e-09  Score=86.47  Aligned_cols=226  Identities=19%  Similarity=0.275  Sum_probs=135.9

Q ss_pred             HHHHCHHHHHHHHHHHHHHHHCCCCCCCCCCCEEEEECCCCHHHHHHHHHHHHHCCC----CEEEEE------HHHHHCC
Q ss_conf             665345899999999987752044565787406886143200388999998730477----337720------6886124
Q gi|254780163|r  477 TVVYGQEEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFALGV----QLLRFD------MSEYMER  546 (798)
Q Consensus       477 ~~v~GQ~~ai~~v~~~i~~~~~gl~~~~rP~g~flf~GptGvGKTelak~la~~~~~----~lir~d------msey~e~  546 (798)
                      ..|+||++|..++.-+..       +|+  +|..|+.||.|+|||-+|+.|+..+..    .-+.++      +.++.+.
T Consensus         8 s~IvGQe~~K~AL~laav-------~p~--~ggvLi~G~~GtgKStlaR~l~~iLP~~~~~e~~~~~~~~~~~~~~~~~~   78 (334)
T PRK13407          8 SAIVGQEEMKQAMVLTAI-------DPG--IGGVLVFGDRGTGKSTAVRALAALLPLIKAVEGCPVNSARPEDCPEWAEV   78 (334)
T ss_pred             HHHCCCHHHHHHHHHHHC-------CCC--CCEEEEECCCCCCHHHHHHHHHHHCCCCCHHCCCCCCCCCCCCCHHHHHC
T ss_conf             376493999999999772-------789--86089978998659999999997289951103675566774211334311


Q ss_pred             CCC------------------CHHCCCC---CHHCC---CCCCCCCCHHHHHCCCEEEEECCHHHCCHHHHHHHHHHHHH
Q ss_conf             653------------------0110478---00025---64443100355515851777404455028999999998777
Q gi|254780163|r  547 HAV------------------SRLIGAP---PGYVG---FGQGGILADSVDQNPYSVVLLDEIEKSHPDVLNILLQIMDY  602 (798)
Q Consensus       547 ~~v------------------s~LiGap---pGYvG---~~egg~Lte~vr~~P~sVvl~DEiEKAh~~v~~~llqild~  602 (798)
                      .+.                  .+++|+=   ..-+|   --+-|.|..|=+    .|+++|||--....|.++|||.+++
T Consensus        79 ~~~~~~~~~~p~v~lPl~atedr~~G~ldie~al~~G~~~~~PGlLa~Ah~----GVLylDEinll~~~vld~Ll~~~e~  154 (334)
T PRK13407         79 SSTTMVERPTPVIDLPLGATEDRVVGALDIERALTRGEKAFEPGLLARANR----GYLYIDEVNLLEDHIVDLLLDVAQS  154 (334)
T ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHCCCCCCCCCHHHHCCC----CEEEEECHHHCCHHHHHHHHHHHHC
T ss_conf             455534489987678999998664474218888626987788605434028----8678720533338899999988716


Q ss_pred             HHCC-CCCCCEECC-CCEEEEEECCCCHHHHHHCCCCCCCCCCHHHHHHHHHHHCCHHHHCCCCEEEECCCC-CHHHHHH
Q ss_conf             5021-779977612-542999942421455330368988211148899999872887881776828962889-9999999
Q gi|254780163|r  603 GILT-DQSGKKISF-RNVILIMTTNAGALEMSKARIGFGSSRNDDADKEALRNFLSPEFLNRLDSIIPFFPL-SSDIIRQ  679 (798)
Q Consensus       603 G~lt-d~~Gr~vdf-~n~iii~TsN~G~~~~~~~~~g~~~~~~~~~~~~~l~~~f~peflnRid~ii~F~~l-~~~~~~~  679 (798)
                      |..+ .-.|.++.+ .+.++|-|.|=        ..                ..++|.++.|++-.|..... +.++-.+
T Consensus       155 G~~~IeReg~s~~~ParF~LVatmNP--------eE----------------g~Lrp~lLDRf~l~v~v~~~~~~~~r~e  210 (334)
T PRK13407        155 GENVVEREGLSIRHPARFVLVGSGNP--------EE----------------GELRPQLLDRFGLSVEVRSPRDVETRVE  210 (334)
T ss_pred             CCEEEEECCEEEECCCCCEEEEEECC--------CC----------------CCCCHHHHHHHCEEEEECCCCCHHHHHH
T ss_conf             95799977634603662658982088--------87----------------7759899836100687148788777668


Q ss_pred             HHHHHH-----------------HHHHHHH-H--HCCCEEEECHHHHHHHHHCCCCC-CCCCHHHHHHHHHHHHHHHHHH
Q ss_conf             999999-----------------9999999-8--66988999889999999718981-0153267999998623599999
Q gi|254780163|r  680 VVHKFI-----------------MKLELQL-Q--EKGISFHFSEEVINWLVSHGYDV-KMGARPLERIIKEHVKVPLADE  738 (798)
Q Consensus       680 i~~~~l-----------------~~l~~~l-~--~~~i~l~~~~~~~~~l~~~~~~~-~~GAR~l~r~i~~~i~~~la~~  738 (798)
                      |+...+                 ..+..++ +  .+-=.+.++++...+++..+..- ..|.|.--++    +...-+-.
T Consensus       211 iv~r~~~~~~~~~~~~~~~~~e~~~l~~~i~~Ar~~l~~v~~~d~~~~~~~~~~~~~~~~g~Ra~i~l----~r~ARa~A  286 (334)
T PRK13407        211 VITRRDAYDADHDAFMAKWGAEDMQLRGRILGARAALPQLKTPDTVLHDCAALCIALGSDGLRGELTL----LRAARAQA  286 (334)
T ss_pred             HHHHHHHHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHCCCCCHHHHHH----HHHHHHHH
T ss_conf             89999986538799999889899999999999987511468999999999999998589871099999----99999999


Q ss_pred             HHCCC
Q ss_conf             96296
Q gi|254780163|r  739 ILFGK  743 (798)
Q Consensus       739 il~~~  743 (798)
                      -|.|.
T Consensus       287 aL~Gr  291 (334)
T PRK13407        287 AFEGA  291 (334)
T ss_pred             HHCCC
T ss_conf             97499


No 104
>KOG0730 consensus
Probab=99.16  E-value=3.9e-09  Score=84.84  Aligned_cols=213  Identities=26%  Similarity=0.419  Sum_probs=137.6

Q ss_pred             HHHHHHHHHHHH--HH---------HCCC---CCCEEEECCCCCHHHHHHHHHHHHHHCCCCCHHHHEEEEEEEEHHHHH
Q ss_conf             217899999999--86---------2267---787489667641166899999999854898834520144554046753
Q gi|254780163|r  207 VGRHEEINRTIQ--IL---------CRRS---KNNPLYVGDPGVGKTAIAEGFAKQIVDGMVPDILLGARIFSLDMGNLI  272 (798)
Q Consensus       207 IGRd~EI~riiq--IL---------~RR~---KNn~~lvG~~gvGktaive~la~~i~~~~vp~~l~~~~i~~ld~~~l~  272 (798)
                      ||=-+++++-+|  |+         .|-.   -.-++|-|+||-|||.++-.+|..          .++.++++....|.
T Consensus       436 IGGlE~lK~elq~~V~~p~~~pe~F~r~Gi~ppkGVLlyGPPGC~KT~lAkalAne----------~~~nFlsvkgpEL~  505 (693)
T KOG0730         436 IGGLEELKRELQQAVEWPLKHPEKFARFGISPPKGVLLYGPPGCGKTLLAKALANE----------AGMNFLSVKGPELF  505 (693)
T ss_pred             CCCHHHHHHHHHHHHHHHHHCHHHHHHHCCCCCCEEEEECCCCCCHHHHHHHHHHH----------HCCCEEECCCHHHH
T ss_conf             45789999999999861665659998725788754777789986247899998646----------35872641578998


Q ss_pred             CCCCCCCHHHHHHHHHHHHHCCCCCEEEEECCHHHHHCCCCCCCCCCCH-----HHHHH---HHHCCCCEEEEEECCHHH
Q ss_conf             0634312378999999987203898399973616630155444344777-----88887---663026603887304899
Q gi|254780163|r  273 AGTRYRGDFEERIKKIVKEIESYANAILYIDEIHTLVGAGSASGISVDA-----SNLLK---PALSSGAVRCIGSTTYSE  344 (798)
Q Consensus       273 ag~~~rg~fe~r~~~~~~~~~~~~~~ilfideih~ligag~~~g~~~d~-----an~lk---P~L~rg~~~~IgatT~~e  344 (798)
                        ++|.||=|.-+..+++.+++..+.|+|+|||..+.|+-+++++  .+     +.+|.   -..+...+-+||||.-..
T Consensus       506 --sk~vGeSEr~ir~iF~kAR~~aP~IiFfDEiDsi~~~R~g~~~--~v~~RVlsqLLtEmDG~e~~k~V~ViAATNRpd  581 (693)
T KOG0730         506 --SKYVGESERAIREVFRKARQVAPCIIFFDEIDALAGSRGGSSS--GVTDRVLSQLLTEMDGLEALKNVLVIAATNRPD  581 (693)
T ss_pred             --HHHCCCHHHHHHHHHHHHHHCCCEEEEHHHHHHHHHCCCCCCC--CHHHHHHHHHHHHCCCCCCCCCEEEEECCCCHH
T ss_conf             --7751825899999999986269837744666666630478755--148999999998700410147089995058810


Q ss_pred             HHHHHHCCHHHHH--HC-EEEEECCCCHHHHHHHHHHHHHHHHHHCCCEECCH-HHHHHHHHHHHHCCCCCCHHHHHHHH
Q ss_conf             9998520111432--00-14430687868999999861276654103512111-78999998654201555646798899
Q gi|254780163|r  345 YRQFFEKDKALVR--RF-QKIDVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKE-AIRAAVQLSVRHFTSRKLPDKAIDVI  420 (798)
Q Consensus       345 y~~~~e~d~al~r--rF-~~i~v~ep~~~~~~~iL~~~~~~ye~~h~v~~~~~-al~~av~ls~ryi~~r~lPdkAidll  420 (798)
                           .-|+||.|  || +.|+|+-|+.+.-..||+--.      ++..+.++ -++..++....| ++.    --.+|-
T Consensus       582 -----~ID~ALlRPGRlD~iiyVplPD~~aR~~Ilk~~~------kkmp~~~~vdl~~La~~T~g~-SGA----el~~lC  645 (693)
T KOG0730         582 -----MIDPALLRPGRLDRIIYVPLPDLEARLEILKQCA------KKMPFSEDVDLEELAQATEGY-SGA----EIVAVC  645 (693)
T ss_pred             -----HCCHHHCCCCCCCEEEEECCCCHHHHHHHHHHHH------HCCCCCCCCCHHHHHHHHCCC-CHH----HHHHHH
T ss_conf             -----1269775986533057515834788999999997------339998655699999985467-738----999999


Q ss_pred             HHHHHHHHHHHHHHHHCCCCHHHHHHHHHHC
Q ss_conf             8653333211443221136578999866310
Q gi|254780163|r  421 DEAGASQILQPLSKRRKFITEKDIKKTIASM  451 (798)
Q Consensus       421 Dea~a~~~~~~~~~~~~~~~~~~i~~~~~~~  451 (798)
                      -|||-...-+...  -..|...+..+.+...
T Consensus       646 q~A~~~a~~e~i~--a~~i~~~hf~~al~~~  674 (693)
T KOG0730         646 QEAALLALRESIE--ATEITWQHFEEALKAV  674 (693)
T ss_pred             HHHHHHHHHHHCC--CCCCCHHHHHHHHHHC
T ss_conf             9999999987526--5434489999999850


No 105
>TIGR02903 spore_lon_C ATP-dependent protease, Lon family; InterPro: IPR014252   This entry shows some relation to the widely distributed ATP-dependent protease La, also called Lon or LonA (IPR004815 from INTERPRO), but is more closely related to LonB (IPR014251 from INTERPRO), a LonA paralog found only in endospore-forming bacteria. Proteins in this entry are unassigned peptidases belonging to the MEROPS peptidase family S16 (lon protease family, clan SJ). They are restricted to a subset of endospore-forming species, and probably participate in the program of endospore formation. We propose the designation LonC..
Probab=99.15  E-value=1.7e-09  Score=87.35  Aligned_cols=232  Identities=21%  Similarity=0.289  Sum_probs=152.7

Q ss_pred             HHCCCCHHHHHHHHHHHHHHHHHHCCCCCCEEEECCCCCHHHHHHHHHHHHHHC-CCCCHHHHEEEEEEEEHHHHHC---
Q ss_conf             754861122217899999999862267787489667641166899999999854-8988345201445540467530---
Q gi|254780163|r  198 VKKGKVDILVGRHEEINRTIQILCRRSKNNPLYVGDPGVGKTAIAEGFAKQIVD-GMVPDILLGARIFSLDMGNLIA---  273 (798)
Q Consensus       198 AreGKLDPVIGRd~EI~riiqIL~RR~KNn~~lvG~~gvGktaive~la~~i~~-~~vp~~l~~~~i~~ld~~~l~a---  273 (798)
                      -|=-.+.=|+|-|.-|+-++-=|+---=-..||-|+||||||+.+. ||.-=++ -.-.++-.+..++++|.+.|=|   
T Consensus       149 LRP~~f~EiVGQerAI~aLlaK~aSPfPQHiiLYGPPGVGKTTaAR-l~LEe~K~~~~tPF~~DA~FvEVDGtTLRWDPR  227 (616)
T TIGR02903       149 LRPRAFSEIVGQERAIKALLAKLASPFPQHIILYGPPGVGKTTAAR-LALEEAKKLKNTPFAEDAPFVEVDGTTLRWDPR  227 (616)
T ss_pred             CCCCCCCCCCCHHHHHHHHHHHHCCCCCCCEEEECCCCCCHHHHHH-HHHHHCCCCCCCCCCCCCCEEEECCCCCCCCCC
T ss_conf             2876676433346899999976318886607855733884789999-987621368744761137857515762667741


Q ss_pred             -------CC----CCCCHHHHHHHHHHHHH-----------CCCCCEEEEECCHHHHHCCCCCCCCCCCH----------
Q ss_conf             -------63----43123789999999872-----------03898399973616630155444344777----------
Q gi|254780163|r  274 -------GT----RYRGDFEERIKKIVKEI-----------ESYANAILYIDEIHTLVGAGSASGISVDA----------  321 (798)
Q Consensus       274 -------g~----~~rg~fe~r~~~~~~~~-----------~~~~~~ilfideih~ligag~~~g~~~d~----------  321 (798)
                             |+    =|.|-     |.=|.|.           .++|. |||||||           |-||.          
T Consensus       228 EvTNPLLGSVHDPIYQGa-----~RDLAE~GvPEPk~GLVT~AHGG-vLFIDEI-----------GELD~lLQnKLLKVL  290 (616)
T TIGR02903       228 EVTNPLLGSVHDPIYQGA-----RRDLAETGVPEPKLGLVTDAHGG-VLFIDEI-----------GELDPLLQNKLLKVL  290 (616)
T ss_pred             CCCCCCCCCCCCCCCCCC-----CHHHCCCCCCCCCCCCCCCCCCC-EEEEECH-----------HHHHHHHHHHHHHHH
T ss_conf             014776776257655676-----40110478798989871004775-6765021-----------122278763244432


Q ss_pred             -------------------HHHHHHHHCCC---CEEEEEECCHHHHHHHHHCCHHHHHHCEEEEECCCCHHHHHHHHHHH
Q ss_conf             -------------------88887663026---60388730489999985201114320014430687868999999861
Q gi|254780163|r  322 -------------------SNLLKPALSSG---AVRCIGSTTYSEYRQFFEKDKALVRRFQKIDVSEPSIEDAIEIVKGI  379 (798)
Q Consensus       322 -------------------an~lkP~L~rg---~~~~IgatT~~ey~~~~e~d~al~rrF~~i~v~ep~~~~~~~iL~~~  379 (798)
                                         -.-+|-.-..|   ++=.|||||-+=    =|=++||-.|-.-|.-++.|+++-..|....
T Consensus       291 EDKrV~F~SsYYDpdD~NvPkYIK~lFe~GAPADFvLIGATTr~P----~eINpALRSRCaEvfFePL~p~dI~~Iv~~A  366 (616)
T TIGR02903       291 EDKRVEFSSSYYDPDDENVPKYIKKLFEEGAPADFVLIGATTRDP----EEINPALRSRCAEVFFEPLTPEDIKEIVLNA  366 (616)
T ss_pred             CCCEEEEEECCCCCCCCCCCHHHHHHHCCCCCCCEEEECCCCCCH----HHCCHHHHCCCCEEECCCCCHHHHHHHHHHH
T ss_conf             264366532124875378655888852268882568726615882----4405123301431321798878999999998


Q ss_pred             HHHHHHHCCCEECCHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHH----HHHHHCCCCHHHHHHHHHHCCCCC
Q ss_conf             2766541035121117899999865420155564679889986533332114----432211365789998663102453
Q gi|254780163|r  380 KPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLPDKAIDVIDEAGASQILQP----LSKRRKFITEKDIKKTIASMNRSI  455 (798)
Q Consensus       380 ~~~ye~~h~v~~~~~al~~av~ls~ryi~~r~lPdkAidllDea~a~~~~~~----~~~~~~~~~~~~i~~~~~~~~~gi  455 (798)
                      +.+.    +|...+.+-+.+.++.   |.+|    |||.+|=-+=+.++-..    .....-.|+.+||.++|.. ..=+
T Consensus       367 A~kl----nv~L~~gV~e~Ia~YT---ieGR----kAvnILAD~Yg~~ly~~~~~~~~~d~~~I~~~dv~evv~~-sRl~  434 (616)
T TIGR02903       367 AEKL----NVKLAEGVEELIARYT---IEGR----KAVNILADVYGYALYKKAEALKEEDKVTITADDVKEVVQI-SRLS  434 (616)
T ss_pred             HHHC----CCCCCCCHHHHHHHCC---CCCH----HHHHHHHHHHHHHHHCCCCCCCCCCCEEEEHHHHHHHHHH-CCCC
T ss_conf             8861----7700036487872147---1311----2223465467676530455567777426618677767753-0457


Q ss_pred             CHHHHHCC
Q ss_conf             10111001
Q gi|254780163|r  456 HTTSFSRD  463 (798)
Q Consensus       456 p~~~~~~~  463 (798)
                      |-.+...+
T Consensus       435 Py~~~~~~  442 (616)
T TIGR02903       435 PYEKVKAS  442 (616)
T ss_pred             CHHHCCCC
T ss_conf             50112468


No 106
>PRK08853 DNA polymerase III subunits gamma and tau; Validated
Probab=99.14  E-value=1.3e-09  Score=88.32  Aligned_cols=198  Identities=18%  Similarity=0.212  Sum_probs=132.7

Q ss_pred             HHHCCCCHHHHHHHHHHHHHHHHHHCCCCCCEEEE-CCCCCHHHHHHHHHHHHHHCCC---------CCHH-----HHEE
Q ss_conf             77548611222178999999998622677874896-6764116689999999985489---------8834-----5201
Q gi|254780163|r  197 KVKKGKVDILVGRHEEINRTIQILCRRSKNNPLYV-GDPGVGKTAIAEGFAKQIVDGM---------VPDI-----LLGA  261 (798)
Q Consensus       197 ~AreGKLDPVIGRd~EI~riiqIL~RR~KNn~~lv-G~~gvGktaive~la~~i~~~~---------vp~~-----l~~~  261 (798)
                      +-|-..++-|||-+.-++-+...|..-+=....|. |.-|||||+++.-||.-+.-.+         ++..     =+..
T Consensus         9 k~RP~~f~e~vGQ~~v~~~L~nal~~~rl~haylf~G~rGvGKTt~ARi~Ak~lNC~~~~~~~pcg~C~~C~~i~~g~~~   88 (717)
T PRK08853          9 KWRPTQFKEVVGQSHVLTALENALAHNRLHHAYLFSGTRGVGKTTIGRLFAKGLNCETGITSTPCGQCATCKEIDEGRFV   88 (717)
T ss_pred             HHCCCCHHHHCCCHHHHHHHHHHHHCCCCCCEEEEECCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCCCCHHHHHCCCCC
T ss_conf             51798565513859999999999970997405761088988898999999998678999999978887026767447877


Q ss_pred             EEEEEEHHHHHCCCCCCCHHHHHHHHHHHHHCC---CCC-EEEEECCHHHHHCCCCCCCCCCCHHHHHHHHHCC--CCEE
Q ss_conf             445540467530634312378999999987203---898-3999736166301554443447778888766302--6603
Q gi|254780163|r  262 RIFSLDMGNLIAGTRYRGDFEERIKKIVKEIES---YAN-AILYIDEIHTLVGAGSASGISVDASNLLKPALSS--GAVR  335 (798)
Q Consensus       262 ~i~~ld~~~l~ag~~~rg~fe~r~~~~~~~~~~---~~~-~ilfideih~ligag~~~g~~~d~an~lkP~L~r--g~~~  335 (798)
                      -++++|.+      +.+|-  +.++.+++.+.-   .+. -|..|||+|+|         +-.+-|-|..-|..  .-+.
T Consensus        89 d~~EiDaA------s~~~v--dd~rel~~~~~y~p~~~~yKvyiiDEvHml---------s~~afnAlLKtlEEPP~hv~  151 (717)
T PRK08853         89 DLLEIDAA------SRTKV--EDTRELLDNVQYKPARGRFKVYLIDEVHML---------SRHSFNALLKTLEEPPEYVK  151 (717)
T ss_pred             CEEEECCC------CCCCH--HHHHHHHHHCCCCCCCCCEEEEEEECHHHC---------CHHHHHHHHHHHCCCCCCEE
T ss_conf             52454056------56788--999999985554887785479998305443---------89999999876037875648


Q ss_pred             EEEECCHHHHHHHHHCCHHHHHHCEEEEECCCCHHHHHHHHHHHHHHHHHHCCCEECCHHHHHHHHHHHHHCCCCCCHHH
Q ss_conf             88730489999985201114320014430687868999999861276654103512111789999986542015556467
Q gi|254780163|r  336 CIGSTTYSEYRQFFEKDKALVRRFQKIDVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLPDK  415 (798)
Q Consensus       336 ~IgatT~~ey~~~~e~d~al~rrF~~i~v~ep~~~~~~~iL~~~~~~ye~~h~v~~~~~al~~av~ls~ryi~~r~lPdk  415 (798)
                      +|-|||.-  +|.-  . ..-.|-|....+--+.++-..-|..+...    -++.|.++||....+.+.--+.|      
T Consensus       152 FilaTT~~--~kip--~-TilSRc~~f~l~~~~~~~i~~~l~~i~~~----E~i~~~~~al~~ia~~a~Gs~Rd------  216 (717)
T PRK08853        152 FLLATTDP--QKLP--V-TILSRCLQFHLKPISVDQIHQQLDFVLDK----EQVSAEARALGLIAHAADGSMRD------  216 (717)
T ss_pred             EEEECCCH--HHCC--H-HHHHHHHHCCCCCCCHHHHHHHHHHHHHH----CCCCCCHHHHHHHHHHCCCCHHH------
T ss_conf             99843873--4373--8-89876544232689999999999999997----59876999999999976883778------


Q ss_pred             HHHHHHHHHHH
Q ss_conf             98899865333
Q gi|254780163|r  416 AIDVIDEAGAS  426 (798)
Q Consensus       416 AidllDea~a~  426 (798)
                      |+.|+|.|-|.
T Consensus       217 alsl~dqaia~  227 (717)
T PRK08853        217 ALSLTDQAIAL  227 (717)
T ss_pred             HHHHHHHHHHH
T ss_conf             88899999996


No 107
>PRK07133 DNA polymerase III subunits gamma and tau; Validated
Probab=99.13  E-value=2.1e-09  Score=86.70  Aligned_cols=201  Identities=22%  Similarity=0.316  Sum_probs=138.3

Q ss_pred             HHHHHHCCCCHHHHHHHHHHHHHHHHHHCCCCCCEEE-ECCCCCHHHHHHHHHHHHHHCCCCCHH-----------HHEE
Q ss_conf             5887754861122217899999999862267787489-667641166899999999854898834-----------5201
Q gi|254780163|r  194 LTEKVKKGKVDILVGRHEEINRTIQILCRRSKNNPLY-VGDPGVGKTAIAEGFAKQIVDGMVPDI-----------LLGA  261 (798)
Q Consensus       194 LTe~AreGKLDPVIGRd~EI~riiqIL~RR~KNn~~l-vG~~gvGktaive~la~~i~~~~vp~~-----------l~~~  261 (798)
                      |..+-|--.++-|||-+.-++.+...+.+.+=....| .|+.|||||+++.-+|..+...+-++.           -...
T Consensus         8 L~RKYRPk~F~EVIGQe~Vv~tL~nAI~~gRIaHAYLF~GPRGvGKTT~ARIfAKaLNC~~~~d~~~pC~~C~~~~~~s~   87 (718)
T PRK07133          8 LYRKYRPKKFDEIKGQDHIIETLKNIIKSGKISHAYLFSGPHGTGKTSVAKIFANALNCSHKTDLIEPCQNCIENFNNNL   87 (718)
T ss_pred             HHHHHCCCCHHHHCCCHHHHHHHHHHHHCCCCCCEEEEECCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCCHHHCCCCCC
T ss_conf             99872899754422859999999999974997505862389986889999999999679999999997702143047898


Q ss_pred             EEEEEEHHHHHCCCCCCCHHHHHHHHHHHHHCC---CCC-EEEEECCHHHHHCCCCCCCCCCCHHHHHHHHHCC--CCEE
Q ss_conf             445540467530634312378999999987203---898-3999736166301554443447778888766302--6603
Q gi|254780163|r  262 RIFSLDMGNLIAGTRYRGDFEERIKKIVKEIES---YAN-AILYIDEIHTLVGAGSASGISVDASNLLKPALSS--GAVR  335 (798)
Q Consensus       262 ~i~~ld~~~l~ag~~~rg~fe~r~~~~~~~~~~---~~~-~ilfideih~ligag~~~g~~~d~an~lkP~L~r--g~~~  335 (798)
                      -++++|.      ++-+|=  +.++.+++.+.-   .+. -|.-|||.|+|         +-.|.|-|.-.|..  ....
T Consensus        88 DViEIDA------ASn~gV--DdIReLie~v~y~P~~gkYKVyIIDEvHML---------S~~AfNALLKtLEEPP~hvv  150 (718)
T PRK07133         88 DIIEMDA------ASNNGV--DEIRELRENVKNLPQISKYKIYIIDEVHML---------SKSAFNALLKTLEEPPKHVI  150 (718)
T ss_pred             CEEEECC------CCCCCH--HHHHHHHHHHCCCCCCCCEEEEEEECCCCC---------CHHHHHHHHHHHCCCCCCCE
T ss_conf             7377545------566888--999999998255887787249999662007---------99999999985027987827


Q ss_pred             EEEECCHHHHHHHHHCCHHHHHHCEEEEECCCCHHHHHHHHHHHHHHHHHHCCCEECCHHHHHHHHHHHHHCCCCCCHHH
Q ss_conf             88730489999985201114320014430687868999999861276654103512111789999986542015556467
Q gi|254780163|r  336 CIGSTTYSEYRQFFEKDKALVRRFQKIDVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLPDK  415 (798)
Q Consensus       336 ~IgatT~~ey~~~~e~d~al~rrF~~i~v~ep~~~~~~~iL~~~~~~ye~~h~v~~~~~al~~av~ls~ryi~~r~lPdk  415 (798)
                      .|-|||.-+  |..   +..-.|-|+....-.+.++-..-|+.+..    .-++.|.++||...++.|.-=+.|      
T Consensus       151 FILaTTep~--KIP---~TIlSRCQrFdFkrI~~~~I~~~L~~I~~----kE~I~~e~eAL~lIA~~a~GSmRD------  215 (718)
T PRK07133        151 FILATTDVQ--KIP---LTILSRVQRFNFRRISEDVIVHQLENILE----KEKIKYEKNALKLIASLASGSLRD------  215 (718)
T ss_pred             EEEEECCHH--HCC---HHHHHCCEEEECCCCCHHHHHHHHHHHHH----HCCCCCCHHHHHHHHHHCCCCHHH------
T ss_conf             999708825--484---87741220335888999999999999999----859977899999999976884888------


Q ss_pred             HHHHHHHHHHH
Q ss_conf             98899865333
Q gi|254780163|r  416 AIDVIDEAGAS  426 (798)
Q Consensus       416 AidllDea~a~  426 (798)
                      |+.+||.+.+.
T Consensus       216 AlSlLDQv~~f  226 (718)
T PRK07133        216 ALSIADQVSIF  226 (718)
T ss_pred             HHHHHHHHHHH
T ss_conf             98799999985


No 108
>TIGR00635 ruvB Holliday junction DNA helicase RuvB; InterPro: IPR004605 All proteins in this family for which functions are known are 5'-3' DNA helicases that, as part of a complex with RuvA homologs serve as a 5'-3' Holliday junction helicase. RuvA specifically binds Holliday junctions as a sandwich of two tetramers and maintains the configuration of the junction. It forms a complex with two hexameric rings of RuvB, the subunit that contains helicase activity. The complex drives ATP-dependent branch migration of the Holliday junction recombination intermediate. The endonuclease RuvC resolves junctions.; GO: 0003677 DNA binding, 0005524 ATP binding, 0009378 Holliday junction helicase activity, 0006281 DNA repair, 0006310 DNA recombination.
Probab=99.13  E-value=1.5e-09  Score=87.77  Aligned_cols=227  Identities=23%  Similarity=0.382  Sum_probs=132.0

Q ss_pred             HHHHHHHHHHHHHHH---HCCCCC---CEEEECCCCCHHHHHHHHHHHHHHCCCCCHHHHEEEEEEEEHHHHHCCCCCCC
Q ss_conf             221789999999986---226778---74896676411668999999998548988345201445540467530634312
Q gi|254780163|r  206 LVGRHEEINRTIQIL---CRRSKN---NPLYVGDPGVGKTAIAEGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRG  279 (798)
Q Consensus       206 VIGRd~EI~riiqIL---~RR~KN---n~~lvG~~gvGktaive~la~~i~~~~vp~~l~~~~i~~ld~~~l~ag~~~rg  279 (798)
                      -||-++ |++-+|+-   +|.+|-   ..+|.||||+|||++++=+|.-+-.        +.+|-|  ...         
T Consensus         6 FiGQ~~-vk~~L~l~I~AAk~R~e~LDH~LL~GPPGLGKTTLA~IiA~Emg~--------~l~iTs--GP~---------   65 (305)
T TIGR00635         6 FIGQEK-VKEQLQLFIEAAKMRQEALDHLLLYGPPGLGKTTLAHIIANEMGV--------NLKITS--GPA---------   65 (305)
T ss_pred             CCCCHH-HHHHHHHHHHHHHHCCCCCCCEEEECCCCCCHHHHHHHHHHHHCC--------CCEEEE--CCC---------
T ss_conf             058288-999999999999824897341663175687467899999998389--------326740--675---------


Q ss_pred             HHHHH---HHHHHHHHCCCCCEEEEECCHHHH--------------------HCCCCCCC-CCCCHHHHHHHHHCCCCEE
Q ss_conf             37899---999998720389839997361663--------------------01554443-4477788887663026603
Q gi|254780163|r  280 DFEER---IKKIVKEIESYANAILYIDEIHTL--------------------VGAGSASG-ISVDASNLLKPALSSGAVR  335 (798)
Q Consensus       280 ~fe~r---~~~~~~~~~~~~~~ilfideih~l--------------------igag~~~g-~~~d~an~lkP~L~rg~~~  335 (798)
                       + +|   |-+++--++ .++ ||||||||=|                    ||-|-++- -.||.+          -+.
T Consensus        66 -L-~kPgDlaaiLt~L~-~gD-VLFIDEIHRL~p~~EE~LYpAMEDF~lDi~IG~Gp~Ar~v~ldLp----------PFT  131 (305)
T TIGR00635        66 -L-EKPGDLAAILTNLE-EGD-VLFIDEIHRLSPAIEELLYPAMEDFRLDIVIGKGPSARSVRLDLP----------PFT  131 (305)
T ss_pred             -C-CCHHHHHHHHHHCC-CCC-EEECCHHHHCCHHHHHHCCCCCCCEEEEEEEECCCCCCEEEECCC----------CCC
T ss_conf             -5-47578999997056-896-310125650483345310530012178778712898525760686----------944


Q ss_pred             EEEECCHHHHHHHHHCCHHHHHHCEEE-EECCCCHHHHHHHHHHHHHHHHHHCCCEECCHHHHHHHHHHHHHCCCCCCHH
Q ss_conf             887304899999852011143200144-3068786899999986127665410351211178999998654201555646
Q gi|254780163|r  336 CIGSTTYSEYRQFFEKDKALVRRFQKI-DVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLPD  414 (798)
Q Consensus       336 ~IgatT~~ey~~~~e~d~al~rrF~~i-~v~ep~~~~~~~iL~~~~~~ye~~h~v~~~~~al~~av~ls~ryi~~r~lPd  414 (798)
                      .|||||-.--  .  -.| |..||=.| +++==|++|=..|+.    ++-.-=+|.+..++..+..+-|      |-=|-
T Consensus       132 LvGATTR~G~--l--t~P-LrdRFG~~~rl~fY~~~EL~~Iv~----R~A~~L~~ei~~~~a~~IArrS------RGTPR  196 (305)
T TIGR00635       132 LVGATTRAGM--L--TSP-LRDRFGIILRLEFYTPEELAEIVS----RSAGLLNIEIEQEAALEIARRS------RGTPR  196 (305)
T ss_pred             CCCCCCCCCC--C--CCC-HHHHHHHHHHCCCCCHHHHHHHHH----HHHHHCCCCCCHHHHHHHHHHC------CCCHH
T ss_conf             2000034774--1--031-334544745402689878999987----5334414300778999998754------78637


Q ss_pred             HHHHHHHHHHHHHHHHHHH--HHHCCCCHHHHHHHHHHCCCCCCHHHHHCCHHHHHHHHCCHHHHHHHCHHHHHHHHHHH
Q ss_conf             7988998653333211443--22113657899986631024531011100112334210000246653458999999999
Q gi|254780163|r  415 KAIDVIDEAGASQILQPLS--KRRKFITEKDIKKTIASMNRSIHTTSFSRDDDSVLSNLEKNLGTVVYGQEEAIKKLSSS  492 (798)
Q Consensus       415 kAidllDea~a~~~~~~~~--~~~~~~~~~~i~~~~~~~~~gip~~~~~~~~~~~l~~l~~~l~~~v~GQ~~ai~~v~~~  492 (798)
                      =|+.||-      |+...+  .....|+.+-..+.+...  +|-..-+..-|.+.|..|-.+..    |-+--+++++-+
T Consensus       197 IAnRLLR------RVRDfA~V~~~~~I~~~i~~~AL~~L--~iD~~GLd~~D~~~L~~li~~f~----GGPVGl~tlA~a  264 (305)
T TIGR00635       197 IANRLLR------RVRDFAQVRGQGVITRDIALKALEML--DIDELGLDEIDRKLLSVLIEKFQ----GGPVGLDTLAAA  264 (305)
T ss_pred             HHHHHHH------HHHHHHHHHCCCCCCHHHHHHHHHHH--CCCHHHHHHHHHHHHHHHHHHCC----CCCHHHHHHHHH
T ss_conf             8887767------66448887267873889999998862--53330057998999999998628----985238989988


Q ss_pred             H
Q ss_conf             8
Q gi|254780163|r  493 I  493 (798)
Q Consensus       493 i  493 (798)
                      +
T Consensus       265 ~  265 (305)
T TIGR00635       265 L  265 (305)
T ss_pred             H
T ss_conf             5


No 109
>PRK06645 DNA polymerase III subunits gamma and tau; Validated
Probab=99.13  E-value=2.1e-09  Score=86.76  Aligned_cols=215  Identities=23%  Similarity=0.274  Sum_probs=142.0

Q ss_pred             HHHCCCCHHHHHHHHHHHHHHHHHHCCCCCC-EEEECCCCCHHHHHHHHHHHHHHCCC----CCH----H-------H--
Q ss_conf             7754861122217899999999862267787-48966764116689999999985489----883----4-------5--
Q gi|254780163|r  197 KVKKGKVDILVGRHEEINRTIQILCRRSKNN-PLYVGDPGVGKTAIAEGFAKQIVDGM----VPD----I-------L--  258 (798)
Q Consensus       197 ~AreGKLDPVIGRd~EI~riiqIL~RR~KNn-~~lvG~~gvGktaive~la~~i~~~~----vp~----~-------l--  258 (798)
                      +-|-..++-|||-+.-++.+-.-+..-+=.+ -++-|+.|||||+.+.-+|..+.-..    -|.    .       +  
T Consensus        14 KyRP~~f~~liGQ~~~~~~l~n~i~~~~~~~aylf~G~rG~GKTt~Ari~ak~lnc~~~~~~~~~~~~c~~c~~c~~i~~   93 (507)
T PRK06645         14 KYRPSNFAELQGQEVLVKVLSYTILNDRLAGGYLLTGIRGVGKTTSARIIAKAVNCSALITENTTIKTCEKCTNCISFNN   93 (507)
T ss_pred             CCCCCCHHHHCCCHHHHHHHHHHHHCCCCCCEEEEECCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCHHHHHHHC
T ss_conf             00799765623939999999999973996634774587997889999999999679998888998888888767899865


Q ss_pred             -HEEEEEEEEHHHHHCCCCCCCHHHHHHHHHHHHHCCC---CC-EEEEECCHHHHHCCCCCCCCCCCHHHHHHHHHC--C
Q ss_conf             -2014455404675306343123789999999872038---98-399973616630155444344777888876630--2
Q gi|254780163|r  259 -LGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIESY---AN-AILYIDEIHTLVGAGSASGISVDASNLLKPALS--S  331 (798)
Q Consensus       259 -~~~~i~~ld~~~l~ag~~~rg~fe~r~~~~~~~~~~~---~~-~ilfideih~ligag~~~g~~~d~an~lkP~L~--r  331 (798)
                       ...-|+++|.++      -+|  =+.++.+++.+.-.   +. -|..|||+|+|         +-+|-|-|.-.|.  -
T Consensus        94 ~~~~dv~EiDaas------~~g--v~~ir~l~~~~~~~p~~~~~kv~iidE~hml---------s~~a~nallktlEepp  156 (507)
T PRK06645         94 HNHPDIIEIDAAS------KTS--VDDIRRIIESAEYKPLQGKHKIFIIDEVHML---------SKGAFNALLKTLEEPP  156 (507)
T ss_pred             CCCCCEEEEECCC------CCC--HHHHHHHHHHCCCCCCCCCEEEEEECCHHHC---------CHHHHHHHHHHHHCCC
T ss_conf             8999859963788------888--8999999863551787674358995214224---------8999999999742786


Q ss_pred             CCEEEEEECCHHHHHHHHHCCHHHHHHCEEEEECCCCHHHHHHHHHHHHHHHHHHCCCEECCHHHHHHHHHHHHHCCCCC
Q ss_conf             66038873048999998520111432001443068786899999986127665410351211178999998654201555
Q gi|254780163|r  332 GAVRCIGSTTYSEYRQFFEKDKALVRRFQKIDVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRK  411 (798)
Q Consensus       332 g~~~~IgatT~~ey~~~~e~d~al~rrF~~i~v~ep~~~~~~~iL~~~~~~ye~~h~v~~~~~al~~av~ls~ryi~~r~  411 (798)
                      ..+.+|-|||.-  +|.  +. ..-.|-|+.....-+.++-..-|..+...    -++.++++||...++.|.-=+.|  
T Consensus       157 ~~~~Fi~atte~--~ki--p~-ti~srcq~f~~~~i~~~~i~~~l~~i~~~----E~~~~~~~al~~ia~~a~Gs~RD--  225 (507)
T PRK06645        157 PHIIFIFATTEV--QKI--PA-TIISRCQRYDLRRLSFEEIFKLLEYITKQ----ENLKADIEALRIIAYKSEGSARD--  225 (507)
T ss_pred             CCEEEEEECCCH--HHC--CH-HHHHHCEEEEEECCCHHHHHHHHHHHHHH----CCCCCCHHHHHHHHHHCCCCHHH--
T ss_conf             443899974853--648--37-88854327875459979999999999997----68777789999999855998678--


Q ss_pred             CHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHH
Q ss_conf             6467988998653333211443221136578999866
Q gi|254780163|r  412 LPDKAIDVIDEAGASQILQPLSKRRKFITEKDIKKTI  448 (798)
Q Consensus       412 lPdkAidllDea~a~~~~~~~~~~~~~~~~~~i~~~~  448 (798)
                          |+.|||.|-+..     ......++.++|.+++
T Consensus       226 ----alslldqai~~~-----~~~~~~I~~~~V~~ML  253 (507)
T PRK06645        226 ----AVSILDQAASMS-----AKSDNIISPQVINQML  253 (507)
T ss_pred             ----HHHHHHHHHHHH-----CCCCCCCCHHHHHHHH
T ss_conf             ----999999999975-----4898702699999983


No 110
>KOG0736 consensus
Probab=99.11  E-value=1.1e-09  Score=88.70  Aligned_cols=96  Identities=27%  Similarity=0.416  Sum_probs=66.5

Q ss_pred             CEEEEECCCCHHHHHHHHHHHHHCCCCEEEEEHHHHHCC---CCCCHHCCCCCHHCCCCCCCCCCHHHHHCCCEEEEECC
Q ss_conf             068861432003889999987304773377206886124---65301104780002564443100355515851777404
Q gi|254780163|r  508 GCYVFSGPTGVGKTEISKQLAFALGVQLLRFDMSEYMER---HAVSRLIGAPPGYVGFGQGGILADSVDQNPYSVVLLDE  584 (798)
Q Consensus       508 g~flf~GptGvGKTelak~la~~~~~~lir~dmsey~e~---~~vs~LiGappGYvG~~egg~Lte~vr~~P~sVvl~DE  584 (798)
                      .+||+-||+|+|||.+.++.|..++.++..+|+.|+...   |+-++|.             ...+..|+.+-+|++|-.
T Consensus       432 ~~vLLhG~~g~GK~t~V~~vas~lg~h~~evdc~el~~~s~~~~etkl~-------------~~f~~a~~~~pavifl~~  498 (953)
T KOG0736         432 PSVLLHGPPGSGKTTVVRAVASELGLHLLEVDCYELVAESASHTETKLQ-------------AIFSRARRCSPAVLFLRN  498 (953)
T ss_pred             EEEEEECCCCCCHHHHHHHHHHHHCCCEEECCHHHHHHCCCCHHHHHHH-------------HHHHHHHHCCCEEEEEEC
T ss_conf             3799867999875799999999838725701389886436331378999-------------999987526862898722


Q ss_pred             HHHCC-----------HHHHHHHHHHHHHHHCCCCCCCEECCCCEEEEEECC
Q ss_conf             45502-----------899999999877750217799776125429999424
Q gi|254780163|r  585 IEKSH-----------PDVLNILLQIMDYGILTDQSGKKISFRNVILIMTTN  625 (798)
Q Consensus       585 iEKAh-----------~~v~~~llqild~G~ltd~~Gr~vdf~n~iii~TsN  625 (798)
                      ++---           ..+++.+++         +.--+-+|..+|+|.|++
T Consensus       499 ~dvl~id~dgged~rl~~~i~~~ls---------~e~~~~~~~~~ivv~t~~  541 (953)
T KOG0736         499 LDVLGIDQDGGEDARLLKVIRHLLS---------NEDFKFSCPPVIVVATTS  541 (953)
T ss_pred             CCEEEECCCCCHHHHHHHHHHHHHH---------CCCCCCCCCCEEEEEECC
T ss_conf             4245533777442779999999972---------023567799659999625


No 111
>TIGR02902 spore_lonB ATP-dependent protease LonB; InterPro: IPR014251   This entry represents LonB, a paralog of the ATP-dependent protease La (LonA, IPR004815 from INTERPRO). LonB proteins are unassigned peptidases belonging to the MEROPS peptidase family S16 (lon protease family, clan SJ) and are found strictly, and almost universally, in endospore-forming bacteria. This protease was shown, in Bacillus subtilis, to be expressed specifically in the forespore during sporulation, under control of sigmaF . The lonB gene, despite being located immediately upstream of lonA, was shown to be monocistronic. LonB appears to be involved in the post-translation control of sigmaH, but lonB mutation did not produce an obvious sporulation defect under the conditions tested . Note that additional paralogs of LonA and LonB occur in the Clostridium lineage and these are excluded from this entry. .
Probab=99.11  E-value=1.7e-09  Score=87.41  Aligned_cols=226  Identities=27%  Similarity=0.371  Sum_probs=158.4

Q ss_pred             HHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHCCCCCCEEEECCCCCHHHHHHHHHHHHHHCCC-CCHHHHEEEEEEEEHH
Q ss_conf             442588775486112221789999999986226778748966764116689999999985489-8834520144554046
Q gi|254780163|r  191 CVDLTEKVKKGKVDILVGRHEEINRTIQILCRRSKNNPLYVGDPGVGKTAIAEGFAKQIVDGM-VPDILLGARIFSLDMG  269 (798)
Q Consensus       191 g~DLTe~AreGKLDPVIGRd~EI~riiqIL~RR~KNn~~lvG~~gvGktaive~la~~i~~~~-vp~~l~~~~i~~ld~~  269 (798)
                      |.=|||+.|=..+|=+||=|+=|+-+-=-||--+==.+|+-|+|||||||=+ .|+..=+..+ ..++=-+..++++|.+
T Consensus        52 t~PL~Ek~RP~SF~EIiGQe~GI~ALKAALCGPNPQHVIiYGPPGVGKTAAA-RLVLeeAKk~~~SPFke~A~FVEiDAT  130 (532)
T TIGR02902        52 TEPLSEKTRPKSFDEIIGQEEGIKALKAALCGPNPQHVIIYGPPGVGKTAAA-RLVLEEAKKNPASPFKEEAAFVEIDAT  130 (532)
T ss_pred             CCCCCCCCCCCCCCCCCCCHHHHHHHHHHCCCCCCCEEEEECCCCCCHHHHH-HHHHHHHHCCCCCCCCCCCEEEEEECC
T ss_conf             7887746677763325673556899998606868963898788696178999-999998650875378988668985051


Q ss_pred             HHHCCCCCCCHHHHH------HHHHHHHH---------------------CCCCCEEEEECCH---HHH-----------
Q ss_conf             753063431237899------99999872---------------------0389839997361---663-----------
Q gi|254780163|r  270 NLIAGTRYRGDFEER------IKKIVKEI---------------------ESYANAILYIDEI---HTL-----------  308 (798)
Q Consensus       270 ~l~ag~~~rg~fe~r------~~~~~~~~---------------------~~~~~~ilfidei---h~l-----------  308 (798)
                      .+        -|-||      +=+|-|=+                     +++|. |||||||   |=+           
T Consensus       131 T~--------RFDERGIADPLIGSVHDPIYQGAGplG~AGIPQPK~GAVT~AHGG-vLFIDEIGELHP~~MNKLLKVLED  201 (532)
T TIGR02902       131 TA--------RFDERGIADPLIGSVHDPIYQGAGPLGVAGIPQPKPGAVTKAHGG-VLFIDEIGELHPVQMNKLLKVLED  201 (532)
T ss_pred             CC--------CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC-EEEECCCCCCCHHHHHHHHHHHHC
T ss_conf             03--------602146666567761585333765457885575877763202586-551212466582435314113302


Q ss_pred             ----HC-CC-CCCCCCCCHHHHHHHHHCCC---CEEEEEECC--HHHHHHHHHCCHHHHHHCEEEEECCCCHHHHHHHHH
Q ss_conf             ----01-55-44434477788887663026---603887304--899999852011143200144306878689999998
Q gi|254780163|r  309 ----VG-AG-SASGISVDASNLLKPALSSG---AVRCIGSTT--YSEYRQFFEKDKALVRRFQKIDVSEPSIEDAIEIVK  377 (798)
Q Consensus       309 ----ig-ag-~~~g~~~d~an~lkP~L~rg---~~~~IgatT--~~ey~~~~e~d~al~rrF~~i~v~ep~~~~~~~iL~  377 (798)
                          +. |- +++  +-..-+-++-.-..|   ++|.|||||  |+      |=.|||-.|-=-|-=.+...||--.|=+
T Consensus       202 RKVFLdSAYY~s~--~pniP~hI~dIFqnGlPADFRLiGATTR~Pe------EIpPAlRSRC~EIFFR~L~~EEi~~iAk  273 (532)
T TIGR02902       202 RKVFLDSAYYSSE--DPNIPSHIRDIFQNGLPADFRLIGATTRNPE------EIPPALRSRCVEIFFRPLLKEEIKEIAK  273 (532)
T ss_pred             CCCHHHCCCCCCC--CCCCCHHHHHHHCCCCCCCEECCCCCCCCCC------CCCHHHHCCCEEEEECCCCHHHHHHHHH
T ss_conf             2200001235877--7865427899720678734012133369877------6783465052267716888789999987


Q ss_pred             HHHHHHHHHCCCEECCHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHH
Q ss_conf             612766541035121117899999865420155564679889986533332114432211365789998663
Q gi|254780163|r  378 GIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLPDKAIDVIDEAGASQILQPLSKRRKFITEKDIKKTIA  449 (798)
Q Consensus       378 ~~~~~ye~~h~v~~~~~al~~av~ls~ryi~~r~lPdkAidllDea~a~~~~~~~~~~~~~~~~~~i~~~~~  449 (798)
                      .-.++-    ++.+..+|++....+|.   ++|    -||.|+--||=-+    ..+.|+.|..+||.-++.
T Consensus       274 ~AaeKI----g~~l~~~Al~~I~~Ya~---nGR----EAvN~~QLAaG~a----~~E~Rk~I~~~DieWV~~  330 (532)
T TIGR02902       274 NAAEKI----GLNLEKEALDLIAKYAS---NGR----EAVNLVQLAAGIA----LGENRKRILAEDIEWVIE  330 (532)
T ss_pred             HHHHHC----CCCCCHHHHHHHHHHHC---CCC----HHHHHHHHHHHHE----ECCCCCEECHHHHHHHHH
T ss_conf             656530----46547547999998740---540----6778999973140----128876120546445553


No 112
>COG5271 MDN1 AAA ATPase containing von Willebrand factor type A (vWA) domain [General function prediction only]
Probab=99.10  E-value=1.7e-09  Score=87.39  Aligned_cols=153  Identities=29%  Similarity=0.400  Sum_probs=108.3

Q ss_pred             CCCCCCEEEEECCCCHHHHHHHHHHHHHCCCCEEEEEHHHHHCCCCCCHHCCCCCHHCCCCCCCCCC-------HHHHHC
Q ss_conf             5787406886143200388999998730477337720688612465301104780002564443100-------355515
Q gi|254780163|r  503 PNKPIGCYVFSGPTGVGKTEISKQLAFALGVQLLRFDMSEYMERHAVSRLIGAPPGYVGFGQGGILA-------DSVDQN  575 (798)
Q Consensus       503 ~~rP~g~flf~GptGvGKTelak~la~~~~~~lir~dmsey~e~~~vs~LiGappGYvG~~egg~Lt-------e~vr~~  575 (798)
                      -.||+   |+-|.+|||||-+-.+||...+..++|||.||-++   .--|.||   |+--++||+.-       .+.| +
T Consensus      1542 v~kpi---lLEGsPGVGKTSlItaLAr~tG~kliRINLSeQTd---L~DLfGs---d~Pve~~Gef~w~dapfL~amr-~ 1611 (4600)
T COG5271        1542 VGKPI---LLEGSPGVGKTSLITALARKTGKKLIRINLSEQTD---LCDLFGS---DLPVEEGGEFRWMDAPFLHAMR-D 1611 (4600)
T ss_pred             CCCCE---EECCCCCCCHHHHHHHHHHHHCCCEEEEECCCCCH---HHHHHCC---CCCCCCCCEEEECCCHHHHHHH-C
T ss_conf             28854---62279986678999999997457247863201102---8987377---8875567616742468999853-4


Q ss_pred             CCEEEEECCHHHCCHHHHHHHHHHHHHHHC-C-CCCCCEECCC-CEEEEEECCCCHHHHHHCCCCCCCCCCHHHHHHHHH
Q ss_conf             851777404455028999999998777502-1-7799776125-429999424214553303689882111488999998
Q gi|254780163|r  576 PYSVVLLDEIEKSHPDVLNILLQIMDYGIL-T-DQSGKKISFR-NVILIMTTNAGALEMSKARIGFGSSRNDDADKEALR  652 (798)
Q Consensus       576 P~sVvl~DEiEKAh~~v~~~llqild~G~l-t-d~~Gr~vdf~-n~iii~TsN~G~~~~~~~~~g~~~~~~~~~~~~~l~  652 (798)
                      . .-||+||+--|..+|+.=|=-.||.-+= - -....+.|+. |..|+.+-|--.+                   .-=|
T Consensus      1612 G-~WVlLDEiNLaSQSVlEGLNacLDhR~eayIPEld~~f~~HpnfrVFAaqNPq~q-------------------ggGR 1671 (4600)
T COG5271        1612 G-GWVLLDEINLASQSVLEGLNACLDHRREAYIPELDKTFDVHPNFRVFAAQNPQDQ-------------------GGGR 1671 (4600)
T ss_pred             C-CEEEEEHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCEEECCCCEEEEEECCCHHC-------------------CCCC
T ss_conf             9-8799624103278899888998850144256311332521687055420481102-------------------7985


Q ss_pred             HHCCHHHHCCCCEEEECCCCCHHHHHHHHHHHHH
Q ss_conf             7288788177682896288999999999999999
Q gi|254780163|r  653 NFLSPEFLNRLDSIIPFFPLSSDIIRQVVHKFIM  686 (798)
Q Consensus       653 ~~f~peflnRid~ii~F~~l~~~~~~~i~~~~l~  686 (798)
                      +-.+--|+||+ .+|.-..|+.+++..|+..+.-
T Consensus      1672 KgLPkSF~nRF-svV~~d~lt~dDi~~Ia~~~yp 1704 (4600)
T COG5271        1672 KGLPKSFLNRF-SVVKMDGLTTDDITHIANKMYP 1704 (4600)
T ss_pred             CCCCHHHHHHH-HEEEECCCCCCHHHHHHHHHCC
T ss_conf             66878886221-1577503453009999985177


No 113
>COG1222 RPT1 ATP-dependent 26S proteasome regulatory subunit [Posttranslational modification, protein turnover, chaperones]
Probab=99.09  E-value=7.9e-09  Score=82.61  Aligned_cols=214  Identities=25%  Similarity=0.334  Sum_probs=141.1

Q ss_pred             HHHHHHHHHHHHHHHCCCCC-------------CEEEECCCCCHHHHHHHHHHHHHHCCCCCHHHHEEEEEEEEHHHHHC
Q ss_conf             21789999999986226778-------------74896676411668999999998548988345201445540467530
Q gi|254780163|r  207 VGRHEEINRTIQILCRRSKN-------------NPLYVGDPGVGKTAIAEGFAKQIVDGMVPDILLGARIFSLDMGNLIA  273 (798)
Q Consensus       207 IGRd~EI~riiqIL~RR~KN-------------n~~lvG~~gvGktaive~la~~i~~~~vp~~l~~~~i~~ld~~~l~a  273 (798)
                      =|=|+.|+.+-++.-=--||             .++|-|+||.|||-++-.+|...          ++.++-+..+.|| 
T Consensus       154 GGL~~Qi~EirE~VELPL~~PElF~~~GI~PPKGVLLYGPPGTGKTLLAkAVA~~T----------~AtFIrvvgSElV-  222 (406)
T COG1222         154 GGLDEQIQEIREVVELPLKNPELFEELGIDPPKGVLLYGPPGTGKTLLAKAVANQT----------DATFIRVVGSELV-  222 (406)
T ss_pred             CCHHHHHHHHHHHHCCCCCCHHHHHHCCCCCCCCEEEECCCCCCHHHHHHHHHHCC----------CCEEEEECCHHHH-
T ss_conf             58899999999984033668889997499999712766899975889999987205----------8669994219999-


Q ss_pred             CCCCCCHHHHHHHHHHHHHCCCCCEEEEECCHHHHHCCCCCCCCCCC---------HHHHHHHHHCCCCEEEEEECCHHH
Q ss_conf             63431237899999998720389839997361663015544434477---------788887663026603887304899
Q gi|254780163|r  274 GTRYRGDFEERIKKIVKEIESYANAILYIDEIHTLVGAGSASGISVD---------ASNLLKPALSSGAVRCIGSTTYSE  344 (798)
Q Consensus       274 g~~~rg~fe~r~~~~~~~~~~~~~~ilfideih~ligag~~~g~~~d---------~an~lkP~L~rg~~~~IgatT~~e  344 (798)
                       .||-||=-.-++.++.-++.+.+.|+|||||..|=+.-..++++.|         .-|-|--.=.||++++|+||.--.
T Consensus       223 -qKYiGEGaRlVRelF~lArekaPsIIFiDEIDAIg~kR~d~~t~gDrEVQRTmleLL~qlDGFD~~~nvKVI~ATNR~D  301 (406)
T COG1222         223 -QKYIGEGARLVRELFELAREKAPSIIFIDEIDAIGAKRFDSGTSGDREVQRTMLELLNQLDGFDPRGNVKVIMATNRPD  301 (406)
T ss_pred             -HHHHCCCHHHHHHHHHHHHHCCCEEEEEECHHHHHCCCCCCCCCCHHHHHHHHHHHHHHCCCCCCCCCEEEEEECCCCC
T ss_conf             -9983411699999999874149849998311223111136888850999999999998605889788768998558855


Q ss_pred             HHHHHHCCHHHHH--HCE-EEEECCCCHHHHHHHHHHHHHHHHHHCCCEECCH-HHHHHHHHHHHHCCCCCCHHHHHHHH
Q ss_conf             9998520111432--001-4430687868999999861276654103512111-78999998654201555646798899
Q gi|254780163|r  345 YRQFFEKDKALVR--RFQ-KIDVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKE-AIRAAVQLSVRHFTSRKLPDKAIDVI  420 (798)
Q Consensus       345 y~~~~e~d~al~r--rF~-~i~v~ep~~~~~~~iL~~~~~~ye~~h~v~~~~~-al~~av~ls~ryi~~r~lPdkAidll  420 (798)
                           --||||-|  ||. +|.++-|+.+.-.+||+--..+      ...+++ -++..+++..-+      -+--|   
T Consensus       302 -----~LDPALLRPGR~DRkIEfplPd~~gR~~Il~IHtrk------M~l~~dvd~e~la~~~~g~------sGAdl---  361 (406)
T COG1222         302 -----ILDPALLRPGRFDRKIEFPLPDEEGRAEILKIHTRK------MNLADDVDLELLARLTEGF------SGADL---  361 (406)
T ss_pred             -----CCCHHHCCCCCCCCEEECCCCCHHHHHHHHHHHHHH------CCCCCCCCHHHHHHHCCCC------CHHHH---
T ss_conf             -----557665088754530116898978999999987621------4676676999998753899------56779---


Q ss_pred             HHHHHHHHHHHHHHHHCCCCHHHHHHHHHHCC
Q ss_conf             86533332114432211365789998663102
Q gi|254780163|r  421 DEAGASQILQPLSKRRKFITEKDIKKTIASMN  452 (798)
Q Consensus       421 Dea~a~~~~~~~~~~~~~~~~~~i~~~~~~~~  452 (798)
                      --.|.-+-+-+..++|..|+.+|....+.+..
T Consensus       362 kaictEAGm~AiR~~R~~Vt~~DF~~Av~KV~  393 (406)
T COG1222         362 KAICTEAGMFAIRERRDEVTMEDFLKAVEKVV  393 (406)
T ss_pred             HHHHHHHHHHHHHHCCCEECHHHHHHHHHHHH
T ss_conf             99999875999986047333999999999997


No 114
>PRK11034 clpA ATP-dependent Clp protease ATP-binding subunit; Provisional
Probab=99.09  E-value=2.8e-06  Score=64.30  Aligned_cols=62  Identities=18%  Similarity=0.176  Sum_probs=53.8

Q ss_pred             CCHHHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHCCCCHHHHHHHHCCCCHHHHHHHHHHHCC
Q ss_conf             6989999999999999980998125999878787377429999999849998999999983000
Q gi|254780163|r   82 PTSSFQRVVQRAVLHVQSTGRGIVTGANILVALFSEPDSHATYFLQEQEMTLYDAVNFISHGIS  145 (798)
Q Consensus        82 ~S~~l~rVL~~A~~~A~~~G~~~I~~eHLLLALL~e~ds~a~~iL~~~gis~~~v~~~i~~~~~  145 (798)
                      +|++++.+|+.|...|..+++++|+++|||+||+.+.  .+..+|...+++...+...+...+.
T Consensus         2 ~s~~l~~~L~~A~~~A~~~~H~~v~~EHlLlaLl~~~--~~~~~L~~~~~d~~~l~~~l~~~i~   63 (758)
T PRK11034          2 LNQELELSLNMAFARAREHRHEFMTVEHLLLALLSNP--SAREALEACSVDLVALRQELEAFIE   63 (758)
T ss_pred             CCHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHCCC--HHHHHHHHCCCCHHHHHHHHHHHHH
T ss_conf             8979999999999999982998322999999998694--1899999859999999999999997


No 115
>PRK07399 DNA polymerase III subunit delta'; Validated
Probab=99.07  E-value=5.1e-09  Score=83.95  Aligned_cols=163  Identities=24%  Similarity=0.388  Sum_probs=94.2

Q ss_pred             HHHHHHCHHHHHHHHHHHHHHHHCCCCCCCCCCCEEEEECCCCHHHHHHHHHHHHHC-CCC----E--EEEEHHHHHCCC
Q ss_conf             246653458999999999877520445657874068861432003889999987304-773----3--772068861246
Q gi|254780163|r  475 LGTVVYGQEEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFAL-GVQ----L--LRFDMSEYMERH  547 (798)
Q Consensus       475 l~~~v~GQ~~ai~~v~~~i~~~~~gl~~~~rP~g~flf~GptGvGKTelak~la~~~-~~~----l--ir~dmsey~e~~  547 (798)
                      +-+.||||+.++..+.+++...        |---++||.||.|+||+.+|..+|..+ ...    .  .++.-...-+-|
T Consensus         2 ~F~~iiGq~~~~~~L~~ai~~~--------rl~hAyLF~Gp~G~GK~~~A~~fa~~Ll~~~~~~~~~~~ri~~~nHPDl~   73 (314)
T PRK07399          2 LFANLIGQPLAIELLTAAIEQN--------RIAPAYLFAGPEGVGRKLAALRFIEGLLSQGSPSKNIRRRLEEGNHPDLL   73 (314)
T ss_pred             CCCCCCCCHHHHHHHHHHHHCC--------CCCCEEEEECCCCCCHHHHHHHHHHHHHCCCCCCCCHHHHHHCCCCCCEE
T ss_conf             8331259499999999999859--------96744877899983299999999999857899997665587518999778


Q ss_pred             CC-------CHHCC-----------CCCHHCCCCCCCCCCHHHHHCC----CEEEEECCHHHCCHHHHHHHHHHHHHHHC
Q ss_conf             53-------01104-----------7800025644431003555158----51777404455028999999998777502
Q gi|254780163|r  548 AV-------SRLIG-----------APPGYVGFGQGGILADSVDQNP----YSVVLLDEIEKSHPDVLNILLQIMDYGIL  605 (798)
Q Consensus       548 ~v-------s~LiG-----------appGYvG~~egg~Lte~vr~~P----~sVvl~DEiEKAh~~v~~~llqild~G~l  605 (798)
                      -|       .+++.           ..|..++-++=-.+.+.+.++|    |.|+++|+.|+...+-.|.||..|+|=  
T Consensus        74 ~i~P~~~~~g~~~~~~~~~~~~~~~~~~~~I~idqIR~l~~~l~~~p~~~~~kVvII~~ae~m~~~AaNaLLKtLEEP--  151 (314)
T PRK07399         74 WVEPTYQHQGKLITASEAEEAGLKRKSPPQIRLEQIREIKRFLSRPPLEAPRKVVVIEDAETMNEAAANALLKTLEEP--  151 (314)
T ss_pred             EEECCCCCCCCCCCHHHHHHHHHHCCCCCCCCHHHHHHHHHHHCCCCCCCCCEEEEECCHHHCCHHHHHHHHHHHCCC--
T ss_conf             860562003454557789876530268777879999999999731885688479998897871999999999861478--


Q ss_pred             CCCCCCEECCCCEEEEEECCCCHHHHHHCCCCCCCCCCHHHHHHHHHHHCCHHHHCCCCEEEECCCCCHHHHHHHHHH
Q ss_conf             177997761254299994242145533036898821114889999987288788177682896288999999999999
Q gi|254780163|r  606 TDQSGKKISFRNVILIMTTNAGALEMSKARIGFGSSRNDDADKEALRNFLSPEFLNRLDSIIPFFPLSSDIIRQVVHK  683 (798)
Q Consensus       606 td~~Gr~vdf~n~iii~TsN~G~~~~~~~~~g~~~~~~~~~~~~~l~~~f~peflnRid~ii~F~~l~~~~~~~i~~~  683 (798)
                        ++       +++|+.|+|..                          ..-|--..|. .+|.|+||+.+++.+++..
T Consensus       152 --~~-------~~fILit~~~~--------------------------~lLpTI~SRC-Q~i~F~~l~~~~i~~~L~~  193 (314)
T PRK07399        152 --GN-------GTLILIAPSPE--------------------------SLLPTIVSRC-QIIPFYRLSDEQLEQVLKR  193 (314)
T ss_pred             --CC-------CEEEEEECCHH--------------------------HCCHHHHCCC-EEEECCCCCHHHHHHHHHH
T ss_conf             --78-------56999979936--------------------------4914664187-5633899899999999997


No 116
>PRK09862 putative ATP-dependent protease; Provisional
Probab=99.07  E-value=6.5e-09  Score=83.18  Aligned_cols=225  Identities=21%  Similarity=0.311  Sum_probs=122.7

Q ss_pred             HHHCHHHHHHHHHHHHHHHHCCCCCCCCCCCEEEEECCCCHHHHHHHHHHHHHCCC---------CEE-----------E
Q ss_conf             65345899999999987752044565787406886143200388999998730477---------337-----------7
Q gi|254780163|r  478 VVYGQEEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFALGV---------QLL-----------R  537 (798)
Q Consensus       478 ~v~GQ~~ai~~v~~~i~~~~~gl~~~~rP~g~flf~GptGvGKTelak~la~~~~~---------~li-----------r  537 (798)
                      .|.||+.|..+    +..+-||-+       .+|+.||+|+|||.||+.|...+..         .-|           .
T Consensus       192 dv~Gq~~akra----leIAAAGgH-------nlLl~GpPG~GKTMlA~rlp~ILPpLt~~e~lEv~~I~Svag~~~~~~~  260 (506)
T PRK09862        192 DVVGQEQGKRG----LEITAAGGH-------NLLLIGPPGTGKTMLASRINGLLPDLSNEEALESAAILSLVNAESVQKQ  260 (506)
T ss_pred             HHCCCHHHHHH----HHHHHCCCC-------CEEEECCCCCCHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHCCCCCCCC
T ss_conf             53697999999----999744688-------6598769994598999775123899898999999999987189877775


Q ss_pred             EEHHHHHCCCCCCHHCCCCCHHCCCC---CCCCCCHHHHHCCCEEEEECCHHHCCHHHHHHHHHHHHHHHCCCCC-CCEE
Q ss_conf             20688612465301104780002564---4431003555158517774044550289999999987775021779-9776
Q gi|254780163|r  538 FDMSEYMERHAVSRLIGAPPGYVGFG---QGGILADSVDQNPYSVVLLDEIEKSHPDVLNILLQIMDYGILTDQS-GKKI  613 (798)
Q Consensus       538 ~dmsey~e~~~vs~LiGappGYvG~~---egg~Lte~vr~~P~sVvl~DEiEKAh~~v~~~llqild~G~ltd~~-Gr~v  613 (798)
                      +.---|..+|.-+    |.++-+|-+   .-|..+    .--+.|++|||+=--.++|++.|-|-|++|.++=+. +.++
T Consensus       261 ~~~rPfR~PHHs~----S~~aliGGG~~~~PGEIS----LAH~GVLFLDElpEF~r~vLe~LRqPLE~g~I~IsRa~~~~  332 (506)
T PRK09862        261 WRQRPFRSPHHSA----SLTAMVGGGAIPGPGEIS----LAHNGVLFLDELPEFERRTLDALREPIESGQIHLSRTRAKI  332 (506)
T ss_pred             CCCCCEECCCCCC----CHHHHHCCCCCCCCCCEE----ECCCCEEEECCHHCCCHHHHHHHHHHHCCCEEEEEECCCEE
T ss_conf             4668503788765----476663799999997222----13575788455000688899987762247759999668679


Q ss_pred             CC-CCEEEEEECCCCHHHHHHCCCCC-CCCCC--HHHHHHHHHHHCCHHHHCCCCEEEECCCCCHHHHHH---------H
Q ss_conf             12-54299994242145533036898-82111--488999998728878817768289628899999999---------9
Q gi|254780163|r  614 SF-RNVILIMTTNAGALEMSKARIGF-GSSRN--DDADKEALRNFLSPEFLNRLDSIIPFFPLSSDIIRQ---------V  680 (798)
Q Consensus       614 df-~n~iii~TsN~G~~~~~~~~~g~-~~~~~--~~~~~~~l~~~f~peflnRid~ii~F~~l~~~~~~~---------i  680 (798)
                      .| .+-.+|+++|-       -..|+ .....  .......-.+.++--|+.|||-.|.-...+...+..         -
T Consensus       333 ~~PA~F~LVaAmNP-------CPCG~~~~~~~~Ct~~~~~rY~~rlSGPllDRiDl~v~v~~~~~~~l~~~~~~~esS~~  405 (506)
T PRK09862        333 TYPARFQLVAAMNP-------SPTGHYQGNHNRCTPEQTLRYLNRLSGPFLDRFDLSLEIPLPPPGILSKTVVPGESSAT  405 (506)
T ss_pred             EECCHHHHEHHCCC-------CCCCCCCCCCCCCCHHHHHHHHHHCCHHHHHCEEEEEECCCCCHHHHHCCCCCCCCHHH
T ss_conf             86153311110378-------88888999977789899999986566221303647998168996666324898988899


Q ss_pred             HHHHHHHHHHHHHHC-------------CCEEEECHHHHHHHHHCCCCCCCCCHHHHHHHH
Q ss_conf             999999999999866-------------988999889999999718981015326799999
Q gi|254780163|r  681 VHKFIMKLELQLQEK-------------GISFHFSEEVINWLVSHGYDVKMGARPLERIIK  728 (798)
Q Consensus       681 ~~~~l~~l~~~l~~~-------------~i~l~~~~~~~~~l~~~~~~~~~GAR~l~r~i~  728 (798)
                      +......-.++..+|             .-...+++++..+|-+....-...+|...|+++
T Consensus       406 ir~rV~~Ar~~q~~R~~~~Na~l~~~~l~~~~~l~~~~~~~L~~a~~~~~lS~R~~~riLr  466 (506)
T PRK09862        406 VKQRVMAARERQFKRQNKLNAWLDSPEIRQFCKLESEDARWLEETLIHLGLSIRAWQRLLK  466 (506)
T ss_pred             HHHHHHHHHHHHHHHCCCCCCCCCHHHHHHHCCCCHHHHHHHHHHHHHCCCCHHHHHHHHH
T ss_conf             9999999999999855165657998999765499978999999999965957999999999


No 117
>PRK08691 DNA polymerase III subunits gamma and tau; Validated
Probab=99.06  E-value=3.2e-09  Score=85.45  Aligned_cols=198  Identities=21%  Similarity=0.261  Sum_probs=126.6

Q ss_pred             HHHHCCCCHHHHHHHHHHHHHHHHHHCCCCCC-EEEECCCCCHHHHHHHHHHHHHHCCC----CCH----------HHHE
Q ss_conf             87754861122217899999999862267787-48966764116689999999985489----883----------4520
Q gi|254780163|r  196 EKVKKGKVDILVGRHEEINRTIQILCRRSKNN-PLYVGDPGVGKTAIAEGFAKQIVDGM----VPD----------ILLG  260 (798)
Q Consensus       196 e~AreGKLDPVIGRd~EI~riiqIL~RR~KNn-~~lvG~~gvGktaive~la~~i~~~~----vp~----------~l~~  260 (798)
                      .+-|-..++-|||-+.-++-+..-|..-+=.. -++.|.-|||||+++.-||..+.-.+    -|-          .-..
T Consensus         8 rk~RP~~F~e~vGQ~~v~~~L~nal~~~rl~haylf~G~rGvGKTt~Ari~Ak~lNC~~~~~~~pCg~C~~C~~i~~g~~   87 (704)
T PRK08691          8 RKWRPKTFADLVGQEHVVKALQNALDEGRLHHAYLLTGTRGVGKTTIARILAKSLNCENAQHGEPCGVCQSCTQIDAGRY   87 (704)
T ss_pred             HHHCCCCHHHHCCCHHHHHHHHHHHHHCCCCCEEEEECCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCCHHHHHHHCCCC
T ss_conf             65188747564186999999999998199752375027898788899999999967999999997877776787855899


Q ss_pred             EEEEEEEHHHHHCCCCCCCHHHHHHHHHHHHHCC---CCC-EEEEECCHHHHHCCCCCCCCCCCHHH-HHHHHHC--CCC
Q ss_conf             1445540467530634312378999999987203---898-39997361663015544434477788-8876630--266
Q gi|254780163|r  261 ARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIES---YAN-AILYIDEIHTLVGAGSASGISVDASN-LLKPALS--SGA  333 (798)
Q Consensus       261 ~~i~~ld~~~l~ag~~~rg~fe~r~~~~~~~~~~---~~~-~ilfideih~ligag~~~g~~~d~an-~lkP~L~--rg~  333 (798)
                      .-++++|.++      .+|-  +.++.+++.+.-   .+. -|..|||+|+|-         -.+-| +|| -|.  -.-
T Consensus        88 ~D~~EiDaAs------~~~v--dd~R~l~~~~~y~P~~~~yKVyiiDEvhmLs---------~~afNAlLK-tLEEPP~~  149 (704)
T PRK08691         88 VDLLEIDAAS------NTGI--DNIREVLENAQYAPTAGKYKVYIIDEVHMLS---------KSAFNAMLK-TLEEPPEH  149 (704)
T ss_pred             CCEEEEECCC------CCCH--HHHHHHHHHCCCCCCCCCEEEEEEECHHHCC---------HHHHHHHHH-HHCCCCCC
T ss_conf             8747742454------4588--9999999853468867853599983154438---------999999998-61479756


Q ss_pred             EEEEEECCHHHHHHHHHCCHHHHHHCEEEEECCCCHHHHHHHHHHHHHHHHHHCCCEECCHHHHHHHHHHHHHCCCCCCH
Q ss_conf             03887304899999852011143200144306878689999998612766541035121117899999865420155564
Q gi|254780163|r  334 VRCIGSTTYSEYRQFFEKDKALVRRFQKIDVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLP  413 (798)
Q Consensus       334 ~~~IgatT~~ey~~~~e~d~al~rrF~~i~v~ep~~~~~~~iL~~~~~~ye~~h~v~~~~~al~~av~ls~ryi~~r~lP  413 (798)
                      +.+|-|||.-+  |.  ...-|.| -|....+--+.++-..-|..+-.    .-++.|.++||....+.+.--+.|    
T Consensus       150 v~FilaTTdp~--Kl--p~TIlSR-C~~f~l~~~~~~~i~~~L~~i~~----~E~i~~e~~al~~ia~~a~Gs~RD----  216 (704)
T PRK08691        150 VKFILATTDPH--KV--PVTVLSR-CLQFVLRNMTAQQVADHLAHVLD----SEKIAYEPPALQLLGRAAAGSMRD----  216 (704)
T ss_pred             EEEEEECCCHH--HC--CHHHHHH-HHHHCCCCCCHHHHHHHHHHHHH----HCCCCCCHHHHHHHHHHCCCCHHH----
T ss_conf             08998548846--47--5899988-87710268999999999999999----839856899999999975785777----


Q ss_pred             HHHHHHHHHHHHH
Q ss_conf             6798899865333
Q gi|254780163|r  414 DKAIDVIDEAGAS  426 (798)
Q Consensus       414 dkAidllDea~a~  426 (798)
                        |+.|||.|-|.
T Consensus       217 --alslldQaia~  227 (704)
T PRK08691        217 --ALSLLDQAIAL  227 (704)
T ss_pred             --HHHHHHHHHHH
T ss_conf             --98899999996


No 118
>TIGR02397 dnaX_nterm DNA polymerase III, subunits gamma and tau; InterPro: IPR012763    This entry represents the well-conserved first N-terminal domain of DnaX, approx. 365 aa. The full-length product of the dnaX gene in Escherichia coli encodes the DNA polymerase III tau subunit. A translational frameshift leads to early termination and a truncated protein subunit gamma, about 1/3 shorter than tau and present in roughly equal amounts. This frameshift mechanism is not necessarily universal for species with DNA polymerase III but appears conserved in the extreme thermophile Thermus thermophilis.; GO: 0003887 DNA-directed DNA polymerase activity, 0005524 ATP binding, 0006260 DNA replication, 0009360 DNA polymerase III complex.
Probab=99.06  E-value=3.4e-09  Score=85.23  Aligned_cols=116  Identities=31%  Similarity=0.418  Sum_probs=58.2

Q ss_pred             HHHCHHHHHHHHHHHHHHHHCCCCCCCCCCCEEEEECCCCHHHHHHHHHHHHHCCCCEEEE-------EHHHHHCCCCCC
Q ss_conf             6534589999999998775204456578740688614320038899999873047733772-------068861246530
Q gi|254780163|r  478 VVYGQEEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFALGVQLLRF-------DMSEYMERHAVS  550 (798)
Q Consensus       478 ~v~GQ~~ai~~v~~~i~~~~~gl~~~~rP~g~flf~GptGvGKTelak~la~~~~~~lir~-------dmsey~e~~~vs  550 (798)
                      .||||++.|.++.+||...|.        --+|||.||-|||||-.||.||..+.=.-...       .|-|....-++.
T Consensus        15 d~~GQ~~iv~tL~NAi~~~ri--------~HAYLF~GpRGtGKTS~ARIfAKaLNC~~~~~~PCn~C~~C~~i~~g~~~D   86 (363)
T TIGR02397        15 DVIGQEHIVKTLKNAIKNGRI--------AHAYLFSGPRGTGKTSIARIFAKALNCQGPDGEPCNECESCKEINSGSSLD   86 (363)
T ss_pred             CCCCCHHHHHHHHHHHHHCCC--------CCEEEECCCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCCHHHHHHCCCCCC
T ss_conf             023517999999999971896--------623450285997635589999998658878778777750227765289866


Q ss_pred             --HHCCCCCHHCCCCCCCCCCHHHHHCC----CEEEEECCHHHCCHHHHHHHHHHHHHH
Q ss_conf             --11047800025644431003555158----517774044550289999999987775
Q gi|254780163|r  551 --RLIGAPPGYVGFGQGGILADSVDQNP----YSVVLLDEIEKSHPDVLNILLQIMDYG  603 (798)
Q Consensus       551 --~LiGappGYvG~~egg~Lte~vr~~P----~sVvl~DEiEKAh~~v~~~llqild~G  603 (798)
                        -+=||  ..=|=|+==.|.|.|.-.|    |=|-..||++==.+.=||.||.-|+|=
T Consensus        87 viEiDAA--SN~gVD~IR~l~e~v~y~P~~~kYKvYIIDEVHMLS~~AFNALLKTLEEP  143 (363)
T TIGR02397        87 VIEIDAA--SNNGVDDIRELRENVKYAPSKGKYKVYIIDEVHMLSKSAFNALLKTLEEP  143 (363)
T ss_pred             EEEECCC--CCCCHHHHHHHHHHHCCCCCCCCCCEEEEECCCCCCHHHHHHHHHHHCCC
T ss_conf             6886486--56878899999873036875544335887323028656899987652279


No 119
>PRK07994 DNA polymerase III subunits gamma and tau; Validated
Probab=99.05  E-value=1.1e-09  Score=88.73  Aligned_cols=197  Identities=19%  Similarity=0.217  Sum_probs=124.6

Q ss_pred             HHHCCCCHHHHHHHHHHHHHHHHHHCCCCC-CEEEECCCCCHHHHHHHHHHHHHHCCCCC--HH---------H---HEE
Q ss_conf             775486112221789999999986226778-74896676411668999999998548988--34---------5---201
Q gi|254780163|r  197 KVKKGKVDILVGRHEEINRTIQILCRRSKN-NPLYVGDPGVGKTAIAEGFAKQIVDGMVP--DI---------L---LGA  261 (798)
Q Consensus       197 ~AreGKLDPVIGRd~EI~riiqIL~RR~KN-n~~lvG~~gvGktaive~la~~i~~~~vp--~~---------l---~~~  261 (798)
                      +-|-..++-|||-+.-++-+...|.--+=. --++.|..|||||+++.-||..+.-.+-+  ..         +   ...
T Consensus         9 k~Rp~~f~~~vGQ~~v~~~l~na~~~~r~~haylf~G~rG~GKtt~ari~ak~lnc~~~~~~~pcg~c~~c~~i~~g~~~   88 (643)
T PRK07994          9 KWRPQTFADVVGQEHVLTALANGLSLGRIHHAYLFSGTRGVGKTSIARLLAKGLNCETGITATPCGVCDNCREIEQGRFV   88 (643)
T ss_pred             HHCCCCHHHHCCCHHHHHHHHHHHHHCCCCCEEEEECCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCCHHHHHHHCCCCC
T ss_conf             52888666653879999999999982986634874589988888999999999679999999978767768988658988


Q ss_pred             EEEEEEHHHHHCCCCCCCHHHHHHHHHHHHHCC---CCC-EEEEECCHHHHHCCCCCCCCCCCHHH-HHHHHHCC-CCEE
Q ss_conf             445540467530634312378999999987203---898-39997361663015544434477788-88766302-6603
Q gi|254780163|r  262 RIFSLDMGNLIAGTRYRGDFEERIKKIVKEIES---YAN-AILYIDEIHTLVGAGSASGISVDASN-LLKPALSS-GAVR  335 (798)
Q Consensus       262 ~i~~ld~~~l~ag~~~rg~fe~r~~~~~~~~~~---~~~-~ilfideih~ligag~~~g~~~d~an-~lkP~L~r-g~~~  335 (798)
                      -++++|.      ++-+|-  +-++.+++.+.-   .+. -|..|||+|+|-         -.+-| +||..=.- -.+.
T Consensus        89 d~~eida------as~~~v--d~~rel~~~~~y~p~~~r~kvyiidEvhmls---------~~afnalLKtlEePp~hv~  151 (643)
T PRK07994         89 DLIEIDA------ASRTKV--EDTRDLLDNVQYAPARGRFKVYLIDEVHMLS---------RHSFNALLKTLEEPPAHVK  151 (643)
T ss_pred             CEEEEEC------CCCCCH--HHHHHHHHHCCCCCCCCCEEEEEEECHHHCC---------HHHHHHHHHHHCCCCHHCE
T ss_conf             7588636------777888--9999999844668877853699972210158---------9999999986237861008


Q ss_pred             EEEECCHHHHHHHHHCCHHHHHHCEEEEECCCCHHHHHHHHHHHHHHHHHHCCCEECCHHHHHHHHHHHHHCCCCCCHHH
Q ss_conf             88730489999985201114320014430687868999999861276654103512111789999986542015556467
Q gi|254780163|r  336 CIGSTTYSEYRQFFEKDKALVRRFQKIDVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLPDK  415 (798)
Q Consensus       336 ~IgatT~~ey~~~~e~d~al~rrF~~i~v~ep~~~~~~~iL~~~~~~ye~~h~v~~~~~al~~av~ls~ryi~~r~lPdk  415 (798)
                      +|-|||.-  +|.  ...-|.| -|....+.-+.++-..-|..+-.    .-++.|.++||....+.+.--+.|      
T Consensus       152 filaTT~~--~k~--p~TilSR-C~~f~~~~~~~~~i~~~l~~i~~----~e~i~~~~~al~~ia~~a~gs~rd------  216 (643)
T PRK07994        152 FLLATTDP--QKL--PVTILSR-CLQFHLKALDVEQIRHQLEHILN----EEHIAHEPRALQLLARAADGSLRD------  216 (643)
T ss_pred             EEEECCCH--HHC--CHHHHHH-HHHEECCCCCHHHHHHHHHHHHH----HCCCCCCHHHHHHHHHHCCCCHHH------
T ss_conf             99860774--548--4789977-76500166999999999999999----759987889999999974786566------


Q ss_pred             HHHHHHHHHH
Q ss_conf             9889986533
Q gi|254780163|r  416 AIDVIDEAGA  425 (798)
Q Consensus       416 AidllDea~a  425 (798)
                      |..|+|.|-|
T Consensus       217 alsl~dq~i~  226 (643)
T PRK07994        217 ALSLTDQAIA  226 (643)
T ss_pred             HHHHHHHHHH
T ss_conf             8889999998


No 120
>PRK07003 DNA polymerase III subunits gamma and tau; Validated
Probab=99.05  E-value=3.8e-09  Score=84.90  Aligned_cols=197  Identities=21%  Similarity=0.260  Sum_probs=127.2

Q ss_pred             HHHCCCCHHHHHHHHHHHHHHHHHHCCCCCCEEE-ECCCCCHHHHHHHHHHHHHHCCCC----CHH--------H--HEE
Q ss_conf             7754861122217899999999862267787489-667641166899999999854898----834--------5--201
Q gi|254780163|r  197 KVKKGKVDILVGRHEEINRTIQILCRRSKNNPLY-VGDPGVGKTAIAEGFAKQIVDGMV----PDI--------L--LGA  261 (798)
Q Consensus       197 ~AreGKLDPVIGRd~EI~riiqIL~RR~KNn~~l-vG~~gvGktaive~la~~i~~~~v----p~~--------l--~~~  261 (798)
                      +-|-..++-|||-+--++-+...|..-+=.+..| .|.-|||||++..-||.-+...+-    |-.        -  +..
T Consensus         9 k~RP~~f~e~vGQ~~v~~~l~nal~~~rl~haylf~G~rGvGKTt~aRi~Ak~lnC~~~~~~~pcg~C~~C~~i~~g~~~   88 (816)
T PRK07003          9 KWRPKDFASLVGQEHVVRALTHALDGGRLHHAYLFTGTRGVGKTTLSRIFAKALNCETGVTSQPCGVCRACREIDEGRFV   88 (816)
T ss_pred             HHCCCCHHHHCCCHHHHHHHHHHHHCCCCCCEEEEECCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCCHHHHHHHCCCCC
T ss_conf             50898576623849999999999970986314751178988888999999998678999998978775557877558877


Q ss_pred             EEEEEEHHHHHCCCCCCCHHHHHHHHHHHHHCC---CCC-EEEEECCHHHHHCCCCCCCCCCCHHH-HHHHHHC--CCCE
Q ss_conf             445540467530634312378999999987203---898-39997361663015544434477788-8876630--2660
Q gi|254780163|r  262 RIFSLDMGNLIAGTRYRGDFEERIKKIVKEIES---YAN-AILYIDEIHTLVGAGSASGISVDASN-LLKPALS--SGAV  334 (798)
Q Consensus       262 ~i~~ld~~~l~ag~~~rg~fe~r~~~~~~~~~~---~~~-~ilfideih~ligag~~~g~~~d~an-~lkP~L~--rg~~  334 (798)
                      -++++|.++      .+|-  +.++.+++.+.-   .+. -|..|||+|+|-         -.+=| +|| -|.  -.-+
T Consensus        89 d~iEiDaAS------~~~v--d~~r~l~~~~~y~p~~~r~KvyiiDEvHmls---------~~afnalLK-tlEepP~hv  150 (816)
T PRK07003         89 DYVEMDAAS------NRGV--DEMAALLERAVYAPVDARFKVYMIDEVHMLT---------NHAFNAMLK-TLEEPPPHV  150 (816)
T ss_pred             CEEEEECCC------CCCH--HHHHHHHHHCCCCCCCCCEEEEEEECHHHCC---------HHHHHHHHH-HHCCCCCCE
T ss_conf             547863554------3576--8999999862247866744799984154339---------999999998-403798664


Q ss_pred             EEEEECCHHHHHHHHHCCHHHHHHCEEEEECCCCHHHHHHHHHHHHHHHHHHCCCEECCHHHHHHHHHHHHHCCCCCCHH
Q ss_conf             38873048999998520111432001443068786899999986127665410351211178999998654201555646
Q gi|254780163|r  335 RCIGSTTYSEYRQFFEKDKALVRRFQKIDVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLPD  414 (798)
Q Consensus       335 ~~IgatT~~ey~~~~e~d~al~rrF~~i~v~ep~~~~~~~iL~~~~~~ye~~h~v~~~~~al~~av~ls~ryi~~r~lPd  414 (798)
                      .+|-|||.-  +|.  ...-|.| -+....+--+.++-..-|..+-.    .-+|.|.++||....+.+.--+.|     
T Consensus       151 ~FilaTTd~--~k~--p~tilSR-c~~f~l~~~~~~~i~~~l~~i~~----~E~i~~e~~al~lia~~a~GsmRD-----  216 (816)
T PRK07003        151 KFILATTDP--QKI--PVTVLSR-CLQFNLKQMPAGHIVSHLERILG----EERIAFEPQALRLLARAAQGSMRD-----  216 (816)
T ss_pred             EEEEECCCH--HHC--CHHHHHH-HHHCCCCCCCHHHHHHHHHHHHH----HCCCCCCHHHHHHHHHHCCCCHHH-----
T ss_conf             899955880--115--2889877-76522367999999999999999----829977999999999976773788-----


Q ss_pred             HHHHHHHHHHHH
Q ss_conf             798899865333
Q gi|254780163|r  415 KAIDVIDEAGAS  426 (798)
Q Consensus       415 kAidllDea~a~  426 (798)
                       |+.|+|.|-|.
T Consensus       217 -alsl~dQaia~  227 (816)
T PRK07003        217 -ALSLTDQAIAY  227 (816)
T ss_pred             -HHHHHHHHHHH
T ss_conf             -88599999984


No 121
>CHL00081 chlI Mg-protoporyphyrin IX chelatase
Probab=99.04  E-value=8.3e-08  Score=75.28  Aligned_cols=227  Identities=22%  Similarity=0.253  Sum_probs=132.8

Q ss_pred             HHHHCHHHHHHHHHHHHHHHHCCCCCCCCCCCEEEEECCCCHHHHHHHHHHHHHCCC-CE---EEEE--------HHHH-
Q ss_conf             665345899999999987752044565787406886143200388999998730477-33---7720--------6886-
Q gi|254780163|r  477 TVVYGQEEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFALGV-QL---LRFD--------MSEY-  543 (798)
Q Consensus       477 ~~v~GQ~~ai~~v~~~i~~~~~gl~~~~rP~g~flf~GptGvGKTelak~la~~~~~-~l---ir~d--------msey-  543 (798)
                      .-|+||+++..++.-+..       +|+  +|-.|+.||.|+|||-++++||.-+.. ..   ..|+        |+.. 
T Consensus        12 ~aIvGQe~~k~aLll~av-------~p~--iGgVLi~G~~GtgKStlvRala~lLP~i~~v~~~~f~~~p~~p~~~~~~~   82 (347)
T CHL00081         12 TAIVGQEEMKLALLLNVI-------DPK--IGGVMIMGDRGTGKSTTIRALVDLLPEIEVVKNDPFNSDPRDPDLMSDEV   82 (347)
T ss_pred             HHHCCHHHHHHHHHHHHC-------CCC--CCEEEEECCCCCCHHHHHHHHHHHCCCCEEECCCCCCCCCCCCCCCCHHH
T ss_conf             065384999999999825-------788--78699878998749999999998578742206887678989810024266


Q ss_pred             ------HCC--------------C--CCCHHCCCCCHH----CC--CCCCCCCCHHHHHCCCEEEEECCHHHCCHHHHHH
Q ss_conf             ------124--------------6--530110478000----25--6444310035551585177740445502899999
Q gi|254780163|r  544 ------MER--------------H--AVSRLIGAPPGY----VG--FGQGGILADSVDQNPYSVVLLDEIEKSHPDVLNI  595 (798)
Q Consensus       544 ------~e~--------------~--~vs~LiGappGY----vG--~~egg~Lte~vr~~P~sVvl~DEiEKAh~~v~~~  595 (798)
                            .+.              .  +-.|++|+=--.    -|  .=+.|.|.++=|    .|++.|||.-+.+.+.++
T Consensus        83 ~~~~~~~~~~~~~~~~~p~v~lPlgaTEDrv~GslDie~al~~G~~~f~pGlLa~A~r----GiLyvDEINll~d~~v~~  158 (347)
T CHL00081         83 RERIRNGEKIPTKKIKIPMVDLPLGATEDRVCGTIDIEKALTEGVKAFEPGLLAKANR----GILYVDEVNLLDDHLVDI  158 (347)
T ss_pred             HHHHCCCCCCCCEECCCCEEECCCCCCCCEECCCHHHHHHHHCCCCCCCCCHHHHCCC----CEEEEEHHHHHHHHHHHH
T ss_conf             6543146667521146862536888852301140009989845871156531222038----858861454323799999


Q ss_pred             HHHHHHHHHCC-CCCCCEECCC-CEEEEEECCCCHHHHHHCCCCCCCCCCHHHHHHHHHHHCCHHHHCCCCEEEECC-CC
Q ss_conf             99987775021-7799776125-429999424214553303689882111488999998728878817768289628-89
Q gi|254780163|r  596 LLQIMDYGILT-DQSGKKISFR-NVILIMTTNAGALEMSKARIGFGSSRNDDADKEALRNFLSPEFLNRLDSIIPFF-PL  672 (798)
Q Consensus       596 llqild~G~lt-d~~Gr~vdf~-n~iii~TsN~G~~~~~~~~~g~~~~~~~~~~~~~l~~~f~peflnRid~ii~F~-~l  672 (798)
                      ||+++.+|..| ...|..+..- +.++|-|.|=              +.          ...+|.++.|+.-.+... +.
T Consensus       159 LLda~a~G~~~VEReG~S~~~Pa~F~liaT~NP--------------eE----------geLrp~llDRF~l~v~v~~~~  214 (347)
T CHL00081        159 LLDSAASGWNTVEREGISIRHPARFVLIGSGNP--------------EE----------GELRPQLLDRFGMHAEIRTVK  214 (347)
T ss_pred             HHHHHHCCEEEECCCCEEECCCCCEEEEECCCC--------------CC----------CCCCHHHHHHEEEEEECCCCC
T ss_conf             999985580898046423305750068855786--------------55----------674888882632267458878


Q ss_pred             CHHHHHHHHHHHHH-----------------HHHHHH---HHCCCEEEECHHHHHHHHHCCCCCCCCCHHHHHHHHHHHH
Q ss_conf             99999999999999-----------------999999---8669889998899999997189810153267999998623
Q gi|254780163|r  673 SSDIIRQVVHKFIM-----------------KLELQL---QEKGISFHFSEEVINWLVSHGYDVKMGARPLERIIKEHVK  732 (798)
Q Consensus       673 ~~~~~~~i~~~~l~-----------------~l~~~l---~~~~i~l~~~~~~~~~l~~~~~~~~~GAR~l~r~i~~~i~  732 (798)
                      +.++-.+|++..+.                 .+..++   ++.==.+.++++.+.|+++.+-  .+|.-+.|--| -.+.
T Consensus       215 ~~e~R~eiv~~r~~f~~~p~~f~~~~~~~~~~l~~~I~~Ar~~L~~V~v~~~~~~~i~~~~~--~~~v~g~RA~I-~l~r  291 (347)
T CHL00081        215 DPELRVKIVEQRSNFDKNPENFREKYSESQDALKTQIILARQLLPNVEIDYDLRVKISQICS--ELDVDGLRGDI-VTNR  291 (347)
T ss_pred             CHHHHHHHHHHHHHHHHCHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHH--HHCCCCCCHHH-HHHH
T ss_conf             98999999999997651969999998878999999999998644773559999999999999--84899871899-9999


Q ss_pred             HHHHHHHHCCC
Q ss_conf             59999996296
Q gi|254780163|r  733 VPLADEILFGK  743 (798)
Q Consensus       733 ~~la~~il~~~  743 (798)
                      ..-|-.-|.|+
T Consensus       292 aARA~AAL~GR  302 (347)
T CHL00081        292 AAKALAAFNGR  302 (347)
T ss_pred             HHHHHHHHCCC
T ss_conf             99999998699


No 122
>COG3604 FhlA Transcriptional regulator containing GAF, AAA-type ATPase, and DNA binding domains [Transcription / Signal transduction mechanisms]
Probab=99.04  E-value=2.4e-08  Score=79.13  Aligned_cols=214  Identities=21%  Similarity=0.319  Sum_probs=162.5

Q ss_pred             HHHCHHHHHHHHHHHHHHHHCCCCCCCCCCCEEEEECCCCHHHHHHHHHHHHHC---CCCEEEEEHHHHHCCCCCCHHCC
Q ss_conf             653458999999999877520445657874068861432003889999987304---77337720688612465301104
Q gi|254780163|r  478 VVYGQEEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFAL---GVQLLRFDMSEYMERHAVSRLIG  554 (798)
Q Consensus       478 ~v~GQ~~ai~~v~~~i~~~~~gl~~~~rP~g~flf~GptGvGKTelak~la~~~---~~~lir~dmsey~e~~~vs~LiG  554 (798)
                      .+|||..|+..+.+.|...    ...+-   +.|..|-|||||--.||++-+.+   +++||.+||.-.-|.-.=|-|.|
T Consensus       224 ~iIG~S~am~~ll~~i~~V----A~Sd~---tVLi~GETGtGKElvAraIH~~S~R~~kPfV~~NCAAlPesLlESELFG  296 (550)
T COG3604         224 GIIGRSPAMRQLLKEIEVV----AKSDS---TVLIRGETGTGKELVARAIHQLSPRRDKPFVKLNCAALPESLLESELFG  296 (550)
T ss_pred             CCCCCCHHHHHHHHHHHHH----HCCCC---EEEEECCCCCCHHHHHHHHHHHCCCCCCCCEEEECCCCCHHHHHHHHHC
T ss_conf             6230699999999999987----26898---0798458885389999999873755579866631222537888888745


Q ss_pred             CCCHHCCCCCCCCCCHHHHHCCC-------EEEEECCHHHCCHHHHHHHHHHHHHHHCC---CCCCCEECCCCEEEEEEC
Q ss_conf             78000256444310035551585-------17774044550289999999987775021---779977612542999942
Q gi|254780163|r  555 APPGYVGFGQGGILADSVDQNPY-------SVVLLDEIEKSHPDVLNILLQIMDYGILT---DQSGKKISFRNVILIMTT  624 (798)
Q Consensus       555 appGYvG~~egg~Lte~vr~~P~-------sVvl~DEiEKAh~~v~~~llqild~G~lt---d~~Gr~vdf~n~iii~Ts  624 (798)
                             |+. |-.|-|++.++-       +-+++|||---.+.++--||-+|.+|.+.   +++-.+||   +=||..+
T Consensus       297 -------HeK-GAFTGA~~~r~GrFElAdGGTLFLDEIGelPL~lQaKLLRvLQegEieRvG~~r~ikVD---VRiIAAT  365 (550)
T COG3604         297 -------HEK-GAFTGAINTRRGRFELADGGTLFLDEIGELPLALQAKLLRVLQEGEIERVGGDRTIKVD---VRVIAAT  365 (550)
T ss_pred             -------CCC-CCCCCCHHCCCCCEEECCCCEEECHHHCCCCHHHHHHHHHHHHHCCEEECCCCCEEEEE---EEEEECC
T ss_conf             -------332-23335101467635655797576022036787788999999863652534799636777---8998213


Q ss_pred             CCCHHHHHHCCCCCCCCCCHHHHHHHH-HHHCCHHHHCCCCEEEEC-CCC--CHHHHHHHHHHHHHHHHHHHHHCCC-EE
Q ss_conf             421455330368988211148899999-872887881776828962-889--9999999999999999999986698-89
Q gi|254780163|r  625 NAGALEMSKARIGFGSSRNDDADKEAL-RNFLSPEFLNRLDSIIPF-FPL--SSDIIRQVVHKFIMKLELQLQEKGI-SF  699 (798)
Q Consensus       625 N~G~~~~~~~~~g~~~~~~~~~~~~~l-~~~f~peflnRid~ii~F-~~l--~~~~~~~i~~~~l~~l~~~l~~~~i-~l  699 (798)
                      |-                   +..+++ ...||-.+.-||+.+=.+ -||  -++++--.+.-++.+...++   |. .+
T Consensus       366 NR-------------------DL~~~V~~G~FRaDLYyRLsV~Pl~lPPLRER~~DIplLA~~Fle~~~~~~---gr~~l  423 (550)
T COG3604         366 NR-------------------DLEEMVRDGEFRADLYYRLSVFPLELPPLRERPEDIPLLAGYFLEKFRRRL---GRAIL  423 (550)
T ss_pred             CH-------------------HHHHHHHCCCCHHHHHHCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHC---CCCCC
T ss_conf             53-------------------099998749515545321020013789834588667999999999998863---97640


Q ss_pred             EECHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHH
Q ss_conf             9988999999971898101532679999986235
Q gi|254780163|r  700 HFSEEVINWLVSHGYDVKMGARPLERIIKEHVKV  733 (798)
Q Consensus       700 ~~~~~~~~~l~~~~~~~~~GAR~l~r~i~~~i~~  733 (798)
                      .++++|.+.|.+..|--  --|.|..+|++.+.-
T Consensus       424 ~ls~~Al~~L~~y~wPG--NVRELen~veRavll  455 (550)
T COG3604         424 SLSAEALELLSSYEWPG--NVRELENVVERAVLL  455 (550)
T ss_pred             CCCHHHHHHHHCCCCCC--CHHHHHHHHHHHHHH
T ss_conf             33989999997399997--199999899999997


No 123
>PRK05563 DNA polymerase III subunits gamma and tau; Validated
Probab=99.04  E-value=4.8e-08  Score=76.99  Aligned_cols=36  Identities=11%  Similarity=0.352  Sum_probs=15.8

Q ss_pred             HEEEEEEEEHHHHHCCCCCCCHHHHHHHHHHHHHCCCCCEEEEE
Q ss_conf             20144554046753063431237899999998720389839997
Q gi|254780163|r  259 LGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIESYANAILYI  302 (798)
Q Consensus       259 ~~~~i~~ld~~~l~ag~~~rg~fe~r~~~~~~~~~~~~~~ilfi  302 (798)
                      ..++||-+|=.-|++.        +-+.++++.++..+.-+.||
T Consensus       118 ~~~Kv~IiDEvhmls~--------~a~nallKtlEePp~~~~Fi  153 (541)
T PRK05563        118 GKYKVYIMDEVHMLSQ--------GAVNAFLKTLEEPPSNVIFI  153 (541)
T ss_pred             CCEEEEEEECCCCCCH--------HHHHHHHHHHHCCCCCCEEE
T ss_conf             8705999977233899--------99999999985487775699


No 124
>COG0542 clpA ATP-binding subunits of Clp protease and DnaK/DnaJ chaperones [Posttranslational modification, protein turnover, chaperones]
Probab=99.04  E-value=3.4e-06  Score=63.67  Aligned_cols=62  Identities=19%  Similarity=0.169  Sum_probs=40.5

Q ss_pred             CCHHHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHCCCCHHHHHHHHCCCCHHHHHHHHHHHCC
Q ss_conf             6989999999999999980998125999878787377429999999849998999999983000
Q gi|254780163|r   82 PTSSFQRVVQRAVLHVQSTGRGIVTGANILVALFSEPDSHATYFLQEQEMTLYDAVNFISHGIS  145 (798)
Q Consensus        82 ~S~~l~rVL~~A~~~A~~~G~~~I~~eHLLLALL~e~ds~a~~iL~~~gis~~~v~~~i~~~~~  145 (798)
                      +|..++++|..|...|...++++|+++|+|++|+..+++.  .++...|++...+...+...+.
T Consensus         2 ~~~~~~~~l~~a~~~a~~~~h~~~~~eHll~~ll~~~~~~--~~l~~~~~~~~~l~~~~~~~~~   63 (786)
T COG0542           2 LTERAQKALELAQELARMRRHEYVTPEHLLLALLDQPKGD--ELLNLCGIDLDKLRQELEEFID   63 (786)
T ss_pred             CCHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHCCCCHH--HHHHHCCCCHHHHHHHHHHHHH
T ss_conf             4889999999999999985798665999999997486317--9998749999999999999984


No 125
>KOG0731 consensus
Probab=99.02  E-value=2.5e-08  Score=78.95  Aligned_cols=158  Identities=26%  Similarity=0.388  Sum_probs=104.4

Q ss_pred             CHHHHHHHH---HHHHHHHHHH---------CCCCCCEEEECCCCCHHHHHHHHHHHHHHCCCCCHHHHEEEEEEEEHHH
Q ss_conf             112221789---9999999862---------2677874896676411668999999998548988345201445540467
Q gi|254780163|r  203 VDILVGRHE---EINRTIQILC---------RRSKNNPLYVGDPGVGKTAIAEGFAKQIVDGMVPDILLGARIFSLDMGN  270 (798)
Q Consensus       203 LDPVIGRd~---EI~riiqIL~---------RR~KNn~~lvG~~gvGktaive~la~~i~~~~vp~~l~~~~i~~ld~~~  270 (798)
                      ++-|-|-|+   ||+.++..|-         =|-=--++|+|+||+|||-++-..|-   +       .+.-+++.+..-
T Consensus       310 FkDVAG~deAK~El~E~V~fLKNP~~Y~~lGAKiPkGvLL~GPPGTGKTLLAKAiAG---E-------AgVPF~svSGSE  379 (774)
T KOG0731         310 FKDVAGVDEAKEELMEFVKFLKNPEQYQELGAKIPKGVLLVGPPGTGKTLLAKAIAG---E-------AGVPFFSVSGSE  379 (774)
T ss_pred             CCCCCCHHHHHHHHHHHHHHHCCHHHHHHCCCCCCCCEEEECCCCCCHHHHHHHHHC---C-------CCCCEEEECHHH
T ss_conf             010267089999999999984398999874776767517878999867899998853---0-------589646413378


Q ss_pred             HHCCCCCCCHHHHHHHHHHHHHCCCCCEEEEECCHHHHHCCCC---CCCCCCCHH---HHHHHHH----CCCCEEEEEEC
Q ss_conf             5306343123789999999872038983999736166301554---443447778---8887663----02660388730
Q gi|254780163|r  271 LIAGTRYRGDFEERIKKIVKEIESYANAILYIDEIHTLVGAGS---ASGISVDAS---NLLKPAL----SSGAVRCIGST  340 (798)
Q Consensus       271 l~ag~~~rg~fe~r~~~~~~~~~~~~~~ilfideih~ligag~---~~g~~~d~a---n~lkP~L----~rg~~~~Igat  340 (798)
                      ++..-.-.|  -.|++.+...++.+.+.|+|||||..+=+.-.   ..|+.-+..   |-|-+-|    ..+.+-++++|
T Consensus       380 FvE~~~g~~--asrvr~lf~~ar~~aP~iifideida~~~~r~G~~~~~~~~e~e~tlnQll~emDgf~~~~~vi~~a~t  457 (774)
T KOG0731         380 FVEMFVGVG--ASRVRDLFPLARKNAPSIIFIDEIDAVGRKRGGKGTGGGQDEREQTLNQLLVEMDGFETSKGVIVLAAT  457 (774)
T ss_pred             HHHHHCCCC--HHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHCCCCCCCCEEEEECC
T ss_conf             888760343--488899998743269807971454200312556666788807888999887875277677847998116


Q ss_pred             CHHHHHHHHHCCHHHHH--HCEE-EEECCCCHHHHHHHHH
Q ss_conf             48999998520111432--0014-4306878689999998
Q gi|254780163|r  341 TYSEYRQFFEKDKALVR--RFQK-IDVSEPSIEDAIEIVK  377 (798)
Q Consensus       341 T~~ey~~~~e~d~al~r--rF~~-i~v~ep~~~~~~~iL~  377 (798)
                      ---     =.-|+||-|  ||.. |.|+.|+...-..|+.
T Consensus       458 nr~-----d~ld~allrpGRfdr~i~i~~p~~~~r~~i~~  492 (774)
T KOG0731         458 NRP-----DILDPALLRPGRFDRQIQIDLPDVKGRASILK  492 (774)
T ss_pred             CCC-----CCCCHHHCCCCCCCCCEECCCCCHHHHHHHHH
T ss_conf             886-----64288764987555523246985141689999


No 126
>pfam05621 TniB Bacterial TniB protein. This family consists of several bacterial TniB NTP-binding proteins. TniB is a probable ATP-binding protein which is involved in Tn5053 mercury resistance transposition.
Probab=99.02  E-value=2e-08  Score=79.74  Aligned_cols=220  Identities=19%  Similarity=0.213  Sum_probs=130.2

Q ss_pred             HHHHHHHHHCCC---CCCEEEECCCCCHHHHHHHHHHHHHHCCCCCHHHHEEEEEEEEH------H----HHHC--CCCC
Q ss_conf             999999862267---78748966764116689999999985489883452014455404------6----7530--6343
Q gi|254780163|r  213 INRTIQILCRRS---KNNPLYVGDPGVGKTAIAEGFAKQIVDGMVPDILLGARIFSLDM------G----NLIA--GTRY  277 (798)
Q Consensus       213 I~riiqIL~RR~---KNn~~lvG~~gvGktaive~la~~i~~~~vp~~l~~~~i~~ld~------~----~l~a--g~~~  277 (798)
                      +.++-+.|.+-+   =-|-+|||++|.|||.|++.++..--...-++. ....|+.+.+      .    ++++  |+.|
T Consensus        46 L~~Le~Ll~~P~~~Rmp~lLlvGdsnnGKT~Iv~rF~~~hp~~~d~~~-~~~PVl~vq~P~~p~~~~lY~~IL~~l~aP~  124 (302)
T pfam05621        46 LNRLEALYAWPNKQRMPNLLLVGPTNNGKSMIVEKFRRAHPAGSDADQ-EHIPVLVVQMPSEPSVIRFYVALLAAMGAPL  124 (302)
T ss_pred             HHHHHHHHHCCCCCCCCCEEEEECCCCCHHHHHHHHHHHCCCCCCCCC-CCCEEEEEECCCCCCHHHHHHHHHHHHCCCC
T ss_conf             999999984686468875588707988789999999996799878666-7021899976999886899999999837877


Q ss_pred             C--CHHHHHHHHHHHHHCCCCCEEEEECCHHHHHCCCCCCCCCCCHHHHHHHHHCCCCEEEEEECCHHHHHHHHHCCHHH
Q ss_conf             1--23789999999872038983999736166301554443447778888766302660388730489999985201114
Q gi|254780163|r  278 R--GDFEERIKKIVKEIESYANAILYIDEIHTLVGAGSASGISVDASNLLKPALSSGAVRCIGSTTYSEYRQFFEKDKAL  355 (798)
Q Consensus       278 r--g~fe~r~~~~~~~~~~~~~~ilfideih~ligag~~~g~~~d~an~lkP~L~rg~~~~IgatT~~ey~~~~e~d~al  355 (798)
                      |  +.-.+.-..++.-++.-+--+|.|||+|+++ +|+... .-..-|.||=.--.-.|-++|+-|.+-|+ .|..|+-|
T Consensus       125 ~~~~~~~~~~~~~~~ll~~~~vrmLIIDEiHnlL-~Gs~~~-qr~~ln~LK~L~Nel~IpiV~vGt~eA~~-ai~tD~Ql  201 (302)
T pfam05621       125 RPRPRLPEMEQLALALLRKVGVRMLVIDELHNVL-AGNSVN-RREFLNLLRFLGNELRIPLVGVGTRDAYL-AIRSDDQL  201 (302)
T ss_pred             CCCCCHHHHHHHHHHHHHHCCCCEEEEECHHHHC-CCCHHH-HHHHHHHHHHHHHCCCCCEEEECCHHHHH-HHHCCHHH
T ss_conf             8887789999999999997498789985436560-486889-99999999998636587869953199999-97068888


Q ss_pred             HHHCEEEEECCCCHHHHHHHH-HHHHHHHHHHCCCEECCHHH-HHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             320014430687868999999-86127665410351211178-9999986542015556467988998653333211443
Q gi|254780163|r  356 VRRFQKIDVSEPSIEDAIEIV-KGIKPYFEEHHQLRYSKEAI-RAAVQLSVRHFTSRKLPDKAIDVIDEAGASQILQPLS  433 (798)
Q Consensus       356 ~rrF~~i~v~ep~~~~~~~iL-~~~~~~ye~~h~v~~~~~al-~~av~ls~ryi~~r~lPdkAidllDea~a~~~~~~~~  433 (798)
                      ++||+++.++.=..++.+..| ..+...+--...-.+.+..+ .....+|.=+      .+.-..||-+| |...+.   
T Consensus       202 asRF~~~~Lp~W~~d~ef~~LL~sfe~~LPL~~~S~L~~~~~a~~I~~~SeG~------iGei~~Ll~~a-A~~AI~---  271 (302)
T pfam05621       202 ENRFEPMLLPPWEANDDCCSLLASFAASLPLRRPSPIATLDMARYLLTRSEGT------IGELAHLLMAA-AIAAVE---  271 (302)
T ss_pred             HHHCCCCCCCCCCCCCHHHHHHHHHHHHCCCCCCCCCCCHHHHHHHHHHCCCC------HHHHHHHHHHH-HHHHHH---
T ss_conf             85058611688889808999999999868887776888899999999985992------87999999999-999984---


Q ss_pred             HHHCCCCHHHHHH
Q ss_conf             2211365789998
Q gi|254780163|r  434 KRRKFITEKDIKK  446 (798)
Q Consensus       434 ~~~~~~~~~~i~~  446 (798)
                      ..+..|+.+.+.+
T Consensus       272 sG~E~It~~~l~~  284 (302)
T pfam05621       272 SGEEAINHRTLSM  284 (302)
T ss_pred             CCCCCCCHHHHHH
T ss_conf             7871008999966


No 127
>TIGR01242 26Sp45 26S proteasome subunit P45 family; InterPro: IPR005937    Intracellular proteins, including short-lived proteins such as cyclin, Mos, Myc, p53, NF-kappaB, and IkappaB, are degraded by the ubiquitin-proteasome system. The 26S proteasome (a 2 MDa complex) is made up of two subcomplexes: the 20S proteasome and the regulatory complex. The former is a 700 kDa cylindrical protease complex consisting of four stacks of heptameric rings with 28 subunits (i.e., 7777) with molecular masses of about 20-35 kDa, whereas the latter is a 700-1000 kDa complex consisting of at least 18 subunits with molecular masses of 28-110 kDa, including 6 putative ATPases (Rpt1-Rpt6) and 12 non-ATPase subunits (Rpn1-12).     Members of the 26S proteasome subunit P45 family: ATPase p45/Sug1/Rpt6 may be phosphorylated within the proteasome. This phosphorylation event may play a key role in ATP-dependent proteolysis because a good correlation exists between the inhibition pattern of protein kinase inhibitors against the phosphorylation of p45 and that against the ATP-dependent proteolytic activity , .   More information about these protein can be found at Protein of the Month: AAA ATPases .; GO: 0016787 hydrolase activity, 0030163 protein catabolic process, 0005634 nucleus, 0005737 cytoplasm.
Probab=99.02  E-value=2.5e-09  Score=86.22  Aligned_cols=210  Identities=27%  Similarity=0.408  Sum_probs=110.1

Q ss_pred             HHHHHHHHHHHHHHCCCCC-------------CEEEECCCCCHHHHHHHHHHHHHHCCCCCHHHHEEEEEEEEHHHHHCC
Q ss_conf             1789999999986226778-------------748966764116689999999985489883452014455404675306
Q gi|254780163|r  208 GRHEEINRTIQILCRRSKN-------------NPLYVGDPGVGKTAIAEGFAKQIVDGMVPDILLGARIFSLDMGNLIAG  274 (798)
Q Consensus       208 GRd~EI~riiqIL~RR~KN-------------n~~lvG~~gvGktaive~la~~i~~~~vp~~l~~~~i~~ld~~~l~ag  274 (798)
                      |=++.|+.+-+...=-=|+             -++|-|+||.|||=++-.+|...          +.+++.+=.+-||  
T Consensus       126 GL~~Q~~E~~E~v~LPlk~PeLF~~vGI~PPKGvLLyGPPGtGKTLlAKAvA~et----------~ATFIrvVgSElV--  193 (364)
T TIGR01242       126 GLEKQIREIREAVELPLKKPELFEEVGIEPPKGVLLYGPPGTGKTLLAKAVAHET----------NATFIRVVGSELV--  193 (364)
T ss_pred             CHHHHHHHHHHHHHCCCCCCHHHHHCCCCCCCCEEEECCCCCCHHHHHHHHHCCC----------CCEEEEEEHHHHH--
T ss_conf             8789999998887346888316776288989865700757976889999863145----------5126886044444--


Q ss_pred             CCCCCHHHHHHHHHHHHHCCCCCEEEEECCHHHHHCCCCC-CCCCCC--HH----HH---HHHHHCCCCEEEEEECCHHH
Q ss_conf             3431237899999998720389839997361663015544-434477--78----88---87663026603887304899
Q gi|254780163|r  275 TRYRGDFEERIKKIVKEIESYANAILYIDEIHTLVGAGSA-SGISVD--AS----NL---LKPALSSGAVRCIGSTTYSE  344 (798)
Q Consensus       275 ~~~rg~fe~r~~~~~~~~~~~~~~ilfideih~ligag~~-~g~~~d--~a----n~---lkP~L~rg~~~~IgatT~~e  344 (798)
                      .||-||=-.-++.|+.-++...+.|+|||||-.| +|-.. +.++.|  +-    .+   |--.=+||++++||||---.
T Consensus       194 ~KyIGEGArLV~~~F~LAkEKaPsIiFIDEiDAi-aakR~~~~TsGdREV~RTlmQLLAElDGFd~rg~VkviaATNR~D  272 (364)
T TIGR01242       194 RKYIGEGARLVREVFELAKEKAPSIIFIDEIDAI-AAKRVDSSTSGDREVQRTLMQLLAELDGFDPRGNVKVIAATNRPD  272 (364)
T ss_pred             HHHHCCHHHHHHHHHHHHHCCCCCEEEEECHHHH-HHHHCCCCCCCCHHHHHHHHHHHHHHCCCCCCCCEEEEEECCCCH
T ss_conf             4441331689999999853069816861013335-432114677873157889999997524888767616887207620


Q ss_pred             HHHHHHCCHHHHH--HCEE-EEECCCCHHHHHHHHHHHHHHHHHHCCCEECC-HHHHHHHHHHHHHCCCCCCHHHHHHHH
Q ss_conf             9998520111432--0014-43068786899999986127665410351211-178999998654201555646798899
Q gi|254780163|r  345 YRQFFEKDKALVR--RFQK-IDVSEPSIEDAIEIVKGIKPYFEEHHQLRYSK-EAIRAAVQLSVRHFTSRKLPDKAIDVI  420 (798)
Q Consensus       345 y~~~~e~d~al~r--rF~~-i~v~ep~~~~~~~iL~~~~~~ye~~h~v~~~~-~al~~av~ls~ryi~~r~lPdkAidll  420 (798)
                           ==|||+-|  ||.+ |.|+-|+.+--++||+--..      +..... =-++..+++..=. ++--|  |||-. 
T Consensus       273 -----ilDPA~LRPGRFDR~IEVPlP~~~GR~eIlkiHTr------~~~la~dVdl~~~A~~TeG~-sGAdl--KAi~t-  337 (364)
T TIGR01242       273 -----ILDPAILRPGRFDRIIEVPLPDFEGRLEILKIHTR------KMKLAEDVDLEAIAKLTEGA-SGADL--KAICT-  337 (364)
T ss_pred             -----HCCCCCCCCCCCCCEEECCCCCCCCHHHHHHHHHC------CCCCCCCCCHHHHHHHHCCC-CCCHH--HHHHH-
T ss_conf             -----20432148886132573169783220566555210------00012356879999874788-66304--23434-


Q ss_pred             HHHHHHHHHHHHHHHHCCCCHHHHHHHHHH
Q ss_conf             865333321144322113657899986631
Q gi|254780163|r  421 DEAGASQILQPLSKRRKFITEKDIKKTIAS  450 (798)
Q Consensus       421 Dea~a~~~~~~~~~~~~~~~~~~i~~~~~~  450 (798)
                       ||    -+.+....+..||..|....|.+
T Consensus       338 -EA----G~~AIR~~r~~vT~~Df~kAv~K  362 (364)
T TIGR01242       338 -EA----GMFAIREERDYVTMDDFLKAVEK  362 (364)
T ss_pred             -HH----HHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             -62----04777744567669999999873


No 128
>TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily. Members of this protein are marked as probable ATPases by the nucleotide binding P-loop motif GXXGXGKTT, a motif DEAQ similar to the DEAD/H box of helicases, and extensive homology to ATPases of MSHA-type pilus systems and to GspA proteins associated with type II protein secretion systems.
Probab=99.01  E-value=6.9e-08  Score=75.85  Aligned_cols=223  Identities=17%  Similarity=0.204  Sum_probs=135.5

Q ss_pred             HHHHHHHHHHHHHCCCCCCEEEECCCCCHHHHHHHHHHHHHHCCCCCH-HHHEEEEEEEEHHHHHC---CCCCCCH----
Q ss_conf             789999999986226778748966764116689999999985489883-45201445540467530---6343123----
Q gi|254780163|r  209 RHEEINRTIQILCRRSKNNPLYVGDPGVGKTAIAEGFAKQIVDGMVPD-ILLGARIFSLDMGNLIA---GTRYRGD----  280 (798)
Q Consensus       209 Rd~EI~riiqIL~RR~KNn~~lvG~~gvGktaive~la~~i~~~~vp~-~l~~~~i~~ld~~~l~a---g~~~rg~----  280 (798)
                      .-+|.-..++-..+.++.-.+++||+|+|||.+...|+..+-...+.. .+.+..+=.-++-..++   |..+.+.    
T Consensus        27 ~h~~al~~L~~~l~~~~g~~lltGe~GtGKTtllr~l~~~l~~~~~~~~~i~~~~l~~~~ll~~i~~~lg~~~~~~~~~~  106 (269)
T TIGR03015        27 GHKRAMAYLEYGLSQREGFILITGEVGAGKTTLIRNLLKRLDQERVVAAKLVNTRVDAEDLLRMVAADFGLETEGRDKAA  106 (269)
T ss_pred             HHHHHHHHHHHHHHCCCCEEEEECCCCCCHHHHHHHHHHHCCCCCEEEEEECCCCCCHHHHHHHHHHHCCCCCCCCCHHH
T ss_conf             69999999999996489659997299898899999999845934548999769999999999999998598988989999


Q ss_pred             HHHHHHHHHHHHCCC-CCEEEEECCHHHHHCCCCCCCCCCCHHHHHHHH----HC-CCCEEEEEECCHHHHHHHHHC--C
Q ss_conf             789999999872038-983999736166301554443447778888766----30-266038873048999998520--1
Q gi|254780163|r  281 FEERIKKIVKEIESY-ANAILYIDEIHTLVGAGSASGISVDASNLLKPA----LS-SGAVRCIGSTTYSEYRQFFEK--D  352 (798)
Q Consensus       281 fe~r~~~~~~~~~~~-~~~ilfideih~ligag~~~g~~~d~an~lkP~----L~-rg~~~~IgatT~~ey~~~~e~--d  352 (798)
                      +-..+...+.+.... ..++|.|||.|++         +.|+-+-|+=.    .. ..-+++|-.-.+ |.+..+..  -
T Consensus       107 ~~~~l~~~L~~~~~~g~~~vliIDEAq~L---------~~~~Le~Lr~L~n~e~~~~~ll~iiL~Gqp-eL~~~L~~~~~  176 (269)
T TIGR03015       107 LLRELEDFLIEQFAAGKRALLVVDEAQNL---------TPELLEELRMLSNFQTDNAKLLQIFLVGQP-EFRETLQSPQL  176 (269)
T ss_pred             HHHHHHHHHHHHHHCCCCEEEEEECHHHC---------CHHHHHHHHHHHCCCCCCCCCEEEEEECCH-HHHHHHCCCCH
T ss_conf             99999999999996699469997242219---------999999999997013588870489995786-79998727402


Q ss_pred             HHHHHHC-EEEEECCCCHHHHHHHHHHHHHHHHHHCCCEECCHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHH
Q ss_conf             1143200-144306878689999998612766541035121117899999865420155564679889986533332114
Q gi|254780163|r  353 KALVRRF-QKIDVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLPDKAIDVIDEAGASQILQP  431 (798)
Q Consensus       353 ~al~rrF-~~i~v~ep~~~~~~~iL~~~~~~ye~~h~v~~~~~al~~av~ls~ryi~~r~lPdkAidllDea~a~~~~~~  431 (798)
                      +.|..|- ....+...|.++|...++.--..-...+..-++++|+....+.|.=+      |.+--    ..|-..-+..
T Consensus       177 ~~l~qRI~~~~~L~pl~~eet~~YI~~RL~~AG~~~~~~Ft~~A~~~I~~~S~G~------PR~IN----~Lc~~aLl~a  246 (269)
T TIGR03015       177 QQLRQRIIASCHLGPLDREETREYIEHRLERAGNRDAPVFSEGAFDAIHRFSRGI------PRLIN----ILCDRLLLSA  246 (269)
T ss_pred             HHHHHCEEEEEEECCCCHHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHHCCCC------HHHHH----HHHHHHHHHH
T ss_conf             5455507679984799989999999999986699999985999999999986990------08999----9999999999


Q ss_pred             HHHHHCCCCHHHHHHHHHHC
Q ss_conf             43221136578999866310
Q gi|254780163|r  432 LSKRRKFITEKDIKKTIASM  451 (798)
Q Consensus       432 ~~~~~~~~~~~~i~~~~~~~  451 (798)
                      ..+.++.|+.+.|..++..+
T Consensus       247 ~~~~~~~I~~~~v~~~~~el  266 (269)
T TIGR03015       247 FLEEKREIGGEEVREVIAEI  266 (269)
T ss_pred             HHHCCCCCCHHHHHHHHHHH
T ss_conf             99488867999999999976


No 129
>PRK09111 DNA polymerase III subunits gamma and tau; Validated
Probab=99.01  E-value=1.2e-08  Score=81.23  Aligned_cols=211  Identities=21%  Similarity=0.254  Sum_probs=138.1

Q ss_pred             HHHCCCCHHHHHHHHHHHHHHHHHHCCCCCC-EEEECCCCCHHHHHHHHHHHHHHCCC-----CC--HH-----------
Q ss_conf             7754861122217899999999862267787-48966764116689999999985489-----88--34-----------
Q gi|254780163|r  197 KVKKGKVDILVGRHEEINRTIQILCRRSKNN-PLYVGDPGVGKTAIAEGFAKQIVDGM-----VP--DI-----------  257 (798)
Q Consensus       197 ~AreGKLDPVIGRd~EI~riiqIL~RR~KNn-~~lvG~~gvGktaive~la~~i~~~~-----vp--~~-----------  257 (798)
                      +-|--.++-|||-|.-++-+..-+..-+=.+ -++.|.-|||||+++.-||.-+.-..     -|  +.           
T Consensus        16 k~rp~~f~~~~gq~~~~~~l~~~~~~~~~~~a~l~~g~rg~gktt~ari~a~~lnc~~~~~~~~~~~~~c~~c~~c~~i~   95 (600)
T PRK09111         16 KYRPQTFDDLIGQEAMVRTLRNAFETGRIAQAFMLTGVRGVGKTTTARILARALNYKGPDGVGGPTIDPCGVGEHCQAIM   95 (600)
T ss_pred             CCCCCCHHHHCCCHHHHHHHHHHHHCCCCCCEEEEECCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCHHHHHHH
T ss_conf             01798776633859999999999972984204764578987899999999999669887666899889899886589886


Q ss_pred             -HHEEEEEEEEHHHHHCCCCCCCHHHHHHHHHHHHHCCC---CC-EEEEECCHHHHHCCCCCCCCCCCHHHHHHHHHC--
Q ss_conf             -52014455404675306343123789999999872038---98-399973616630155444344777888876630--
Q gi|254780163|r  258 -LLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIESY---AN-AILYIDEIHTLVGAGSASGISVDASNLLKPALS--  330 (798)
Q Consensus       258 -l~~~~i~~ld~~~l~ag~~~rg~fe~r~~~~~~~~~~~---~~-~ilfideih~ligag~~~g~~~d~an~lkP~L~--  330 (798)
                       =+..-++++|.+      +.+|-  +-++.+++.+.-.   +. -|.-|||+|+|         |-.|-|-|.--|.  
T Consensus        96 ~~~~~d~~e~daa------s~~~v--~~~r~~~~~~~~~p~~~~~kv~iidevhml---------s~~afnallktleep  158 (600)
T PRK09111         96 EGRHVDVIEMDAA------SHTGV--DDIREIIESVRYRPVSARYKVYIIDEVHML---------STAAFNALLKTLEEP  158 (600)
T ss_pred             CCCCCCEEEEECC------CCCCH--HHHHHHHHHHCCCCCCCCEEEEEEECCCCC---------CHHHHHHHHHHHHCC
T ss_conf             6899875885155------45788--899999986053887775469996001105---------799999999876259


Q ss_pred             CCCEEEEEECCHHHHHHHHHCCH-HHHHHCEEEEECCCCHHHHHHHHHHHHHHHHHHCCCEECCHHHHHHHHHHHHHCCC
Q ss_conf             26603887304899999852011-14320014430687868999999861276654103512111789999986542015
Q gi|254780163|r  331 SGAVRCIGSTTYSEYRQFFEKDK-ALVRRFQKIDVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTS  409 (798)
Q Consensus       331 rg~~~~IgatT~~ey~~~~e~d~-al~rrF~~i~v~ep~~~~~~~iL~~~~~~ye~~h~v~~~~~al~~av~ls~ryi~~  409 (798)
                      -.-+.+|=|||.  .+|    =| ..-.|-|.-...--+.++-..-|..+..    .-++.+.++||...++.|.-=+.|
T Consensus       159 p~~~~fi~att~--~~k----~p~ti~src~~f~~~~~~~~~~~~~l~~i~~----~e~~~~~~~al~~ia~~a~GS~RD  228 (600)
T PRK09111        159 PPHVKFIFATTE--IRK----VPVTVLSRCQRFDLRRIEAEVLAAHLARIAE----KEGVEVEPDALALIARAAEGSVRD  228 (600)
T ss_pred             CCCEEEEEECCC--HHH----CCHHHHHHHHEECCCCCCHHHHHHHHHHHHH----HCCCCCCHHHHHHHHHHCCCCCCH
T ss_conf             865499996285--343----7589985441201057999999999999998----607686677999999974898421


Q ss_pred             CCCHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHH
Q ss_conf             556467988998653333211443221136578999866
Q gi|254780163|r  410 RKLPDKAIDVIDEAGASQILQPLSKRRKFITEKDIKKTI  448 (798)
Q Consensus       410 r~lPdkAidllDea~a~~~~~~~~~~~~~~~~~~i~~~~  448 (798)
                            |..|||.|-|.        ....|+..+|.+++
T Consensus       229 ------aLSlLDQai~~--------~~~~i~~~~v~~mL  253 (600)
T PRK09111        229 ------GLSLLDQAIAH--------GAGEVTAEQVRDML  253 (600)
T ss_pred             ------HHHHHHHHHHC--------CCCCCCHHHHHHHH
T ss_conf             ------89999999972--------79875699999986


No 130
>TIGR01241 FtsH_fam ATP-dependent metallopeptidase HflB; InterPro: IPR005936   Metalloproteases are the most diverse of the four main types of protease, with more than 50 families identified to date. In these enzymes, a divalent cation, usually zinc, activates the water molecule. The metal ion is held in place by amino acid ligands, usually three in number. The known metal ligands are His, Glu, Asp or Lys and at least one other residue is required for catalysis, which may play an electrophillic role. Of the known metalloproteases, around half contain an HEXXH motif, which has been shown in crystallographic studies to form part of the metal-binding site . The HEXXH motif is relatively common, but can be more stringently defined for metalloproteases as 'abXHEbbHbc', where 'a' is most often valine or threonine and forms part of the S1' subsite in thermolysin and neprilysin, 'b' is an uncharged residue, and 'c' a hydrophobic residue. Proline is never found in this site, possibly because it would break the helical structure adopted by this motif in metalloproteases .   Peptidases are grouped into clans and families. Clans are groups of families for which there is evidence of common ancestry. Each clan is identified with two letters, the first representing the catalytic type of the families included in the clan (with the letter 'P' being used for a clan containing families of more than one of the catalytic types serine, threonine and cysteine). Some families cannot yet be assigned to clans, and when a formal assignment is required, such a family is described as belonging to clan A-, C-, M-, S-, T- or U-, according to the catalytic type. Some clans are divided into subclans because there is evidence of a very ancient divergence within the clan, for example MA(E), the gluzincins, and MA(M), the metzincins.   Families are grouped by their catalytic type, the first character representing the catalytic type: A, aspartic; C, cysteine; G, glutamic acid; M, metallo; S, serine; T, threonine; and U, unknown. The serine, threonine and cysteine peptidases utilise the amino acid as a nucleophile and form an acyl intermediate - these peptidases can also readily act as transferases. In the case of aspartic, glutamic and metallopeptidases, the nucleophile is an activated water molecule.    This group of metallopeptidases belong to MEROPS peptidase family M41 (FtsH endopeptidase family, clan MA(E)). The predicted active site residues for members of this family and thermolysin, the type example for clan MA, occur in the motif HEXXH.    FtsH is a membrane-anchored ATP-dependent protease that degrades misfolded or misassembled membrane proteins as well as a subset of cytoplasmic regulatory proteins. FtsH is a 647-residue protein of 70 kDa, with two putative transmembrane segments towards its N terminus which anchor the protein to the membrane, giving rise to a periplasmic domain of 70 residues and a cytoplasmic segment of 520 residues containing the ATPase and protease domains . ; GO: 0004222 metalloendopeptidase activity, 0030163 protein catabolic process, 0016020 membrane.
Probab=99.00  E-value=3.2e-10  Score=92.60  Aligned_cols=161  Identities=27%  Similarity=0.417  Sum_probs=109.8

Q ss_pred             HHHHCHHHHHHHHHHHHHHHHCCCCCCCC--------CCCEEEEECCCCHHHHHHHHHHHHHCCCCEEEEEHHHHHCCCC
Q ss_conf             66534589999999998775204456578--------7406886143200388999998730477337720688612465
Q gi|254780163|r  477 TVVYGQEEAIKKLSSSIKIARAGLSDPNK--------PIGCYVFSGPTGVGKTEISKQLAFALGVQLLRFDMSEYMERHA  548 (798)
Q Consensus       477 ~~v~GQ~~ai~~v~~~i~~~~~gl~~~~r--------P~g~flf~GptGvGKTelak~la~~~~~~lir~dmsey~e~~~  548 (798)
                      +=|-|+|||.+.|.+-|--    |++|+|        |-|++| +||+|+|||.||||.|=.=+.+|.++==|||-|   
T Consensus        59 ~DVAG~dEAKeEl~EiVdF----LK~P~kf~~LGaKIPKGVLL-vGPPGTGKTLLAKAvAGEA~VPFF~iSGSdFVE---  130 (505)
T TIGR01241        59 KDVAGIDEAKEELVEIVDF----LKNPSKFTKLGAKIPKGVLL-VGPPGTGKTLLAKAVAGEAGVPFFSISGSDFVE---  130 (505)
T ss_pred             CCCCCCHHHHHHHHHHHHH----CCCCHHHHHCCCCCCCCEEE-ECCCCCCHHHHHHHHHCCCCCCCEEECCCCEEE---
T ss_conf             3444532333433313422----26963798727889871473-178784246788752025889624740761011---


Q ss_pred             CCHHCCCCCHHCCCCCCC--CCCHHHHHCCCEEEEECCHHH------------CCHHHHHHHHHHHH--HHHCCCCCCCE
Q ss_conf             301104780002564443--100355515851777404455------------02899999999877--75021779977
Q gi|254780163|r  549 VSRLIGAPPGYVGFGQGG--ILADSVDQNPYSVVLLDEIEK------------SHPDVLNILLQIMD--YGILTDQSGKK  612 (798)
Q Consensus       549 vs~LiGappGYvG~~egg--~Lte~vr~~P~sVvl~DEiEK------------Ah~~v~~~llqild--~G~ltd~~Gr~  612 (798)
                        .++|     ||  -.=  =|.|.=|++-=|+|+.|||+-            +|-+.=+.|=|+|=  ||.=+ +.   
T Consensus       131 --MFVG-----VG--ASRVRDLFeqAK~nAPCIIFIDEIDAVGr~RGaG~lGGGnDEREQTLNQLLVEMDGF~~-~~---  197 (505)
T TIGR01241       131 --MFVG-----VG--ASRVRDLFEQAKKNAPCIIFIDEIDAVGRQRGAGELGGGNDEREQTLNQLLVEMDGFGT-NT---  197 (505)
T ss_pred             --CCCC-----CC--CEEHHHHHHHHHHHCCCEEEEECHHHCCCCCCCCCCCCCCCHHHHHHHHHHEECCCCCC-CC---
T ss_conf             --1205-----64--00014457999971897056401000033356436676541355433233133178589-88---


Q ss_pred             ECCCCEEEEEECCCCHHHHHHCCCCCCCCCCHHHHHHHHHHHCCHHHHCCCCEEEECCCCCHHHHHHHHHHHH
Q ss_conf             6125429999424214553303689882111488999998728878817768289628899999999999999
Q gi|254780163|r  613 ISFRNVILIMTTNAGALEMSKARIGFGSSRNDDADKEALRNFLSPEFLNRLDSIIPFFPLSSDIIRQVVHKFI  685 (798)
Q Consensus       613 vdf~n~iii~TsN~G~~~~~~~~~g~~~~~~~~~~~~~l~~~f~peflnRid~ii~F~~l~~~~~~~i~~~~l  685 (798)
                          +.|||--||       |           .++.+  ..-.||   +|+|.=|+=+.=+-.--.+|+..++
T Consensus       198 ----gvIv~AATN-------R-----------PDvLD--~ALLRP---GRFDRQv~V~~PD~~GR~~IL~VH~  243 (505)
T TIGR01241       198 ----GVIVIAATN-------R-----------PDVLD--PALLRP---GRFDRQVVVDLPDIKGREEILKVHA  243 (505)
T ss_pred             ----CEEEEEECC-------C-----------CCCCC--CCCCCC---CCCCCEEECCCCCHHHHHHHHHHHH
T ss_conf             ----579985048-------8-----------41165--100687---8744513458887467899999985


No 131
>PRK07270 DNA polymerase III subunits gamma and tau; Validated
Probab=98.98  E-value=1.5e-07  Score=73.36  Aligned_cols=36  Identities=11%  Similarity=0.372  Sum_probs=17.0

Q ss_pred             HEEEEEEEEHHHHHCCCCCCCHHHHHHHHHHHHHCCCCCEEEEE
Q ss_conf             20144554046753063431237899999998720389839997
Q gi|254780163|r  259 LGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIESYANAILYI  302 (798)
Q Consensus       259 ~~~~i~~ld~~~l~ag~~~rg~fe~r~~~~~~~~~~~~~~ilfi  302 (798)
                      ..++||-+|-.-++..        +-..++++-++..+.-++||
T Consensus       117 ~~yKV~IIDEah~Ls~--------~A~NALLKtLEEPP~~~vFI  152 (557)
T PRK07270        117 ATYKVYIIDEVHMLST--------GAFNALLKTLEEPTENVVFI  152 (557)
T ss_pred             CCEEEEEECCHHHCCH--------HHHHHHHHHHHCCCCCEEEE
T ss_conf             8838999714453499--------99998999852899876999


No 132
>COG2255 RuvB Holliday junction resolvasome, helicase subunit [DNA replication, recombination, and repair]
Probab=98.98  E-value=9.9e-08  Score=74.72  Aligned_cols=175  Identities=28%  Similarity=0.396  Sum_probs=103.4

Q ss_pred             CHHHHHHHHHHHHHHHHH---HCCCCC---CEEEECCCCCHHHHHHHHHHHHHHCCCCCHHHHEEEEEEEEHHHHHCCCC
Q ss_conf             112221789999999986---226778---74896676411668999999998548988345201445540467530634
Q gi|254780163|r  203 VDILVGRHEEINRTIQIL---CRRSKN---NPLYVGDPGVGKTAIAEGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTR  276 (798)
Q Consensus       203 LDPVIGRd~EI~riiqIL---~RR~KN---n~~lvG~~gvGktaive~la~~i~~~~vp~~l~~~~i~~ld~~~l~ag~~  276 (798)
                      ++-.||-++-.++ ++|.   ++.++.   ..+|.|+||.|||+++.=+|.-+-.        |.++-+  ...| .-  
T Consensus        25 l~efiGQ~~vk~~-L~ifI~AAk~r~e~lDHvLl~GPPGlGKTTLA~IIA~Emgv--------n~k~ts--Gp~l-eK--   90 (332)
T COG2255          25 LDEFIGQEKVKEQ-LQIFIKAAKKRGEALDHVLLFGPPGLGKTTLAHIIANELGV--------NLKITS--GPAL-EK--   90 (332)
T ss_pred             HHHHCCHHHHHHH-HHHHHHHHHHCCCCCCEEEEECCCCCCHHHHHHHHHHHHCC--------CEEECC--CCCC-CC--
T ss_conf             8885183999999-99999999844987674786479987688899999998567--------737636--6201-57--


Q ss_pred             CCCHHHHHHHHHHHHHCCCCCEEEEECCHHHHHCCCCCCCCCCCHHHHHHHHHCC--------------------CCEEE
Q ss_conf             3123789999999872038983999736166301554443447778888766302--------------------66038
Q gi|254780163|r  277 YRGDFEERIKKIVKEIESYANAILYIDEIHTLVGAGSASGISVDASNLLKPALSS--------------------GAVRC  336 (798)
Q Consensus       277 ~rg~fe~r~~~~~~~~~~~~~~ilfideih~ligag~~~g~~~d~an~lkP~L~r--------------------g~~~~  336 (798)
                       -|+    +-+++..++  ++-||||||||-+         +.-+-.+|-|+|.-                    --+..
T Consensus        91 -~gD----laaiLt~Le--~~DVLFIDEIHrl---------~~~vEE~LYpaMEDf~lDI~IG~gp~Arsv~ldLppFTL  154 (332)
T COG2255          91 -PGD----LAAILTNLE--EGDVLFIDEIHRL---------SPAVEEVLYPAMEDFRLDIIIGKGPAARSIRLDLPPFTL  154 (332)
T ss_pred             -HHH----HHHHHHCCC--CCCEEEEEHHHHC---------CHHHHHHHHHHHHHEEEEEEECCCCCCCEEECCCCCEEE
T ss_conf             -265----999986398--6776777255314---------742898964675310577897248755347637998137


Q ss_pred             EEECCHHHHHHHHHCCHHHHHHCEE-EEECCCCHHHHHHHHHHHHHHHHHHCCCEECCHHHHHHHHHHHHHCCCCCCHHH
Q ss_conf             8730489999985201114320014-430687868999999861276654103512111789999986542015556467
Q gi|254780163|r  337 IGSTTYSEYRQFFEKDKALVRRFQK-IDVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLPDK  415 (798)
Q Consensus       337 IgatT~~ey~~~~e~d~al~rrF~~-i~v~ep~~~~~~~iL~~~~~~ye~~h~v~~~~~al~~av~ls~ryi~~r~lPdk  415 (798)
                      |||||-..-    = -.-|..||-. .+++--++++--.|+.    ++-..-++.+++++.....+-|      |--|.=
T Consensus       155 IGATTr~G~----l-t~PLrdRFGi~~rlefY~~~eL~~Iv~----r~a~~l~i~i~~~~a~eIA~rS------RGTPRI  219 (332)
T COG2255         155 IGATTRAGM----L-TNPLRDRFGIIQRLEFYTVEELEEIVK----RSAKILGIEIDEEAALEIARRS------RGTPRI  219 (332)
T ss_pred             EEECCCCCC----C-CCHHHHHCCCEEEEECCCHHHHHHHHH----HHHHHHCCCCCHHHHHHHHHHC------CCCCHH
T ss_conf             510134664----5-633688628604540588899999999----8888738776857999999863------699389


Q ss_pred             HHHHHHH
Q ss_conf             9889986
Q gi|254780163|r  416 AIDVIDE  422 (798)
Q Consensus       416 AidllDe  422 (798)
                      |..||..
T Consensus       220 AnRLLrR  226 (332)
T COG2255         220 ANRLLRR  226 (332)
T ss_pred             HHHHHHH
T ss_conf             9999999


No 133
>COG0465 HflB ATP-dependent Zn proteases [Posttranslational modification, protein turnover, chaperones]
Probab=98.97  E-value=2.7e-08  Score=78.82  Aligned_cols=339  Identities=21%  Similarity=0.259  Sum_probs=176.8

Q ss_pred             CCHHHHHHHHHHHHHHHHHHC------------CCCCCEEEECCCCCHHHHHHHHHHHHHHCCCCCHHHHEEEEEEEEHH
Q ss_conf             611222178999999998622------------67787489667641166899999999854898834520144554046
Q gi|254780163|r  202 KVDILVGRHEEINRTIQILCR------------RSKNNPLYVGDPGVGKTAIAEGFAKQIVDGMVPDILLGARIFSLDMG  269 (798)
Q Consensus       202 KLDPVIGRd~EI~riiqIL~R------------R~KNn~~lvG~~gvGktaive~la~~i~~~~vp~~l~~~~i~~ld~~  269 (798)
                      +++-|.|.|+..+.+.+++.=            |-=--++|+|+||.|||-++...|-   +-+||       .++.+..
T Consensus       148 ~F~DVAG~dEakeel~EiVdfLk~p~ky~~lGakiPkGvlLvGpPGTGKTLLAkAvAg---EA~VP-------Ff~iSGS  217 (596)
T COG0465         148 TFADVAGVDEAKEELSELVDFLKNPKKYQALGAKIPKGVLLVGPPGTGKTLLAKAVAG---EAGVP-------FFSISGS  217 (596)
T ss_pred             CHHHHCCCHHHHHHHHHHHHHHHCCHHHHHCCCCCCCCEEEECCCCCCCHHHHHHHHC---CCCCC-------CEECCCH
T ss_conf             7566418679999999999986385566752353456526855999872789999845---46898-------3530344


Q ss_pred             HHHCCCCCCCHHHHHHHHHHHHHCCCCCEEEEECCHHHHHCC-CCCCCCCCCH----HHHHHHHH----CCCCEEEEEEC
Q ss_conf             753063431237899999998720389839997361663015-5444344777----88887663----02660388730
Q gi|254780163|r  270 NLIAGTRYRGDFEERIKKIVKEIESYANAILYIDEIHTLVGA-GSASGISVDA----SNLLKPAL----SSGAVRCIGST  340 (798)
Q Consensus       270 ~l~ag~~~rg~fe~r~~~~~~~~~~~~~~ilfideih~liga-g~~~g~~~d~----an~lkP~L----~rg~~~~Igat  340 (798)
                      ..|-  .|.|-=-.|.+.+..+++++.+.|+|||||-.+--. |.+.|++-|-    .|-|.--+    ++..+-+|+||
T Consensus       218 ~FVe--mfVGvGAsRVRdLF~qAkk~aP~IIFIDEiDAvGr~Rg~g~GggnderEQTLNQlLvEmDGF~~~~gviviaaT  295 (596)
T COG0465         218 DFVE--MFVGVGASRVRDLFEQAKKNAPCIIFIDEIDAVGRQRGAGLGGGNDEREQTLNQLLVEMDGFGGNEGVIVIAAT  295 (596)
T ss_pred             HHHH--HHCCCCCHHHHHHHHHHHCCCCCEEEEEHHHHCCCCCCCCCCCCCHHHHHHHHHHHHHHCCCCCCCCEEEECCC
T ss_conf             4644--31478838889999985515996698763433145457788998069999998888520157888754885267


Q ss_pred             CHHHHHHHHHCCHHHHH--HC-EEEEECCCCHHHHHHHHHHHHHHHHHHCCCEECCHHHHHHHHHHHHHCCCCCCHHHHH
Q ss_conf             48999998520111432--00-1443068786899999986127665410351211178999998654201555646798
Q gi|254780163|r  341 TYSEYRQFFEKDKALVR--RF-QKIDVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLPDKAI  417 (798)
Q Consensus       341 T~~ey~~~~e~d~al~r--rF-~~i~v~ep~~~~~~~iL~~~~~~ye~~h~v~~~~~al~~av~ls~ryi~~r~lPdkAi  417 (798)
                      -..+     =-|+||-|  || ..|.|+-|+...--.||+-- .+     ++.+.++.=-..   .+|=-|+..- ..=.
T Consensus       296 NRpd-----VlD~ALlRpgRFDRqI~V~~PDi~gRe~IlkvH-~~-----~~~l~~~V~l~~---iAr~tpGfsG-AdL~  360 (596)
T COG0465         296 NRPD-----VLDPALLRPGRFDRQILVELPDIKGREQILKVH-AK-----NKPLAEDVDLKK---IARGTPGFSG-ADLA  360 (596)
T ss_pred             CCCC-----CCHHHHCCCCCCCEEEECCCCCHHHHHHHHHHH-HH-----CCCCCCCCCHHH---HHHHCCCCCC-CHHH
T ss_conf             8743-----331765288776625544785156578887886-41-----577776678889---8643778563-0676


Q ss_pred             HHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHCCCCCCHHHHHCCHHHHHHHHCCHHHHHHHCHHHHHHHHHHHHHHHH
Q ss_conf             89986533332114432211365789998663102453101110011233421000024665345899999999987752
Q gi|254780163|r  418 DVIDEAGASQILQPLSKRRKFITEKDIKKTIASMNRSIHTTSFSRDDDSVLSNLEKNLGTVVYGQEEAIKKLSSSIKIAR  497 (798)
Q Consensus       418 dllDea~a~~~~~~~~~~~~~~~~~~i~~~~~~~~~gip~~~~~~~~~~~l~~l~~~l~~~v~GQ~~ai~~v~~~i~~~~  497 (798)
                      .++.||+    +.+....+..|+..|+.+.+.+..-|-+-....-.+.++          +++--.+|.-+++....   
T Consensus       361 nl~NEAa----l~aar~n~~~i~~~~i~ea~drv~~G~erks~vise~ek----------~~~AYhEaghalv~~~l---  423 (596)
T COG0465         361 NLLNEAA----LLAARRNKKEITMRDIEEAIDRVIAGPERKSRVISEAEK----------KITAYHEAGHALVGLLL---  423 (596)
T ss_pred             HHHHHHH----HHHHHHCCEEEECCCHHHHHHHHHCCCCCCCCCCCHHHC----------CCHHHHHHHHHHHHHHC---
T ss_conf             5566889----999883684675345388999996587768864674540----------32578899999999727---


Q ss_pred             CCCCCCCCCCCEEEEECCCCHHHHHHHHHHHHHCCCCE-EEEEHHHHHCCCCCCHHCCCCCHHCCCCCCCCCCHHHHHCC
Q ss_conf             04456578740688614320038899999873047733-77206886124653011047800025644431003555158
Q gi|254780163|r  498 AGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFALGVQL-LRFDMSEYMERHAVSRLIGAPPGYVGFGQGGILADSVDQNP  576 (798)
Q Consensus       498 ~gl~~~~rP~g~flf~GptGvGKTelak~la~~~~~~l-ir~dmsey~e~~~vs~LiGappGYvG~~egg~Lte~vr~~P  576 (798)
                          +...|+ .-...=|.|       .+|.+...-+- .++-||.-.-.+.+.-+.|           |...|-+.-.+
T Consensus       424 ----~~~d~v-~KvtIiPrG-------~alG~t~~~Pe~d~~l~sk~~l~~~i~~~lg-----------GRaAEel~~g~  480 (596)
T COG0465         424 ----PDADPV-HKVTIIPRG-------RALGYTLFLPEEDKYLMSKEELLDRIDVLLG-----------GRAAEELIFGY  480 (596)
T ss_pred             ----CCCCCC-CEEEECCCC-------HHHCCEECCCCCCCCCCCHHHHHHHHHHHHC-----------CCHHHHHHHCC
T ss_conf             ----887620-035522672-------2201100388545320127788879999866-----------71766646244


Q ss_pred             CEEEEE--CCHHHCCHHHHHHHHHHHHHHHCCCCCCCE
Q ss_conf             517774--044550289999999987775021779977
Q gi|254780163|r  577 YSVVLL--DEIEKSHPDVLNILLQIMDYGILTDQSGKK  612 (798)
Q Consensus       577 ~sVvl~--DEiEKAh~~v~~~llqild~G~ltd~~Gr~  612 (798)
                       .+--.  +.+    +...++...+..+.-+.+-.|..
T Consensus       481 -e~ttGa~~D~----~~at~~ar~mVt~~Gms~~lG~v  513 (596)
T COG0465         481 -EITTGASNDL----EKATDLARAMVTEYGMSAKLGPV  513 (596)
T ss_pred             -CCCCCCHHHH----HHHHHHHHHHHHHCCCCHHHCCE
T ss_conf             -5013521318----99999999853351852653651


No 134
>PRK06305 DNA polymerase III subunits gamma and tau; Validated
Probab=98.97  E-value=5.8e-07  Score=69.18  Aligned_cols=128  Identities=23%  Similarity=0.376  Sum_probs=81.7

Q ss_pred             HHHHCHHHHHHHHHHHHHHHHCCCCCCCCCCCEEEEECCCCHHHHHHHHHHHHHCC--C---C----EEEEEHHHHHCCC
Q ss_conf             66534589999999998775204456578740688614320038899999873047--7---3----3772068861246
Q gi|254780163|r  477 TVVYGQEEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFALG--V---Q----LLRFDMSEYMERH  547 (798)
Q Consensus       477 ~~v~GQ~~ai~~v~~~i~~~~~gl~~~~rP~g~flf~GptGvGKTelak~la~~~~--~---~----lir~dmsey~e~~  547 (798)
                      ..||||++++..+.+++...|.        --.|||+||.|||||-+|+.||..+.  .   .    -..-.|-++.+..
T Consensus        17 ~dvVGQ~~vv~~L~nai~~~ri--------~HAyLF~GprGtGKTT~ArilAkaLnC~~~~~~~~pCg~C~~C~~I~~g~   88 (462)
T PRK06305         17 SEILGQDAVVTVLKNALRFNRA--------AHAYLFSGIRGTGKTTLARIFAKALNCQNPTEDQEPCNQCAICKEISSGT   88 (462)
T ss_pred             HHHCCCHHHHHHHHHHHHCCCC--------CCEEEEECCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCCCHHHHHHHCCC
T ss_conf             6604909999999999984997--------62343038998599999999999967999988889887668889986389


Q ss_pred             CCC--HHCCCCCHHCCCCCCCCCCHHHHHCC----CEEEEECCHHHCCHHHHHHHHHHHHHHHCCCCCCCEECCCCEEEE
Q ss_conf             530--11047800025644431003555158----517774044550289999999987775021779977612542999
Q gi|254780163|r  548 AVS--RLIGAPPGYVGFGQGGILADSVDQNP----YSVVLLDEIEKSHPDVLNILLQIMDYGILTDQSGKKISFRNVILI  621 (798)
Q Consensus       548 ~vs--~LiGappGYvG~~egg~Lte~vr~~P----~sVvl~DEiEKAh~~v~~~llqild~G~ltd~~Gr~vdf~n~iii  621 (798)
                      +..  .+=++.  .-|-|+=-.|.+.++..|    |-|.++||++.-+.+-||.||..|+|=-           .++++|
T Consensus        89 ~~DViEiDaAs--~~gVddIRel~e~v~~~P~~~~yKVyIIDEvhmLs~~AfNALLKtLEEPP-----------~~v~FI  155 (462)
T PRK06305         89 SLDVIEIDGAS--HRGIEDIRQINETVLFTPSKSQYKIYIIDEVHMLTKEAFNSLLKTLEEPP-----------QHVKFF  155 (462)
T ss_pred             CCCEEEECCCC--CCCHHHHHHHHHHHCCCCCCCCEEEEEEECHHHCCHHHHHHHHHHHHCCC-----------CCEEEE
T ss_conf             99868643553--44668999999771008867750599981521179999999999861898-----------774999


Q ss_pred             EECC
Q ss_conf             9424
Q gi|254780163|r  622 MTTN  625 (798)
Q Consensus       622 ~TsN  625 (798)
                      |.++
T Consensus       156 LaTT  159 (462)
T PRK06305        156 LATT  159 (462)
T ss_pred             EEEC
T ss_conf             9818


No 135
>KOG0734 consensus
Probab=98.97  E-value=1.3e-08  Score=81.05  Aligned_cols=153  Identities=29%  Similarity=0.500  Sum_probs=103.5

Q ss_pred             CCCCHHHHHHH---HHHHHHHHHH---------HCCCCCCEEEECCCCCHHHHHHHHHHHHHHCCCCCHHHHEEEEEEEE
Q ss_conf             48611222178---9999999986---------22677874896676411668999999998548988345201445540
Q gi|254780163|r  200 KGKVDILVGRH---EEINRTIQIL---------CRRSKNNPLYVGDPGVGKTAIAEGFAKQIVDGMVPDILLGARIFSLD  267 (798)
Q Consensus       200 eGKLDPVIGRd---~EI~riiqIL---------~RR~KNn~~lvG~~gvGktaive~la~~i~~~~vp~~l~~~~i~~ld  267 (798)
                      +-+++-|-|-|   .|++.+++-|         ..|--..++|||+||.|||-++...|-   +..||-       |.  
T Consensus       300 nv~F~dVkG~DEAK~ELeEiVefLkdP~kftrLGGKLPKGVLLvGPPGTGKTlLARAvAG---EA~VPF-------F~--  367 (752)
T KOG0734         300 NVTFEDVKGVDEAKQELEEIVEFLKDPTKFTRLGGKLPKGVLLVGPPGTGKTLLARAVAG---EAGVPF-------FY--  367 (752)
T ss_pred             CCCCCCCCCHHHHHHHHHHHHHHHCCCHHHHHCCCCCCCCEEEECCCCCCHHHHHHHHHC---CCCCCE-------EE--
T ss_conf             655002147278999999999986090876431475888538768999755699998605---568974-------74--


Q ss_pred             HHHHHCCC----CCCCHHHHHHHHHHHHHCCCCCEEEEECCHHHHHCCCCCCCCCCCHH------HHHHHHH----CCCC
Q ss_conf             46753063----43123789999999872038983999736166301554443447778------8887663----0266
Q gi|254780163|r  268 MGNLIAGT----RYRGDFEERIKKIVKEIESYANAILYIDEIHTLVGAGSASGISVDAS------NLLKPAL----SSGA  333 (798)
Q Consensus       268 ~~~l~ag~----~~rg~fe~r~~~~~~~~~~~~~~ilfideih~ligag~~~g~~~d~a------n~lkP~L----~rg~  333 (798)
                          .||.    .|.|.=-.|++.++.++++..+.|+|||||..+ |  +... .-|.+      |-|.--|    ..-.
T Consensus       368 ----~sGSEFdEm~VGvGArRVRdLF~aAk~~APcIIFIDEiDav-G--~kR~-~~~~~y~kqTlNQLLvEmDGF~qNeG  439 (752)
T KOG0734         368 ----ASGSEFDEMFVGVGARRVRDLFAAAKARAPCIIFIDEIDAV-G--GKRN-PSDQHYAKQTLNQLLVEMDGFKQNEG  439 (752)
T ss_pred             ----CCCCCHHHHHHCCCHHHHHHHHHHHHHCCCEEEEEECHHHH-C--CCCC-CCHHHHHHHHHHHHHHHHCCCCCCCC
T ss_conf             ----16620445422014899999999987349859997200220-5--6678-62778999899999998428676886


Q ss_pred             EEEEEECCHHHHHHHHHCCHHHHH--HCEE-EEECCCCHHHHHHHHH
Q ss_conf             038873048999998520111432--0014-4306878689999998
Q gi|254780163|r  334 VRCIGSTTYSEYRQFFEKDKALVR--RFQK-IDVSEPSIEDAIEIVK  377 (798)
Q Consensus       334 ~~~IgatT~~ey~~~~e~d~al~r--rF~~-i~v~ep~~~~~~~iL~  377 (798)
                      |-+||||..-|     .-|+||.|  ||.+ |.|+-|++.--.+||.
T Consensus       440 iIvigATNfpe-----~LD~AL~RPGRFD~~v~Vp~PDv~GR~eIL~  481 (752)
T KOG0734         440 IIVIGATNFPE-----ALDKALTRPGRFDRHVTVPLPDVRGRTEILK  481 (752)
T ss_pred             EEEEECCCCHH-----HHHHHHCCCCCCCEEEECCCCCCCCHHHHHH
T ss_conf             69995168745-----5568734887553367468977332899999


No 136
>KOG0989 consensus
Probab=98.95  E-value=4.3e-08  Score=77.32  Aligned_cols=187  Identities=24%  Similarity=0.374  Sum_probs=83.7

Q ss_pred             HHHHHHCCCCHHHHHHHHHHHHHHHHHHCCCCCCEEEECCCCCHHHHHHHHHHHHHHCCCCCHHHHEEEEEEEEHHHH--
Q ss_conf             588775486112221789999999986226778748966764116689999999985489883452014455404675--
Q gi|254780163|r  194 LTEKVKKGKVDILVGRHEEINRTIQILCRRSKNNPLYVGDPGVGKTAIAEGFAKQIVDGMVPDILLGARIFSLDMGNL--  271 (798)
Q Consensus       194 LTe~AreGKLDPVIGRd~EI~riiqIL~RR~KNn~~lvG~~gvGktaive~la~~i~~~~vp~~l~~~~i~~ld~~~l--  271 (798)
                      .|++-+-..+|-++|-+..+.-+...+.||.-.|-++-|+||.|||+-+..+|..+.-    +.+.-.++.+++..-.  
T Consensus        26 wteKYrPkt~de~~gQe~vV~~L~~a~~~~~lp~~LFyGPpGTGKTStalafar~L~~----~~~~~~rvl~lnaSderG  101 (346)
T KOG0989          26 WTEKYRPKTFDELAGQEHVVQVLKNALLRRILPHYLFYGPPGTGKTSTALAFARALNC----EQLFPCRVLELNASDERG  101 (346)
T ss_pred             HHHHHCCCCHHHHCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCHHHHHHHHHHHHCC----CCCCCCCHHHHCCCCCCC
T ss_conf             3787478737765015999999999986068860786689998676899999998557----423555424313660014


Q ss_pred             --HCCCCCCCHHHHHHHHHHHHH--CCCCC-EEEEECCHHHHHCCCCCCCCCCCHHHHHHHHHC--CCCEEEEEECCHHH
Q ss_conf             --306343123789999999872--03898-399973616630155444344777888876630--26603887304899
Q gi|254780163|r  272 --IAGTRYRGDFEERIKKIVKEI--ESYAN-AILYIDEIHTLVGAGSASGISVDASNLLKPALS--SGAVRCIGSTTYSE  344 (798)
Q Consensus       272 --~ag~~~rg~fe~r~~~~~~~~--~~~~~-~ilfideih~ligag~~~g~~~d~an~lkP~L~--rg~~~~IgatT~~e  344 (798)
                        +-+.|.. .|+. +....+..  ...+. -|+-+||.|++         +-||-+-|.-.+.  ....++|=.|++=+
T Consensus       102 isvvr~Kik-~fak-l~~~~~~~~~~~~~~fKiiIlDEcdsm---------tsdaq~aLrr~mE~~s~~trFiLIcnyls  170 (346)
T KOG0989         102 ISVVREKIK-NFAK-LTVLLKRSDGYPCPPFKIIILDECDSM---------TSDAQAALRRTMEDFSRTTRFILICNYLS  170 (346)
T ss_pred             CCCHHHHHC-CHHH-HHHCCCCCCCCCCCCCEEEEEECHHHH---------HHHHHHHHHHHHHCCCCCEEEEEECCCHH
T ss_conf             310066523-7998-750255656788986328997416453---------09999999999862546659999738856


Q ss_pred             HHHHHHCCHHHHHHCEEEEECCCCHHHHHHHHHHHHHHHHHHCCCEECCHHHHHHHHHHH
Q ss_conf             999852011143200144306878689999998612766541035121117899999865
Q gi|254780163|r  345 YRQFFEKDKALVRRFQKIDVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSV  404 (798)
Q Consensus       345 y~~~~e~d~al~rrF~~i~v~ep~~~~~~~iL~~~~~~ye~~h~v~~~~~al~~av~ls~  404 (798)
                        +.|.   -+..|-|+..-+....+..+..|+-+.+.    -+|.|.++|+...+..|.
T Consensus       171 --rii~---pi~SRC~KfrFk~L~d~~iv~rL~~Ia~~----E~v~~d~~al~~I~~~S~  221 (346)
T KOG0989         171 --RIIR---PLVSRCQKFRFKKLKDEDIVDRLEKIASK----EGVDIDDDALKLIAKISD  221 (346)
T ss_pred             --HCCH---HHHHHHHHHCCCCCCHHHHHHHHHHHHHH----HCCCCCHHHHHHHHHHCC
T ss_conf             --4772---87746777128876447899999999888----589978789999999738


No 137
>TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda. Members of this protein family are Hda (Homologous to DnaA). These proteins are about half the length of DnaA and homologous over length of Hda. In the model species Escherichia coli, the initiation of DNA replication requires DnaA bound to ATP rather than ADP; Hda helps facilitate the conversion of DnaA-ATP to DnaA-ADP.
Probab=98.95  E-value=2.1e-07  Score=72.33  Aligned_cols=161  Identities=15%  Similarity=0.210  Sum_probs=89.5

Q ss_pred             HHHHHHCCCCCCEE-EECCCCCHHHHHHHHHHHHHHCCCCCHHHHEEEEEEEEHHHHHCCCCCCCHHHHHHHHHHHHHCC
Q ss_conf             99986226778748-96676411668999999998548988345201445540467530634312378999999987203
Q gi|254780163|r  216 TIQILCRRSKNNPL-YVGDPGVGKTAIAEGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIES  294 (798)
Q Consensus       216 iiqIL~RR~KNn~~-lvG~~gvGktaive~la~~i~~~~vp~~l~~~~i~~ld~~~l~ag~~~rg~fe~r~~~~~~~~~~  294 (798)
                      +.++... ..+|++ +.|++|.|||.+.++++..+.+.       +++++.++...          |......+++.++.
T Consensus        29 l~~~~~~-~~~~~l~i~G~~GsGKTHLl~a~~~~~~~~-------~~~~~yl~~~~----------~~~~~~~~l~~l~~   90 (226)
T TIGR03420        29 LRQLAAG-KGDRFLYLWGESGSGKSHLLQAACAAAEER-------GKSAIYLPLAE----------LAQADPEVLEGLEQ   90 (226)
T ss_pred             HHHHHHC-CCCCEEEEECCCCCCHHHHHHHHHHHHHCC-------CCCEEEECHHH----------HHHHHHHHHHHCCC
T ss_conf             9987646-688869998999998899999999998626-------99579952999----------87753999972744


Q ss_pred             CCCEEEEECCHHHHHCCCCCCCCCCCHHHHHHHHHCCCCEEEEEECCHHHHHHHHHCCHHHHHHC---EEEEECCCCHHH
Q ss_conf             89839997361663015544434477788887663026603887304899999852011143200---144306878689
Q gi|254780163|r  295 YANAILYIDEIHTLVGAGSASGISVDASNLLKPALSSGAVRCIGSTTYSEYRQFFEKDKALVRRF---QKIDVSEPSIED  371 (798)
Q Consensus       295 ~~~~ilfideih~ligag~~~g~~~d~an~lkP~L~rg~~~~IgatT~~ey~~~~e~d~al~rrF---~~i~v~ep~~~~  371 (798)
                       . -+|+||++|.+.|....+.   -.-+++--...+|.-=+|+++++...-+...+|  |..||   ..+.+++|+.++
T Consensus        91 -~-d~l~iDDi~~i~~~~~~e~---~lF~l~N~~~~~~~~ilits~~~p~~l~~~l~d--L~SRl~~~~~~~I~~pdd~~  163 (226)
T TIGR03420        91 -A-DLVCLDDVEAIAGQPEWQE---ALFHLYNRVREAGGRLLIAGRAAPAQLPLRLPD--LRTRLAWGLVFQLPPLSDEE  163 (226)
T ss_pred             -C-CEEEEECHHHHCCCHHHHH---HHHHHHHHHHHHCCEEEEECCCCHHHCCCCHHH--HHHHHHCCCEEECCCCCHHH
T ss_conf             -8-9999966333437837899---999999999865282898678882320320177--99999688568527999999


Q ss_pred             HHHHHHHHHHHHHHHCCCEECCHHHHHHHHHHHH
Q ss_conf             9999986127665410351211178999998654
Q gi|254780163|r  372 AIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVR  405 (798)
Q Consensus       372 ~~~iL~~~~~~ye~~h~v~~~~~al~~av~ls~r  405 (798)
                      -..||+..    -.-+++.++++++.+.+.-..|
T Consensus       164 ~~~iL~k~----~~~r~i~i~~~vi~yl~~r~~R  193 (226)
T TIGR03420       164 KIAALQSR----AARRGLQLPDEVADYLLRHGSR  193 (226)
T ss_pred             HHHHHHHH----HHHCCCCCCHHHHHHHHHHCCC
T ss_conf             99999999----9985998899999999986379


No 138
>KOG0731 consensus
Probab=98.94  E-value=1.2e-08  Score=81.21  Aligned_cols=126  Identities=32%  Similarity=0.445  Sum_probs=84.5

Q ss_pred             HHHHHCHHHHHHHHHHHHHH-------HHCCCCCCCCCCCEEEEECCCCHHHHHHHHHHHHHCCCCEEEEEHHHHHCCCC
Q ss_conf             46653458999999999877-------52044565787406886143200388999998730477337720688612465
Q gi|254780163|r  476 GTVVYGQEEAIKKLSSSIKI-------ARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFALGVQLLRFDMSEYMERHA  548 (798)
Q Consensus       476 ~~~v~GQ~~ai~~v~~~i~~-------~~~gl~~~~rP~g~flf~GptGvGKTelak~la~~~~~~lir~dmsey~e~~~  548 (798)
                      -+-|.|+|+|.+.+-+-+.-       .+.|.+-   |-|+ |++||+|+|||-|||+.|-.-+.+|+.+.-|||.|   
T Consensus       310 FkDVAG~deAK~El~E~V~fLKNP~~Y~~lGAKi---PkGv-LL~GPPGTGKTLLAKAiAGEAgVPF~svSGSEFvE---  382 (774)
T KOG0731         310 FKDVAGVDEAKEELMEFVKFLKNPEQYQELGAKI---PKGV-LLVGPPGTGKTLLAKAIAGEAGVPFFSVSGSEFVE---  382 (774)
T ss_pred             CCCCCCHHHHHHHHHHHHHHHCCHHHHHHCCCCC---CCCE-EEECCCCCCHHHHHHHHHCCCCCCEEEECHHHHHH---
T ss_conf             0102670899999999999843989998747767---6751-78789998678999988530589646413378888---


Q ss_pred             CCHHCCCCCHHCCCCCC--CCCCHHHHHCCCEEEEECCHHHC------------CHHHHHHHHHHHH--HHHCCCCCCCE
Q ss_conf             30110478000256444--31003555158517774044550------------2899999999877--75021779977
Q gi|254780163|r  549 VSRLIGAPPGYVGFGQG--GILADSVDQNPYSVVLLDEIEKS------------HPDVLNILLQIMD--YGILTDQSGKK  612 (798)
Q Consensus       549 vs~LiGappGYvG~~eg--g~Lte~vr~~P~sVvl~DEiEKA------------h~~v~~~llqild--~G~ltd~~Gr~  612 (798)
                               .|||-+..  --|...-|.+--|+|+.|||+--            +.+=-+.|-|+|=  ||..+      
T Consensus       383 ---------~~~g~~asrvr~lf~~ar~~aP~iifideida~~~~r~G~~~~~~~~e~e~tlnQll~emDgf~~------  447 (774)
T KOG0731         383 ---------MFVGVGASRVRDLFPLARKNAPSIIFIDEIDAVGRKRGGKGTGGGQDEREQTLNQLLVEMDGFET------  447 (774)
T ss_pred             ---------HHCCCCHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHCCCCC------
T ss_conf             ---------76034348889999874326980797145420031255666678880788899988787527767------


Q ss_pred             ECCCCEEEEEECC
Q ss_conf             6125429999424
Q gi|254780163|r  613 ISFRNVILIMTTN  625 (798)
Q Consensus       613 vdf~n~iii~TsN  625 (798)
                       + ++.|++.++|
T Consensus       448 -~-~~vi~~a~tn  458 (774)
T KOG0731         448 -S-KGVIVLAATN  458 (774)
T ss_pred             -C-CCEEEEECCC
T ss_conf             -7-8479981168


No 139
>COG0714 MoxR-like ATPases [General function prediction only]
Probab=98.93  E-value=3.8e-08  Score=77.72  Aligned_cols=151  Identities=26%  Similarity=0.385  Sum_probs=90.3

Q ss_pred             HHHHHHHHHHHHHHHHHCCCCCCEEEECCCCCHHHHHHHHHHHHHHCCCCCHHHHEEEEEEEEHHHHHCCCCCCCHH--H
Q ss_conf             22217899999999862267787489667641166899999999854898834520144554046753063431237--8
Q gi|254780163|r  205 ILVGRHEEINRTIQILCRRSKNNPLYVGDPGVGKTAIAEGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGDF--E  282 (798)
Q Consensus       205 PVIGRd~EI~riiqIL~RR~KNn~~lvG~~gvGktaive~la~~i~~~~vp~~l~~~~i~~ld~~~l~ag~~~rg~f--e  282 (798)
                      .++|+++++..+..-+...+  +++|.|+||||||.+++.+|+.+.          ..++.+....-+..+-..|.+  .
T Consensus        25 ~~~g~~~~~~~~l~a~~~~~--~vll~G~PG~gKT~la~~lA~~l~----------~~~~~i~~t~~l~p~d~~G~~~~~   92 (329)
T COG0714          25 VVVGDEEVIELALLALLAGG--HVLLEGPPGVGKTLLARALARALG----------LPFVRIQCTPDLLPSDLLGTYAYA   92 (329)
T ss_pred             CCCCCHHHHHHHHHHHHCCC--CEEEECCCCCCHHHHHHHHHHHHC----------CCCEEEECCCCCCHHHHCCHHHHH
T ss_conf             55266999999999998599--778779898777999999999838----------981899568998888820568887


Q ss_pred             HHHH--HHHHHHCC--CCC--EEEEECCHHHHHCCCCCCCCCCCHHHHHHHHHCCCCEE--------------EEEECCH
Q ss_conf             9999--99987203--898--39997361663015544434477788887663026603--------------8873048
Q gi|254780163|r  283 ERIK--KIVKEIES--YAN--AILYIDEIHTLVGAGSASGISVDASNLLKPALSSGAVR--------------CIGSTTY  342 (798)
Q Consensus       283 ~r~~--~~~~~~~~--~~~--~ilfideih~ligag~~~g~~~d~an~lkP~L~rg~~~--------------~IgatT~  342 (798)
                      .+.+  ........  -.+  .|||+|||-..         ..+.-|.|-++|..+.+.              +|++..+
T Consensus        93 ~~~~~~~~~~~~~gpl~~~~~~ill~DEInra---------~p~~q~aLl~~l~e~~vt~~~~~~~~~~~~f~viaT~Np  163 (329)
T COG0714          93 ALLLEPGEFRFVPGPLFAAVRVILLLDEINRA---------PPEVQNALLEALEERQVTVPGLTTIRLPPPFIVIATQNP  163 (329)
T ss_pred             HHHCCCCEEEEECCCCCCCCCEEEEEECCCCC---------CHHHHHHHHHHHHHCEEEECCCCCCCCCCCCEEEEECCC
T ss_conf             66425771898468733451338998703458---------988999999999726897079665337998789982686


Q ss_pred             HHHHHHHHCCHHHHHHC-EEEEECCCCHHHHHHHH
Q ss_conf             99999852011143200-14430687868999999
Q gi|254780163|r  343 SEYRQFFEKDKALVRRF-QKIDVSEPSIEDAIEIV  376 (798)
Q Consensus       343 ~ey~~~~e~d~al~rrF-~~i~v~ep~~~~~~~iL  376 (798)
                      .||.-..+-..|+.+|| =.+.++-|..++...++
T Consensus       164 ~e~~g~~~l~eA~ldRf~~~~~v~yp~~~~e~~~i  198 (329)
T COG0714         164 GEYEGTYPLPEALLDRFLLRIYVDYPDSEEEERII  198 (329)
T ss_pred             CCCCCCCCCCHHHHCCCEEEEECCCCCCHHHHHHH
T ss_conf             76578878998888103887764899738899999


No 140
>PRK08058 DNA polymerase III subunit delta'; Validated
Probab=98.93  E-value=5.2e-08  Score=76.70  Aligned_cols=43  Identities=33%  Similarity=0.444  Sum_probs=23.8

Q ss_pred             HHHC-HHHHHHHHHHHHHHHHCCCCCCCCCCCEEEEECCCCHHHHHHHHHHH
Q ss_conf             6534-58999999999877520445657874068861432003889999987
Q gi|254780163|r  478 VVYG-QEEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLA  528 (798)
Q Consensus       478 ~v~G-Q~~ai~~v~~~i~~~~~gl~~~~rP~g~flf~GptGvGKTelak~la  528 (798)
                      +++| |++++..+.+++..        +|.--++||.||.|+||+.+|+++|
T Consensus         6 ~~~~~Q~~i~~~L~~~i~~--------~rl~HA~Lf~Gp~G~GK~~~A~~~A   49 (329)
T PRK08058          6 QLTALQPIVVKMLQNSIAK--------NRLAHAYLFEGAKGTGKKATALWLA   49 (329)
T ss_pred             HHHHHHHHHHHHHHHHHHC--------CCCCCEEEEECCCCCCHHHHHHHHH
T ss_conf             8883189999999999985--------9966156557899988999999999


No 141
>PRK05342 clpX ATP-dependent protease ATP-binding subunit ClpX; Provisional
Probab=98.91  E-value=6.4e-08  Score=76.08  Aligned_cols=170  Identities=24%  Similarity=0.401  Sum_probs=105.1

Q ss_pred             CCCCEEEECCCCCHHHHHHHHHHHHHHCCCCCHHHHEEEEEEEEHHHHHCCCCCCCH-HHHHHHHHHHHHC----CCCCE
Q ss_conf             778748966764116689999999985489883452014455404675306343123-7899999998720----38983
Q gi|254780163|r  224 SKNNPLYVGDPGVGKTAIAEGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGD-FEERIKKIVKEIE----SYANA  298 (798)
Q Consensus       224 ~KNn~~lvG~~gvGktaive~la~~i~~~~vp~~l~~~~i~~ld~~~l~ag~~~rg~-fe~r~~~~~~~~~----~~~~~  298 (798)
                      .|+|.+|||+.|+|||-|+.-||+.+   +||-...+..-+        .-+.|.|+ -|.-+..++..+.    .+..=
T Consensus       108 ~KsNILliGPTG~GKTlla~tLAk~l---~vPF~iaDAT~l--------TEaGYVGeDVE~ii~~Llq~Ad~dve~Ae~G  176 (411)
T PRK05342        108 QKSNILLIGPTGSGKTLLAQTLARIL---NVPFAIADATTL--------TEAGYVGEDVENILLKLLQAADYDVEKAQRG  176 (411)
T ss_pred             CCCCEEEECCCCCCHHHHHHHHHHHH---CCCEEEEEECEE--------CCCCCCCCCHHHHHHHHHHHCCCCHHHHHCC
T ss_conf             34538998999977889999999986---999899861200--------1267456079999999999828889988368


Q ss_pred             EEEECCHHHHHCCCCCCCCCCCHH------HHHHHHHCCC-----------------------CEEEEEECCHHH-----
Q ss_conf             999736166301554443447778------8887663026-----------------------603887304899-----
Q gi|254780163|r  299 ILYIDEIHTLVGAGSASGISVDAS------NLLKPALSSG-----------------------AVRCIGSTTYSE-----  344 (798)
Q Consensus       299 ilfideih~ligag~~~g~~~d~a------n~lkP~L~rg-----------------------~~~~IgatT~~e-----  344 (798)
                      |.|||||.-|--.+.+.+.+-|+|      .+|| .+.-.                       .|-+|.+-.+..     
T Consensus       177 IV~IDEIDKIarks~~~s~trDVSgEGVQqaLLk-iiEGt~v~vp~~ggrkhp~~~~~~idT~nILFI~gGAF~GL~~II  255 (411)
T PRK05342        177 IVYIDEIDKIARKSENPSITRDVSGEGVQQALLK-ILEGTVASVPPQGGRKHPQQEFIQVDTTNILFICGGAFDGLEKII  255 (411)
T ss_pred             EEEEEEHHHHHHCCCCCCCCCCCCCHHHHHHHHH-HHCCCEECCCCCCCCCCCCCCEEEEECCCEEEEECCCCCCHHHHH
T ss_conf             2888502345424788888777651248999999-875871411888777787765167614717999115533589999


Q ss_pred             -------------------------HHHHHHC-C-------HHHHHHCEE-EEECCCCHHHHHHHHH----HHHHHHHHH
Q ss_conf             -------------------------9998520-1-------114320014-4306878689999998----612766541
Q gi|254780163|r  345 -------------------------YRQFFEK-D-------KALVRRFQK-IDVSEPSIEDAIEIVK----GIKPYFEEH  386 (798)
Q Consensus       345 -------------------------y~~~~e~-d-------~al~rrF~~-i~v~ep~~~~~~~iL~----~~~~~ye~~  386 (798)
                                               +-++++. |       |-|--||-. +.+++.+.++-++||.    .+-..|.+.
T Consensus       256 ~~R~~~~~iGF~~~~~~~~~~~~~~~l~~v~p~DLi~fGlIPEfiGRlPViv~L~~L~~~~L~~ILtePkNaLikQY~~L  335 (411)
T PRK05342        256 KQRLGKSGIGFGAEVKSKDEKDLGELLAQVEPEDLVKFGLIPEFIGRLPVVATLEELDEEALVRILTEPKNALVKQYQKL  335 (411)
T ss_pred             HHHCCCCCCCCCCCCCCCCCCCHHHHHHHCCHHHHHHCCCCHHHHCCCCEEEECCCCCHHHHHHHHCCCCCHHHHHHHHH
T ss_conf             86357887677887664110005678762798788873883776146640546244799999999658741599999999


Q ss_pred             C-----CCEECCHHHHHHHHHHHH
Q ss_conf             0-----351211178999998654
Q gi|254780163|r  387 H-----QLRYSKEAIRAAVQLSVR  405 (798)
Q Consensus       387 h-----~v~~~~~al~~av~ls~r  405 (798)
                      .     .+.|+++||.+.++.+-.
T Consensus       336 F~~dgV~L~Ft~~AL~~IA~~A~~  359 (411)
T PRK05342        336 FEMDGVELEFTDDALEAIAKKAIE  359 (411)
T ss_pred             HHHCCCEEEECHHHHHHHHHHHHH
T ss_conf             975496799868999999999998


No 142
>PRK12323 DNA polymerase III subunits gamma and tau; Provisional
Probab=98.91  E-value=2.7e-08  Score=78.73  Aligned_cols=197  Identities=21%  Similarity=0.263  Sum_probs=126.5

Q ss_pred             HHHCCCCHHHHHHHHHHHHHHHHHHCCCCCCE-EEECCCCCHHHHHHHHHHHHHHCCC---------CCH----------
Q ss_conf             77548611222178999999998622677874-8966764116689999999985489---------883----------
Q gi|254780163|r  197 KVKKGKVDILVGRHEEINRTIQILCRRSKNNP-LYVGDPGVGKTAIAEGFAKQIVDGM---------VPD----------  256 (798)
Q Consensus       197 ~AreGKLDPVIGRd~EI~riiqIL~RR~KNn~-~lvG~~gvGktaive~la~~i~~~~---------vp~----------  256 (798)
                      +-|=..++-|||-+--++-+...|...+=++. ++.|.-|||||+++.-||.-+....         -|-          
T Consensus         9 k~RP~~F~~~vGQ~~v~~~l~na~~~~r~~haylf~G~rGvGKTt~ari~Ak~lnc~~~~~~~g~~~~pcg~C~~C~~i~   88 (721)
T PRK12323          9 KWRPRDFTTLVGQEHVVRALTHALEQQRLHHAYLFTGTRGVGKTTLSRILAKSLNCTGPDGEGGITAQPCGQCRACTEID   88 (721)
T ss_pred             HHCCCCHHHHCCCHHHHHHHHHHHHCCCCCCEEEEECCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCHHHHHHH
T ss_conf             40798665532859999999999971997544750279988898999999999768998667898788787765468775


Q ss_pred             HHHEEEEEEEEHHHHHCCCCCCCHHHHHHHHHHHHHCC---CCC-EEEEECCHHHHHCCCCCCCCCCCHHH-HHHHHHC-
Q ss_conf             45201445540467530634312378999999987203---898-39997361663015544434477788-8876630-
Q gi|254780163|r  257 ILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIES---YAN-AILYIDEIHTLVGAGSASGISVDASN-LLKPALS-  330 (798)
Q Consensus       257 ~l~~~~i~~ld~~~l~ag~~~rg~fe~r~~~~~~~~~~---~~~-~ilfideih~ligag~~~g~~~d~an-~lkP~L~-  330 (798)
                      .=+..-++++|.++      .+|-  +.++.+++.+.-   .+. -|..|||+|+|-         ..+-| +|| -|. 
T Consensus        89 ~g~~~d~~EiDaas------~~~v--~~~r~l~~~~~y~P~~~~~KvyiiDevhmls---------~~afnalLK-tlEe  150 (721)
T PRK12323         89 AGRFVDYIEMDAAS------NRGV--DEMAQLLDQAVYAPTAGRFKVYMIDEVHMLT---------NHAFNAMLK-TLEE  150 (721)
T ss_pred             CCCCCCEEEEECCC------CCCH--HHHHHHHHHCCCCCCCCCEEEEEEECCCCCC---------HHHHHHHHH-HHCC
T ss_conf             68987647743676------7888--9999999854558876644699985400058---------999999998-4017


Q ss_pred             -CCCEEEEEECCHHHHHHHHHCCHHHHHHCEEEEECCCCHHHHHHHHHHHHHHHHHHCCCEECCHHHHHHHHHHHHHCCC
Q ss_conf             -2660388730489999985201114320014430687868999999861276654103512111789999986542015
Q gi|254780163|r  331 -SGAVRCIGSTTYSEYRQFFEKDKALVRRFQKIDVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTS  409 (798)
Q Consensus       331 -rg~~~~IgatT~~ey~~~~e~d~al~rrF~~i~v~ep~~~~~~~iL~~~~~~ye~~h~v~~~~~al~~av~ls~ryi~~  409 (798)
                       -.-+.+|-|||.-  +|.-  -.-|.| -|....+--+.++-..-|..+-    ..-++.|.++||....+.+.--+.|
T Consensus       151 PP~hv~FilaTT~~--~Kip--~TilSR-c~~f~~~~~~~~~i~~~l~~i~----~~E~i~~~~~al~~ia~~a~Gs~RD  221 (721)
T PRK12323        151 PPPHVKFILATTDP--QKIP--VTVLSR-CLQFNLKQMPPGHIVSHLDAIL----GQEGIGHEGNALRLLAQAAHGSMRD  221 (721)
T ss_pred             CCCCEEEEEECCCH--HHCC--HHHHHH-HHHCCCCCCCHHHHHHHHHHHH----HHCCCCCCHHHHHHHHHHCCCCHHH
T ss_conf             97553899943863--4485--889877-6542347899999999999999----9839977999999999975896476


Q ss_pred             CCCHHHHHHHHHHHHHH
Q ss_conf             55646798899865333
Q gi|254780163|r  410 RKLPDKAIDVIDEAGAS  426 (798)
Q Consensus       410 r~lPdkAidllDea~a~  426 (798)
                            |+.|||.|-|.
T Consensus       222 ------alslldQaia~  232 (721)
T PRK12323        222 ------ALSLTDQAIAY  232 (721)
T ss_pred             ------HHHHHHHHHHH
T ss_conf             ------88899999986


No 143
>PRK08451 DNA polymerase III subunits gamma and tau; Validated
Probab=98.90  E-value=5.2e-07  Score=69.54  Aligned_cols=123  Identities=24%  Similarity=0.334  Sum_probs=70.1

Q ss_pred             HHHHCHHHHHHHHHHHHHHHHCCCCCCCCCCCEEEEECCCCHHHHHHHHHHHHHC--CC-----C-EEEEEHHHHHCCCC
Q ss_conf             6653458999999999877520445657874068861432003889999987304--77-----3-37720688612465
Q gi|254780163|r  477 TVVYGQEEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFAL--GV-----Q-LLRFDMSEYMERHA  548 (798)
Q Consensus       477 ~~v~GQ~~ai~~v~~~i~~~~~gl~~~~rP~g~flf~GptGvGKTelak~la~~~--~~-----~-lir~dmsey~e~~~  548 (798)
                      ..||||+.++..+..++...        |.--.|||.||.|||||-+|+.+|..+  +.     + -..-.|....+   
T Consensus        14 ~evIGQe~iv~~L~nAi~~~--------Rl~HAYLFsGPrGvGKTt~ArifAkaLnC~~~~~~~PCg~C~sC~~i~~---   82 (523)
T PRK08451         14 DELIGQESVSKTLSLALDNN--------RLAHAYLFSGLRGSGKTSSARIFSRALVCEQGPSSTPCGTCAQCQAALE---   82 (523)
T ss_pred             HHCCCCHHHHHHHHHHHHCC--------CCCCEEEEECCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCCHHHHHHHC---
T ss_conf             44049499999999999859--------9671587578998688999999999975999999898887888999864---


Q ss_pred             CCHHCCCCCHHC--------CCCCCCCCCHHHHHCC----CEEEEECCHHHCCHHHHHHHHHHHHHHHCCCCCCCEECCC
Q ss_conf             301104780002--------5644431003555158----5177740445502899999999877750217799776125
Q gi|254780163|r  549 VSRLIGAPPGYV--------GFGQGGILADSVDQNP----YSVVLLDEIEKSHPDVLNILLQIMDYGILTDQSGKKISFR  616 (798)
Q Consensus       549 vs~LiGappGYv--------G~~egg~Lte~vr~~P----~sVvl~DEiEKAh~~v~~~llqild~G~ltd~~Gr~vdf~  616 (798)
                           |.-|-++        |-++=-.|.+.++..|    |-|+++||++.-+++-+|.||..|++-           =.
T Consensus        83 -----g~hpDViEiDaasn~gID~IReLie~~~~~P~~gryKV~IIDEah~Lt~~A~NALLKTLEEP-----------P~  146 (523)
T PRK08451         83 -----GRHIDIIEMDAASNRGIDDIRNLIEQTKYKPSMARFKIFIIDEVHMLTKEAFNALLKTLEEP-----------PS  146 (523)
T ss_pred             -----CCCCCEEEECCCCCCCHHHHHHHHHHHCCCCCCCCEEEEEEECCCCCCHHHHHHHHHHCCCC-----------CC
T ss_conf             -----89998551055333689999999997235886797279998260304899999999970389-----------87


Q ss_pred             CEEEEEECCC
Q ss_conf             4299994242
Q gi|254780163|r  617 NVILIMTTNA  626 (798)
Q Consensus       617 n~iii~TsN~  626 (798)
                      ++++||.|+-
T Consensus       147 ~vvFILaTTe  156 (523)
T PRK08451        147 YVKFILATTD  156 (523)
T ss_pred             CCEEEEECCC
T ss_conf             8379997599


No 144
>PRK08853 DNA polymerase III subunits gamma and tau; Validated
Probab=98.90  E-value=5.7e-07  Score=69.22  Aligned_cols=19  Identities=37%  Similarity=0.422  Sum_probs=9.5

Q ss_pred             CCCCCCCHHHHHHHHHCCC
Q ss_conf             4434477788887663026
Q gi|254780163|r  314 ASGISVDASNLLKPALSSG  332 (798)
Q Consensus       314 ~~g~~~d~an~lkP~L~rg  332 (798)
                      +.|+-=|+-.+|--+++-|
T Consensus       210 a~Gs~Rdalsl~dqaia~~  228 (717)
T PRK08853        210 ADGSMRDALSLTDQAIALG  228 (717)
T ss_pred             CCCCHHHHHHHHHHHHHHC
T ss_conf             6883778888999999965


No 145
>COG0606 Predicted ATPase with chaperone activity [Posttranslational modification, protein turnover, chaperones]
Probab=98.89  E-value=3.7e-08  Score=77.77  Aligned_cols=225  Identities=24%  Similarity=0.263  Sum_probs=124.4

Q ss_pred             HHHHCHHHHHHHHHHHHHHHHCCCCCCCCCCCEEEEECCCCHHHHHHHHHHHHH---------CCCCEEEEEHH------
Q ss_conf             665345899999999987752044565787406886143200388999998730---------47733772068------
Q gi|254780163|r  477 TVVYGQEEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFA---------LGVQLLRFDMS------  541 (798)
Q Consensus       477 ~~v~GQ~~ai~~v~~~i~~~~~gl~~~~rP~g~flf~GptGvGKTelak~la~~---------~~~~lir~dms------  541 (798)
                      +-|+||++|..++--    +-+|-+       .+||.||+|+|||.+|+.+...         +|.+.|..=-.      
T Consensus       179 ~DV~GQ~~AKrAlei----AAAGgH-------nLl~~GpPGtGKTmla~Rl~~lLPpls~~E~lE~s~I~s~~~~~~~~~  247 (490)
T COG0606         179 KDVKGQEQAKRALEI----AAAGGH-------NLLLVGPPGTGKTMLASRLPGLLPPLSIPEALEVSAIHSLAGDLHEGC  247 (490)
T ss_pred             HHHCCCHHHHHHHHH----HHHCCC-------CEEEECCCCCCHHHHHHHHHCCCCCCCHHHHHHHHHHHHHCCCCCCCC
T ss_conf             664384999999999----984388-------678756998865676423102599987088899988876354324678


Q ss_pred             ------HHHCCC-CC--CHHCCCCCHHCCCCCCCCCCHHHHHCCCEEEEECCHHHCCHHHHHHHHHHHHHHHCCC--CCC
Q ss_conf             ------861246-53--0110478000256444310035551585177740445502899999999877750217--799
Q gi|254780163|r  542 ------EYMERH-AV--SRLIGAPPGYVGFGQGGILADSVDQNPYSVVLLDEIEKSHPDVLNILLQIMDYGILTD--QSG  610 (798)
Q Consensus       542 ------ey~e~~-~v--s~LiGappGYvG~~egg~Lte~vr~~P~sVvl~DEiEKAh~~v~~~llqild~G~ltd--~~G  610 (798)
                            -|.-+| |.  ..|+|   || |--+-|.    |-.--+.|++|||.--=.++|++.|-|-|++|..+=  ..+
T Consensus       248 ~~~~~rPFr~PHHsaS~~aLvG---GG-~~p~PGe----IsLAH~GVLFLDElpef~~~iLe~LR~PLE~g~i~IsRa~~  319 (490)
T COG0606         248 PLKIHRPFRAPHHSASLAALVG---GG-GVPRPGE----ISLAHNGVLFLDELPEFKRSILEALREPLENGKIIISRAGS  319 (490)
T ss_pred             CCCEECCCCCCCCCCHHHHHHC---CC-CCCCCCC----EEEECCCEEEEECCCHHHHHHHHHHHCCCCCCCEEEEECCC
T ss_conf             6411078768874022889737---89-9889873----54303877886144210599999973741258179997587


Q ss_pred             CEECCCCEEEEEECCCCHHHHHHCCCCCCCCCCH-----HHHHHHHHHHCCHHHHCCCCEEEECCCCCHHHHHH------
Q ss_conf             7761254299994242145533036898821114-----88999998728878817768289628899999999------
Q gi|254780163|r  611 KKISFRNVILIMTTNAGALEMSKARIGFGSSRND-----DADKEALRNFLSPEFLNRLDSIIPFFPLSSDIIRQ------  679 (798)
Q Consensus       611 r~vdf~n~iii~TsN~G~~~~~~~~~g~~~~~~~-----~~~~~~l~~~f~peflnRid~ii~F~~l~~~~~~~------  679 (798)
                      +..-..+-..+...|.-       ..|+......     ......-.+..+--|+.|||..|--..++..++.+      
T Consensus       320 ~v~ypa~Fqlv~AmNpc-------pcG~~~~~~~~C~c~~~~~~~Y~~klSgp~lDRiDl~vev~~~~~~e~~~~~~~~e  392 (490)
T COG0606         320 KVTYPARFQLVAAMNPC-------PCGNLGAPLRRCPCSPRQIKRYLNKLSGPFLDRIDLMVEVPRLSAGELIRQVPTGE  392 (490)
T ss_pred             EEEEEEEEEEHHHCCCC-------CCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHEECCCCCCHHHHHCCCCCCC
T ss_conf             16872126775223999-------76478887777578878877889874378775524110046789787614789898


Q ss_pred             ----HHHHHHHHHHHHHHH-CC--CEEEECHHHHHHHHHCCCCCCCCCHHHHHHHHHH
Q ss_conf             ----999999999999986-69--8899988999999971898101532679999986
Q gi|254780163|r  680 ----VVHKFIMKLELQLQE-KG--ISFHFSEEVINWLVSHGYDVKMGARPLERIIKEH  730 (798)
Q Consensus       680 ----i~~~~l~~l~~~l~~-~~--i~l~~~~~~~~~l~~~~~~~~~GAR~l~r~i~~~  730 (798)
                          +-.....--..++++ .+  +.-.++...++.   .|.-..-++.-|+..+++.
T Consensus       393 ss~~v~~rVa~AR~~Q~~R~~~~~~Na~l~~~~l~k---~~~L~~~~~~~L~~al~~~  447 (490)
T COG0606         393 SSAGVRERVAKAREAQIARAGRIGINAELSEEALRK---FCALQREDADLLKAALERL  447 (490)
T ss_pred             CCHHHHHHHHHHHHHHHHHHHCCCCCHHCCHHHHHH---HCCCCHHHHHHHHHHHHHC
T ss_conf             758899999999999999853568542128999997---6265776799999999966


No 146
>pfam01637 Arch_ATPase Archaeal ATPase. This family contain a conserved P-loop motif that is involved in binding ATP. This family is almost exclusively found in archaebacteria and particularly in Methanococcus jannaschii that encodes sixteen members of this family.
Probab=98.89  E-value=4.9e-07  Score=69.71  Aligned_cols=189  Identities=13%  Similarity=0.055  Sum_probs=110.1

Q ss_pred             HHHHHHHHHHHHHHHHCCCCCCEEEECCCCCHHHHHHHHHHHHHHCCCCCHHHHEEEEEEEEHHHH--------------
Q ss_conf             221789999999986226778748966764116689999999985489883452014455404675--------------
Q gi|254780163|r  206 LVGRHEEINRTIQILCRRSKNNPLYVGDPGVGKTAIAEGFAKQIVDGMVPDILLGARIFSLDMGNL--------------  271 (798)
Q Consensus       206 VIGRd~EI~riiqIL~RR~KNn~~lvG~~gvGktaive~la~~i~~~~vp~~l~~~~i~~ld~~~l--------------  271 (798)
                      .+||++|++.+.+.+.+-.-+..++.|.-++|||+++...+.+.-....+      .+|-.+...-              
T Consensus         1 F~~Re~EL~~L~~~~~~~~~~~ivi~G~RR~GKTsLi~~~~~~~~~~~~~------~i~~~~~~~~~~~~~~~~~~~~~l   74 (223)
T pfam01637         1 FFDREKELKELEEWAERGTYPIIVVYGPRRCGKTALLREFLEELRELGYR------VIYYDPLRREFEEKLDRFEEAKRL   74 (223)
T ss_pred             CCCHHHHHHHHHHHHHCCCCCEEEEECCCCCCHHHHHHHHHHHCCCCCCE------EEEEECHHHHHHHHHHHHHHHHHH
T ss_conf             98979999999999966997189998688787999999999863346852------899951444379999988888999


Q ss_pred             ---HC--CCCCCCH----HHHHHHHHHHHHCCC-CCEEEEECCHHHHHCCCCCCCCCCCHHHHHHHHHCCCCEEEEEECC
Q ss_conf             ---30--6343123----789999999872038-9839997361663015544434477788887663026603887304
Q gi|254780163|r  272 ---IA--GTRYRGD----FEERIKKIVKEIESY-ANAILYIDEIHTLVGAGSASGISVDASNLLKPALSSGAVRCIGSTT  341 (798)
Q Consensus       272 ---~a--g~~~rg~----fe~r~~~~~~~~~~~-~~~ilfideih~ligag~~~g~~~d~an~lkP~L~rg~~~~IgatT  341 (798)
                         +.  .-+..++    ...-+..+++.+.+. .++|++|||++.+++..+...---...++.--.+....+..|-+.+
T Consensus        75 ~~~~~~~~~~~~~~~~~~~~~~l~~~~~~l~~~~~~~iiviDEfq~l~~~~~~~~~~~~l~~~~d~~~~~~~~~~I~~GS  154 (223)
T pfam01637        75 AEALGDALPKIGIAKSKLAFLSLTLLFELLKRKGKKIAIIIDEVQYAIGLNGAESYVKLLLNLIDYPPKEYHLIVVLCGS  154 (223)
T ss_pred             HHHHHHHCCCCCCCCCCCHHHHHHHHHHHHHHCCCCEEEEEECHHHHHHCCCCHHHHHHHHHHHHHHHCCCCEEEEEECC
T ss_conf             99987651233222112078899999999985599659997016776402443059999999999752457758999727


Q ss_pred             -HHHHHHHHHCCHHHHHHCEEEEECCCCHHHHHHHHHHHHHHHHHHCCCEECCHHHHHHHHHHH
Q ss_conf             -899999852011143200144306878689999998612766541035121117899999865
Q gi|254780163|r  342 -YSEYRQFFEKDKALVRRFQKIDVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSV  404 (798)
Q Consensus       342 -~~ey~~~~e~d~al~rrF~~i~v~ep~~~~~~~iL~~~~~~ye~~h~v~~~~~al~~av~ls~  404 (798)
                       ..--++.+..+..|--|+..|.+.+-+.+++.+.++..-    ...++.++++.++.++.+..
T Consensus       155 ~~~~m~~~~~~~~plygR~~~i~l~p~~~~~~~efl~~~f----~e~~~~~~~~~~~~iy~~~g  214 (223)
T pfam01637       155 SEGLTIELLDYKSPLYGRHRWALLKPFDFETAWNFLREGF----EELYEPGPKEEFEEVWRLLG  214 (223)
T ss_pred             HHHHHHHHHCCCCCCCCCCCEEEECCCCHHHHHHHHHHHH----HHHCCCCCHHHHHHHHHHHC
T ss_conf             1999999862056535750227726899899999999999----98478999899999999969


No 147
>COG2255 RuvB Holliday junction resolvasome, helicase subunit [DNA replication, recombination, and repair]
Probab=98.88  E-value=5.7e-08  Score=76.42  Aligned_cols=200  Identities=24%  Similarity=0.315  Sum_probs=121.5

Q ss_pred             HHCCHHHHHHHCHHHHHHHHHHHHHHHHCCCCCCCCCCCEEEEECCCCHHHHHHHHHHHHHCCCCEEEEEHHHHHCCCCC
Q ss_conf             10000246653458999999999877520445657874068861432003889999987304773377206886124653
Q gi|254780163|r  470 NLEKNLGTVVYGQEEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFALGVQLLRFDMSEYMERHAV  549 (798)
Q Consensus       470 ~l~~~l~~~v~GQ~~ai~~v~~~i~~~~~gl~~~~rP~g~flf~GptGvGKTelak~la~~~~~~lir~dmsey~e~~~v  549 (798)
                      .+.-..-...+||++..+.+.-.|+-++    ..+.++.-.||.||+|.|||-||..+|..++.++-.---.-. |    
T Consensus        19 ~lRP~~l~efiGQ~~vk~~L~ifI~AAk----~r~e~lDHvLl~GPPGlGKTTLA~IIA~Emgvn~k~tsGp~l-e----   89 (332)
T COG2255          19 SLRPKTLDEFIGQEKVKEQLQIFIKAAK----KRGEALDHVLLFGPPGLGKTTLAHIIANELGVNLKITSGPAL-E----   89 (332)
T ss_pred             CCCCCCHHHHCCHHHHHHHHHHHHHHHH----HCCCCCCEEEEECCCCCCHHHHHHHHHHHHCCCEEECCCCCC-C----
T ss_conf             3586548885183999999999999998----449876747864799876888999999985677376366201-5----


Q ss_pred             CHHCCCCCHHCCCCCCCCCCHHHHHCCCEEEEECCHHHCCHHHHHHHHHHHHHHHCCC--CC---CCEE--CCC-CEEEE
Q ss_conf             0110478000256444310035551585177740445502899999999877750217--79---9776--125-42999
Q gi|254780163|r  550 SRLIGAPPGYVGFGQGGILADSVDQNPYSVVLLDEIEKSHPDVLNILLQIMDYGILTD--QS---GKKI--SFR-NVILI  621 (798)
Q Consensus       550 s~LiGappGYvG~~egg~Lte~vr~~P~sVvl~DEiEKAh~~v~~~llqild~G~ltd--~~---Gr~v--df~-n~iii  621 (798)
                            -||    |=-+.||.   -.|+.|++.|||..-.|.|..+|+-.|+|-++-=  +.   -|.|  |.- =|+|=
T Consensus        90 ------K~g----DlaaiLt~---Le~~DVLFIDEIHrl~~~vEE~LYpaMEDf~lDI~IG~gp~Arsv~ldLppFTLIG  156 (332)
T COG2255          90 ------KPG----DLAAILTN---LEEGDVLFIDEIHRLSPAVEEVLYPAMEDFRLDIIIGKGPAARSIRLDLPPFTLIG  156 (332)
T ss_pred             ------CHH----HHHHHHHC---CCCCCEEEEEHHHHCCHHHHHHHHHHHHHEEEEEEECCCCCCCEEECCCCCEEEEE
T ss_conf             ------726----59999863---98677677725531474289896467531057789724875534763799813751


Q ss_pred             EECCCCHHHHHHCCCCCCCCCCHHHHHHHHHHHCCHHHHCCCCEEEECCCCCHHHHHHHHHHHHHHHHHHHHHCCCEEEE
Q ss_conf             94242145533036898821114889999987288788177682896288999999999999999999999866988999
Q gi|254780163|r  622 MTTNAGALEMSKARIGFGSSRNDDADKEALRNFLSPEFLNRLDSIIPFFPLSSDIIRQVVHKFIMKLELQLQEKGISFHF  701 (798)
Q Consensus       622 ~TsN~G~~~~~~~~~g~~~~~~~~~~~~~l~~~f~peflnRid~ii~F~~l~~~~~~~i~~~~l~~l~~~l~~~~i~l~~  701 (798)
                      -|+-+|.                  ...-|+..|        --+.-++-.+.+++.+|+.+.-         +-..+++
T Consensus       157 ATTr~G~------------------lt~PLrdRF--------Gi~~rlefY~~~eL~~Iv~r~a---------~~l~i~i  201 (332)
T COG2255         157 ATTRAGM------------------LTNPLRDRF--------GIIQRLEFYTVEELEEIVKRSA---------KILGIEI  201 (332)
T ss_pred             ECCCCCC------------------CCCHHHHHC--------CCEEEEECCCHHHHHHHHHHHH---------HHHCCCC
T ss_conf             0134664------------------563368862--------8604540588899999999888---------8738776


Q ss_pred             CHHHHHHHHHCCC-CCCCCCHHHHHH
Q ss_conf             8899999997189-810153267999
Q gi|254780163|r  702 SEEVINWLVSHGY-DVKMGARPLERI  726 (798)
Q Consensus       702 ~~~~~~~l~~~~~-~~~~GAR~l~r~  726 (798)
                      ++++...++.+.. .|..--|-|||+
T Consensus       202 ~~~~a~eIA~rSRGTPRIAnRLLrRV  227 (332)
T COG2255         202 DEEAALEIARRSRGTPRIANRLLRRV  227 (332)
T ss_pred             CHHHHHHHHHHCCCCCHHHHHHHHHH
T ss_conf             85799999986369938999999999


No 148
>PRK07003 DNA polymerase III subunits gamma and tau; Validated
Probab=98.88  E-value=1.5e-06  Score=66.29  Aligned_cols=27  Identities=7%  Similarity=-0.152  Sum_probs=13.7

Q ss_pred             HHHHHHHHHHHHHHHHHHHCCCEEEEC
Q ss_conf             999999999999999998669889998
Q gi|254780163|r  676 IIRQVVHKFIMKLELQLQEKGISFHFS  702 (798)
Q Consensus       676 ~~~~i~~~~l~~l~~~l~~~~i~l~~~  702 (798)
                      =..-|..+.+..+.++|+-+..-..++
T Consensus       686 W~~Li~~L~l~Glv~QLAlNS~l~~~~  712 (816)
T PRK07003        686 WPTLAARLPLKGVAYQLAFNSELTAVD  712 (816)
T ss_pred             HHHHHHHCCCCHHHHHHHHHCEEECCC
T ss_conf             999998678524999999635663134


No 149
>TIGR01817 nifA Nif-specific regulatory protein; InterPro: IPR010113   This entry represents NifA, a DNA-binding regulatory protein for nitrogen fixation. Not included in this group are: the homologue in Aquifex aeolicus (which lacks nitrogenase), transcriptional activators of alternative nitrogenases (VFe or FeFe instead of MoFe), and truncated forms.   In diazotrophic proteobacteria, the sigma54-dependent activator NifA activates transcription of the nif (nitrogen fixation) genes by a conserved mechanism common to members of the enhancer binding protein family. Although NifA proteins have similar domain structures, both transcriptional regulation of nifA expression and posttranslational regulation of NifA activity by oxygen and fixed nitrogen vary significantly from one organism to another. In Klebsiella pneumoniae and Azotobacter vinelandii, nifA is co-ordinately transcribed with a second gene, nifL, whose product inhibits NifA activity in response to oxygen and fixed nitrogen .; GO: 0003677 DNA binding, 0016563 transcription activator activity, 0009399 nitrogen fixation.
Probab=98.87  E-value=9.3e-08  Score=74.90  Aligned_cols=233  Identities=21%  Similarity=0.338  Sum_probs=173.8

Q ss_pred             CHHHHHHHCHHHHHHHHHHHHHHHHCCCCCCCCCCCEEEEECCCCHHHHHHHHHHHHHC---CCCEEEEEHHHHHCCCCC
Q ss_conf             00246653458999999999877520445657874068861432003889999987304---773377206886124653
Q gi|254780163|r  473 KNLGTVVYGQEEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFAL---GVQLLRFDMSEYMERHAV  549 (798)
Q Consensus       473 ~~l~~~v~GQ~~ai~~v~~~i~~~~~gl~~~~rP~g~flf~GptGvGKTelak~la~~~---~~~lir~dmsey~e~~~v  549 (798)
                      .-...-|||...|+..|.+.++..    ..-|   -+.|+.|=||+||=-.||++=+.+   .++||+|||.--.|.===
T Consensus       208 ~~~~~~i~G~Spam~~v~~~~~~v----A~~n---STVLlRGESGTGKEl~A~AIH~~SpR~~~PFVK~NCAALse~lLE  280 (574)
T TIGR01817       208 SGKEDGIVGKSPAMRQVVDQIKVV----ARSN---STVLLRGESGTGKELIAKAIHELSPRAKRPFVKLNCAALSETLLE  280 (574)
T ss_pred             CCCCCCCCCCCHHHHHHHHHHHHH----CCCC---CEEEEECCCCCCHHHHHHHHCCCCCCCCCCCEEEECCCCCCCHHH
T ss_conf             234474012478999999886520----1317---667850565744334442340466455788545006447761124


Q ss_pred             CHHCCCCCHHCCCCCCCCCCHHHHHCCC-------EEEEECCHHHCCHHHHHHHHHHHHHHHCC---CCCCCEECCCCEE
Q ss_conf             0110478000256444310035551585-------17774044550289999999987775021---7799776125429
Q gi|254780163|r  550 SRLIGAPPGYVGFGQGGILADSVDQNPY-------SVVLLDEIEKSHPDVLNILLQIMDYGILT---DQSGKKISFRNVI  619 (798)
Q Consensus       550 s~LiGappGYvG~~egg~Lte~vr~~P~-------sVvl~DEiEKAh~~v~~~llqild~G~lt---d~~Gr~vdf~n~i  619 (798)
                      |-|.|       ||+ |-.|-||+++-=       .=++||||==-.|..+-=||-||.||-+.   -++-=+||   .=
T Consensus       281 SELFG-------HEK-GAFTGA~~~RkGRFElAdGGTLFLDEIGEISPaFQAKLLRVLQEGEFERVGG~~TlKVd---VR  349 (574)
T TIGR01817       281 SELFG-------HEK-GAFTGAVAQRKGRFELADGGTLFLDEIGEISPAFQAKLLRVLQEGEFERVGGNRTLKVD---VR  349 (574)
T ss_pred             HHHHC-------CCC-HHHHHHHHHCCCCEEECCCCCCCCCCCCCCCHHHHHHHHHHHHCCCEEEECCCEEEEEE---EE
T ss_conf             54513-------430-14688875177753302788320000146785688899887521002532787248873---67


Q ss_pred             EEEECCCCHHHHHHCCCCCCCCCCHHHHHHHH-HHHCCHHHHCCCCEEEECC-CC--CHHHHHHHHHHHHHHHHHHHHHC
Q ss_conf             99942421455330368988211148899999-8728878817768289628-89--99999999999999999999866
Q gi|254780163|r  620 LIMTTNAGALEMSKARIGFGSSRNDDADKEAL-RNFLSPEFLNRLDSIIPFF-PL--SSDIIRQVVHKFIMKLELQLQEK  695 (798)
Q Consensus       620 ii~TsN~G~~~~~~~~~g~~~~~~~~~~~~~l-~~~f~peflnRid~ii~F~-~l--~~~~~~~i~~~~l~~l~~~l~~~  695 (798)
                      ||+-||                   .+..++| +..||-.+.=||..+=.|- ||  -.+|+-.+++.+|++++   .++
T Consensus       350 lvaATN-------------------rdLE~aV~~GeFRaDLYYRinVvPl~lPPLRER~~DIP~LA~~fL~kf~---~en  407 (574)
T TIGR01817       350 LVAATN-------------------RDLEEAVAKGEFRADLYYRINVVPLILPPLRERREDIPLLAEAFLEKFN---REN  407 (574)
T ss_pred             EEECCC-------------------CCHHHHHHCCCCCCHHHHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHHH---HHH
T ss_conf             886137-------------------3558897278973023554422234078777873116899999999876---651


Q ss_pred             CCE-EEECHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHHHHHHHHHCCCCCCCCEEEEEEEECC
Q ss_conf             988-999889999999718981015326799999862359999996296768884899996078
Q gi|254780163|r  696 GIS-FHFSEEVINWLVSHGYDVKMGARPLERIIKEHVKVPLADEILFGKLKKGGGVVKVSLNPD  758 (798)
Q Consensus       696 ~i~-l~~~~~~~~~l~~~~~~~~~GAR~l~r~i~~~i~~~la~~il~~~~~~g~~~~~v~~~~~  758 (798)
                      +-. |.++++|++.|.. ||=|.. -|.|...|++.=       +|.    .+++++..++.-+
T Consensus       408 ~R~mL~~~~~Ai~~Lm~-c~wPGN-VRELENC~eRtA-------tLs----~~~~It~~df~c~  458 (574)
T TIGR01817       408 GRPMLTLSPSAIRVLMS-CKWPGN-VRELENCVERTA-------TLS----RSGTITRSDFSCQ  458 (574)
T ss_pred             CCCEEEECHHHHHHHHC-CCCCCC-CEEHHHHHHHHH-------HHC----CCCCCCCCEEEEC
T ss_conf             87203226789989751-789997-400443787787-------541----6885164236642


No 150
>PRK06674 DNA polymerase III subunits gamma and tau; Validated
Probab=98.87  E-value=1.6e-06  Score=66.01  Aligned_cols=37  Identities=11%  Similarity=0.347  Sum_probs=18.7

Q ss_pred             HHEEEEEEEEHHHHHCCCCCCCHHHHHHHHHHHHHCCCCCEEEEE
Q ss_conf             520144554046753063431237899999998720389839997
Q gi|254780163|r  258 LLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIESYANAILYI  302 (798)
Q Consensus       258 l~~~~i~~ld~~~l~ag~~~rg~fe~r~~~~~~~~~~~~~~ilfi  302 (798)
                      -..++||-+|-.-++.-        +-..++++-++..+.-++||
T Consensus       117 ~~~yKV~IIDeah~Lt~--------~A~NALLKtLEEPP~~viFI  153 (563)
T PRK06674        117 AVEYKVYIIDEVHMLSI--------GAFNALLKTLEEPPGHVIFI  153 (563)
T ss_pred             CCCEEEEEEECHHHCCH--------HHHHHHHHHHHCCCCCEEEE
T ss_conf             78737999854563799--------99999999863887564999


No 151
>PRK06645 DNA polymerase III subunits gamma and tau; Validated
Probab=98.87  E-value=7.1e-07  Score=68.58  Aligned_cols=128  Identities=23%  Similarity=0.304  Sum_probs=81.0

Q ss_pred             HHHHCHHHHHHHHHHHHHHHHCCCCCCCCCCCEEEEECCCCHHHHHHHHHHHHHCC-------CCE-----EEEEHHHHH
Q ss_conf             66534589999999998775204456578740688614320038899999873047-------733-----772068861
Q gi|254780163|r  477 TVVYGQEEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFALG-------VQL-----LRFDMSEYM  544 (798)
Q Consensus       477 ~~v~GQ~~ai~~v~~~i~~~~~gl~~~~rP~g~flf~GptGvGKTelak~la~~~~-------~~l-----ir~dmsey~  544 (798)
                      ..+|||++.+..+..++...|.        --.|||+||.|||||-+|+.+|..+.       .+-     ..-.|-++.
T Consensus        21 ~~liGQ~~~~~~l~n~i~~~~~--------~~aylf~G~rG~GKTt~Ari~ak~lnc~~~~~~~~~~~~c~~c~~c~~i~   92 (507)
T PRK06645         21 AELQGQEVLVKVLSYTILNDRL--------AGGYLLTGIRGVGKTTSARIIAKAVNCSALITENTTIKTCEKCTNCISFN   92 (507)
T ss_pred             HHHCCCHHHHHHHHHHHHCCCC--------CCEEEEECCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCHHHHHHH
T ss_conf             5623939999999999973996--------63477458799788999999999967999888899888888876789986


Q ss_pred             CCCCCCHH--CCCCCHHCCCCCCCCCCHHHHHCC----CEEEEECCHHHCCHHHHHHHHHHHHHHHCCCCCCCEECCCCE
Q ss_conf             24653011--047800025644431003555158----517774044550289999999987775021779977612542
Q gi|254780163|r  545 ERHAVSRL--IGAPPGYVGFGQGGILADSVDQNP----YSVVLLDEIEKSHPDVLNILLQIMDYGILTDQSGKKISFRNV  618 (798)
Q Consensus       545 e~~~vs~L--iGappGYvG~~egg~Lte~vr~~P----~sVvl~DEiEKAh~~v~~~llqild~G~ltd~~Gr~vdf~n~  618 (798)
                      +..++.-+  =+|  ---|-++=-.|.+.++..|    |-|..+||++.-..+.||.||..|++-           =.++
T Consensus        93 ~~~~~dv~EiDaa--s~~gv~~ir~l~~~~~~~p~~~~~kv~iidE~hmls~~a~nallktlEep-----------p~~~  159 (507)
T PRK06645         93 NHNHPDIIEIDAA--SKTSVDDIRRIIESAEYKPLQGKHKIFIIDEVHMLSKGAFNALLKTLEEP-----------PPHI  159 (507)
T ss_pred             CCCCCCEEEEECC--CCCCHHHHHHHHHHCCCCCCCCCEEEEEECCHHHCCHHHHHHHHHHHHCC-----------CCCE
T ss_conf             5899985996378--88888999999863551787674358995214224899999999974278-----------6443


Q ss_pred             EEEEECC
Q ss_conf             9999424
Q gi|254780163|r  619 ILIMTTN  625 (798)
Q Consensus       619 iii~TsN  625 (798)
                      ++||.++
T Consensus       160 ~Fi~att  166 (507)
T PRK06645        160 IFIFATT  166 (507)
T ss_pred             EEEEECC
T ss_conf             8999748


No 152
>PRK06647 DNA polymerase III subunits gamma and tau; Validated
Probab=98.84  E-value=9.5e-07  Score=67.64  Aligned_cols=129  Identities=25%  Similarity=0.387  Sum_probs=79.4

Q ss_pred             HHHHCHHHHHHHHHHHHHHHHCCCCCCCCCCCEEEEECCCCHHHHHHHHHHHHHC-CCCEEE-------EEHHHHHCCCC
Q ss_conf             6653458999999999877520445657874068861432003889999987304-773377-------20688612465
Q gi|254780163|r  477 TVVYGQEEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFAL-GVQLLR-------FDMSEYMERHA  548 (798)
Q Consensus       477 ~~v~GQ~~ai~~v~~~i~~~~~gl~~~~rP~g~flf~GptGvGKTelak~la~~~-~~~lir-------~dmsey~e~~~  548 (798)
                      ..|+||++++..+.+++...|.        --.|||+||.|+|||-+|+.+|..+ ...-..       -.|-+.....+
T Consensus        16 ~dvvGQe~vv~~L~nai~~~rl--------~HAyLFsGprG~GKTt~ArilAk~LnC~~~~~~~PCg~C~sC~~i~~g~~   87 (560)
T PRK06647         16 NSLEGQDFVVETLKHSIEKNKI--------ANAYIFSGPRGVGKTSSARAFARCLNCVNGPTIMPCGECFSCKSIDNDSS   87 (560)
T ss_pred             HHHCCCHHHHHHHHHHHHCCCC--------CCEEEEECCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCCHHHHHHHCCCC
T ss_conf             4403949999999999974997--------74366328998789999999999965999999888878878888745999


Q ss_pred             --CCHHCCCCCHHCCCCCCCCCCHHHHHCC----CEEEEECCHHHCCHHHHHHHHHHHHHHHCCCCCCCEECCCCEEEEE
Q ss_conf             --3011047800025644431003555158----5177740445502899999999877750217799776125429999
Q gi|254780163|r  549 --VSRLIGAPPGYVGFGQGGILADSVDQNP----YSVVLLDEIEKSHPDVLNILLQIMDYGILTDQSGKKISFRNVILIM  622 (798)
Q Consensus       549 --vs~LiGappGYvG~~egg~Lte~vr~~P----~sVvl~DEiEKAh~~v~~~llqild~G~ltd~~Gr~vdf~n~iii~  622 (798)
                        +-.+=|+  .-.|-++--.|.+.++..|    |-|+++||++.-+.+-+|.||..|++--           .+|++||
T Consensus        88 ~DviEidaa--sn~~VddIR~l~e~v~~~P~~~~yKV~IIDEahmLt~~A~NALLKtLEEPP-----------~~~~FIL  154 (560)
T PRK06647         88 LDVIEIDGA--SNTSVQDVRQIKEEIMFPPASSRYRVYIIDEVHMLSNSAFNALLKTIEEPP-----------PYIVFIF  154 (560)
T ss_pred             CCEEEECCC--CCCCHHHHHHHHHHHCCCCCCCCEEEEEECCHHHCCHHHHHHHHHHHHCCC-----------CCEEEEE
T ss_conf             875764364--548889999999986328766870699964656559999999999863488-----------7559999


Q ss_pred             ECCC
Q ss_conf             4242
Q gi|254780163|r  623 TTNA  626 (798)
Q Consensus       623 TsN~  626 (798)
                      .||-
T Consensus       155 aTte  158 (560)
T PRK06647        155 ATTE  158 (560)
T ss_pred             ECCC
T ss_conf             7799


No 153
>TIGR00635 ruvB Holliday junction DNA helicase RuvB; InterPro: IPR004605 All proteins in this family for which functions are known are 5'-3' DNA helicases that, as part of a complex with RuvA homologs serve as a 5'-3' Holliday junction helicase. RuvA specifically binds Holliday junctions as a sandwich of two tetramers and maintains the configuration of the junction. It forms a complex with two hexameric rings of RuvB, the subunit that contains helicase activity. The complex drives ATP-dependent branch migration of the Holliday junction recombination intermediate. The endonuclease RuvC resolves junctions.; GO: 0003677 DNA binding, 0005524 ATP binding, 0009378 Holliday junction helicase activity, 0006281 DNA repair, 0006310 DNA recombination.
Probab=98.84  E-value=2.9e-08  Score=78.52  Aligned_cols=192  Identities=22%  Similarity=0.340  Sum_probs=122.1

Q ss_pred             HHHHCHHHHHHHHHHHHHHHHCCCCCCCCCCCEEEEECCCCHHHHHHHHHHHHHCCCCEEEEEHHHHHCCCCCCHHCCCC
Q ss_conf             66534589999999998775204456578740688614320038899999873047733772068861246530110478
Q gi|254780163|r  477 TVVYGQEEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFALGVQLLRFDMSEYMERHAVSRLIGAP  556 (798)
Q Consensus       477 ~~v~GQ~~ai~~v~~~i~~~~~gl~~~~rP~g~flf~GptGvGKTelak~la~~~~~~lir~dmsey~e~~~vs~LiGap  556 (798)
                      +..|||++-.+.+.-.|+-||.    .+-++.=.||.||+|+|||-||..+|..++.++-..--.-..-           
T Consensus         4 ~eFiGQ~~vk~~L~l~I~AAk~----R~e~LDH~LL~GPPGLGKTTLA~IiA~Emg~~l~iTsGP~L~k-----------   68 (305)
T TIGR00635         4 AEFIGQEKVKEQLQLFIEAAKM----RQEALDHLLLYGPPGLGKTTLAHIIANEMGVNLKITSGPALEK-----------   68 (305)
T ss_pred             HHCCCCHHHHHHHHHHHHHHHH----CCCCCCCEEEECCCCCCHHHHHHHHHHHHCCCCEEEECCCCCC-----------
T ss_conf             1105828899999999999982----4897341663175687467899999998389326740675547-----------


Q ss_pred             CHHCCCCCCCCCCHHHHHCCCEEEEECCHHHCCHHHHHHHHHHHHHHHCC-----CCCCCEECCC---CEEEEEECCCCH
Q ss_conf             00025644431003555158517774044550289999999987775021-----7799776125---429999424214
Q gi|254780163|r  557 PGYVGFGQGGILADSVDQNPYSVVLLDEIEKSHPDVLNILLQIMDYGILT-----DQSGKKISFR---NVILIMTTNAGA  628 (798)
Q Consensus       557 pGYvG~~egg~Lte~vr~~P~sVvl~DEiEKAh~~v~~~llqild~G~lt-----d~~Gr~vdf~---n~iii~TsN~G~  628 (798)
                      ||    |=-|.||. +  .|..|++.|||+--+|.|-.+|+-.|||=+|-     +-..|+|...   =|+|=-||-.| 
T Consensus        69 Pg----DlaaiLt~-L--~~gDVLFIDEIHRL~p~~EE~LYpAMEDF~lDi~IG~Gp~Ar~v~ldLpPFTLvGATTR~G-  140 (305)
T TIGR00635        69 PG----DLAAILTN-L--EEGDVLFIDEIHRLSPAIEELLYPAMEDFRLDIVIGKGPSARSVRLDLPPFTLVGATTRAG-  140 (305)
T ss_pred             HH----HHHHHHHH-C--CCCCEEECCHHHHCCHHHHHHCCCCCCCEEEEEEEECCCCCCEEEECCCCCCCCCCCCCCC-
T ss_conf             57----89999970-5--6896310125650483345310530012178778712898525760686944200003477-


Q ss_pred             HHHHHCCCCCCCCCCHHHHHHHHHHHCCHHHHCCCCEEEECCCCCHHHHHHHHHHHHHHHHHHHHHCCCEEEECHHHHHH
Q ss_conf             55330368988211148899999872887881776828962889999999999999999999998669889998899999
Q gi|254780163|r  629 LEMSKARIGFGSSRNDDADKEALRNFLSPEFLNRLDSIIPFFPLSSDIIRQVVHKFIMKLELQLQEKGISFHFSEEVINW  708 (798)
Q Consensus       629 ~~~~~~~~g~~~~~~~~~~~~~l~~~f~peflnRid~ii~F~~l~~~~~~~i~~~~l~~l~~~l~~~~i~l~~~~~~~~~  708 (798)
                                       ....-|+..|.  ++.|+|      -.+.+++.+|+.+.=         .-..+++++.+...
T Consensus       141 -----------------~lt~PLrdRFG--~~~rl~------fY~~~EL~~Iv~R~A---------~~L~~ei~~~~a~~  186 (305)
T TIGR00635       141 -----------------MLTSPLRDRFG--IILRLE------FYTPEELAEIVSRSA---------GLLNIEIEQEAALE  186 (305)
T ss_pred             -----------------CCCCCHHHHHH--HHHHCC------CCCHHHHHHHHHHHH---------HHCCCCCCHHHHHH
T ss_conf             -----------------41031334544--745402------689878999987533---------44143007789999


Q ss_pred             HHHCCC-CCCCCCHHHHH
Q ss_conf             997189-81015326799
Q gi|254780163|r  709 LVSHGY-DVKMGARPLER  725 (798)
Q Consensus       709 l~~~~~-~~~~GAR~l~r  725 (798)
                      |+++.- .|.-=-|=|||
T Consensus       187 IArrSRGTPRIAnRLLRR  204 (305)
T TIGR00635       187 IARRSRGTPRIANRLLRR  204 (305)
T ss_pred             HHHHCCCCHHHHHHHHHH
T ss_conf             987547863788877676


No 154
>KOG0727 consensus
Probab=98.83  E-value=2e-08  Score=79.70  Aligned_cols=135  Identities=30%  Similarity=0.547  Sum_probs=90.3

Q ss_pred             CCCCCCCCCCCEEEEECCCCHHHHHHHHHHHHHCCCCEEEEEHHHHHCCCCCCHHCCCCCHHCCCCCCCCCCHH----HH
Q ss_conf             04456578740688614320038899999873047733772068861246530110478000256444310035----55
Q gi|254780163|r  498 AGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFALGVQLLRFDMSEYMERHAVSRLIGAPPGYVGFGQGGILADS----VD  573 (798)
Q Consensus       498 ~gl~~~~rP~g~flf~GptGvGKTelak~la~~~~~~lir~dmsey~e~~~vs~LiGappGYvG~~egg~Lte~----vr  573 (798)
                      .|+.+   |.|++|+ ||+|+|||.|||++|....-+|||+.-|||-.+            |.|  ||-....-    -|
T Consensus       184 igidp---prgvlly-gppg~gktml~kava~~t~a~firvvgsefvqk------------ylg--egprmvrdvfrlak  245 (408)
T KOG0727         184 IGIDP---PRGVLLY-GPPGTGKTMLAKAVANHTTAAFIRVVGSEFVQK------------YLG--EGPRMVRDVFRLAK  245 (408)
T ss_pred             HCCCC---CCCEEEE-CCCCCCHHHHHHHHHHCCCHHEEEECCHHHHHH------------HHC--CCCHHHHHHHHHHH
T ss_conf             08899---8622775-799975789999986126111446301899999------------855--48389999999876


Q ss_pred             HCCCEEEEECCHHH-----------CCHHHHHHHHHHHHHHHCCCCCCCEECCCCEEEEEECCCCHHHHHHCCCCCCCCC
Q ss_conf             15851777404455-----------0289999999987775021779977612542999942421455330368988211
Q gi|254780163|r  574 QNPYSVVLLDEIEK-----------SHPDVLNILLQIMDYGILTDQSGKKISFRNVILIMTTNAGALEMSKARIGFGSSR  642 (798)
Q Consensus       574 ~~P~sVvl~DEiEK-----------Ah~~v~~~llqild~G~ltd~~Gr~vdf~n~iii~TsN~G~~~~~~~~~g~~~~~  642 (798)
                      .+.-|+|+.|||+-           |.++|+.+|+.+|..   -|+-..+   .|.-+||.+|-...             
T Consensus       246 enapsiifideidaiatkrfdaqtgadrevqril~ellnq---mdgfdq~---~nvkvimatnradt-------------  306 (408)
T KOG0727         246 ENAPSIIFIDEIDAIATKRFDAQTGADREVQRILIELLNQ---MDGFDQT---TNVKVIMATNRADT-------------  306 (408)
T ss_pred             CCCCCEEEEEHHHHHHHHHCCCCCCCCHHHHHHHHHHHHH---CCCCCCC---CCEEEEEECCCCCC-------------
T ss_conf             1698379862245676641244446318999999999975---1476766---65589983275556-------------


Q ss_pred             CHHHHHHHHHHHCCHHHHCCCCEEEECCCCCHHHHHHH
Q ss_conf             14889999987288788177682896288999999999
Q gi|254780163|r  643 NDDADKEALRNFLSPEFLNRLDSIIPFFPLSSDIIRQV  680 (798)
Q Consensus       643 ~~~~~~~~l~~~f~peflnRid~ii~F~~l~~~~~~~i  680 (798)
                      .    .++   .++|   +|+|.-|-|- |...-..++
T Consensus       307 l----dpa---llrp---grldrkiefp-lpdrrqkrl  333 (408)
T KOG0727         307 L----DPA---LLRP---GRLDRKIEFP-LPDRRQKRL  333 (408)
T ss_pred             C----CHH---HCCC---CCCCCCCCCC-CCCHHHHHH
T ss_conf             6----876---6287---6434443577-985466522


No 155
>COG3829 RocR Transcriptional regulator containing PAS, AAA-type ATPase, and DNA-binding domains [Transcription / Signal transduction mechanisms]
Probab=98.83  E-value=5.8e-07  Score=69.19  Aligned_cols=214  Identities=18%  Similarity=0.249  Sum_probs=155.2

Q ss_pred             HHHHCHHHHHHHHHHHHHHHHCCCCCCCCCCCEEEEECCCCHHHHHHHHHHHHHC---CCCEEEEEHHHHHCCCCCCHHC
Q ss_conf             6653458999999999877520445657874068861432003889999987304---7733772068861246530110
Q gi|254780163|r  477 TVVYGQEEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFAL---GVQLLRFDMSEYMERHAVSRLI  553 (798)
Q Consensus       477 ~~v~GQ~~ai~~v~~~i~~~~~gl~~~~rP~g~flf~GptGvGKTelak~la~~~---~~~lir~dmsey~e~~~vs~Li  553 (798)
                      ..++|...++..+..-+++.-      ..+ .+.|..|-||+||--+|++.-..+   ..+||++||.-.-|.-==|-|.
T Consensus       245 ~~Iig~S~~m~~~~~~akr~A------~td-stVLi~GESGTGKElfA~~IH~~S~R~~~PFIaiNCaAiPe~LlESELF  317 (560)
T COG3829         245 DDIIGESPAMLRVLELAKRIA------KTD-STVLILGESGTGKELFARAIHNLSPRANGPFIAINCAAIPETLLESELF  317 (560)
T ss_pred             HHHCCCCHHHHHHHHHHHHHC------CCC-CCEEEECCCCCCHHHHHHHHHHCCCCCCCCEEEEECCCCCHHHHHHHHH
T ss_conf             002058999999999998633------899-8289953788668999999874484347980787643388888888872


Q ss_pred             CCCCHHCCCCCCCCCCHHHHH-CC-------CEEEEECCHHHCCHHHHHHHHHHHHHHHCC---CCCCCEECCCCEEEEE
Q ss_conf             478000256444310035551-58-------517774044550289999999987775021---7799776125429999
Q gi|254780163|r  554 GAPPGYVGFGQGGILADSVDQ-NP-------YSVVLLDEIEKSHPDVLNILLQIMDYGILT---DQSGKKISFRNVILIM  622 (798)
Q Consensus       554 GappGYvG~~egg~Lte~vr~-~P-------~sVvl~DEiEKAh~~v~~~llqild~G~lt---d~~Gr~vdf~n~iii~  622 (798)
                      |-       + .|-.|-|.+. +|       ..-++||||---....+--||.+|.++...   +.....||+|   ||-
T Consensus       318 Gy-------e-~GAFTGA~~~GK~GlfE~A~gGTLFLDEIgempl~LQaKLLRVLQEkei~rvG~t~~~~vDVR---IIA  386 (560)
T COG3829         318 GY-------E-KGAFTGASKGGKPGLFELANGGTLFLDEIGEMPLPLQAKLLRVLQEKEIERVGGTKPIPVDVR---IIA  386 (560)
T ss_pred             CC-------C-CCCCCCCCCCCCCCCEEECCCCEEEEHHHCCCCHHHHHHHHHHHHHCEEEECCCCCCEEEEEE---EEE
T ss_conf             76-------7-764246445799760544169837712320399899999999875353785378875356789---994


Q ss_pred             ECCCCHHHHHHCCCCCCCCCCHHHHHHHH-HHHCCHHHHCCCCEEEEC-CCC--CHHHHHHHHHHHHHHHHHHHHHCCCE
Q ss_conf             42421455330368988211148899999-872887881776828962-889--99999999999999999999866988
Q gi|254780163|r  623 TTNAGALEMSKARIGFGSSRNDDADKEAL-RNFLSPEFLNRLDSIIPF-FPL--SSDIIRQVVHKFIMKLELQLQEKGIS  698 (798)
Q Consensus       623 TsN~G~~~~~~~~~g~~~~~~~~~~~~~l-~~~f~peflnRid~ii~F-~~l--~~~~~~~i~~~~l~~l~~~l~~~~i~  698 (798)
                      ++|---                   .+.+ ...||-.+.=|++.+-++ -||  -++++.-++.-+|.+.++++...  -
T Consensus       387 ATN~nL-------------------~~~i~~G~FReDLYYRLNV~~i~iPPLReR~eDI~~L~~~Fl~k~s~~~~~~--v  445 (560)
T COG3829         387 ATNRNL-------------------EKMIAEGTFREDLYYRLNVIPITIPPLRERKEDIPLLAEYFLDKFSRRYGRN--V  445 (560)
T ss_pred             CCCCCH-------------------HHHHHCCCCHHHHEEEECEEEECCCCCCCCCCHHHHHHHHHHHHHHHHCCCC--C
T ss_conf             257589-------------------9998639616553003040111477723382018999999999999872887--6


Q ss_pred             EEECHHHHHHHHHCCCCCCCCCHHHHHHHHHHH
Q ss_conf             999889999999718981015326799999862
Q gi|254780163|r  699 FHFSEEVINWLVSHGYDVKMGARPLERIIKEHV  731 (798)
Q Consensus       699 l~~~~~~~~~l~~~~~~~~~GAR~l~r~i~~~i  731 (798)
                      -.+++++...|...-+--  --|.|..+|++-+
T Consensus       446 ~~ls~~a~~~L~~y~WPG--NVRELeNviER~v  476 (560)
T COG3829         446 KGLSPDALALLLRYDWPG--NVRELENVIERAV  476 (560)
T ss_pred             CCCCHHHHHHHHHCCCCC--HHHHHHHHHHHHH
T ss_conf             668999999998689996--0999999999998


No 156
>COG1474 CDC6 Cdc6-related protein, AAA superfamily ATPase [DNA replication, recombination, and repair / Posttranslational modification, protein turnover, chaperones]
Probab=98.83  E-value=3.2e-06  Score=63.89  Aligned_cols=229  Identities=17%  Similarity=0.258  Sum_probs=138.8

Q ss_pred             HHHHHHHHHHHHHHHH----CCCCCCEEEECCCCCHHHHHHHHHHHHHHCCCC-C-HHHHEEEEEEEE---HHHHHC---
Q ss_conf             2217899999999862----267787489667641166899999999854898-8-345201445540---467530---
Q gi|254780163|r  206 LVGRHEEINRTIQILC----RRSKNNPLYVGDPGVGKTAIAEGFAKQIVDGMV-P-DILLGARIFSLD---MGNLIA---  273 (798)
Q Consensus       206 VIGRd~EI~riiqIL~----RR~KNn~~lvG~~gvGktaive~la~~i~~~~v-p-~~l~~~~i~~ld---~~~l~a---  273 (798)
                      +-+||.||+++..+|.    --+..|.++.|.||+|||+++.-+++.+.+... + ..--|+..+.--   ...+..   
T Consensus        19 l~~Re~ei~~l~~~l~~~~~~~~p~n~~iyG~~GTGKT~~~~~v~~~l~~~~~~~~~~yINc~~~~t~~~i~~~i~~~~~   98 (366)
T COG1474          19 LPHREEEINQLASFLAPALRGERPSNIIIYGPTGTGKTATVKFVMEELEESSANVEVVYINCLELRTPYQVLSKILNKLG   98 (366)
T ss_pred             CCCHHHHHHHHHHHHHHHHCCCCCCCEEEECCCCCCHHHHHHHHHHHHHHHCCCCCEEEEEEEECCCHHHHHHHHHHHHC
T ss_conf             10348899999999999855899860799889998732899999999973315675799951307878799999999826


Q ss_pred             CCCCCCH-HHHHHHHHHHHHCC-CCCEEEEECCHHHHHCCCCCCCCCCCHHHHHHH-HHCCCCEEEEEECCHHHHHHHHH
Q ss_conf             6343123-78999999987203-898399973616630155444344777888876-63026603887304899999852
Q gi|254780163|r  274 GTRYRGD-FEERIKKIVKEIES-YANAILYIDEIHTLVGAGSASGISVDASNLLKP-ALSSGAVRCIGSTTYSEYRQFFE  350 (798)
Q Consensus       274 g~~~rg~-fe~r~~~~~~~~~~-~~~~ilfideih~ligag~~~g~~~d~an~lkP-~L~rg~~~~IgatT~~ey~~~~e  350 (798)
                      .....|- .-+-++.+.+.+.. .+.+|+..||+-.|+....   ..  .-++++- ......+-+||.+....|..++ 
T Consensus        99 ~~p~~g~~~~~~~~~l~~~~~~~~~~~IvvLDEid~L~~~~~---~~--LY~L~r~~~~~~~~v~vi~i~n~~~~~~~l-  172 (366)
T COG1474          99 KVPLTGDSSLEILKRLYDNLSKKGKTVIVILDEVDALVDKDG---EV--LYSLLRAPGENKVKVSIIAVSNDDKFLDYL-  172 (366)
T ss_pred             CCCCCCCCHHHHHHHHHHHHHHCCCEEEEEECCHHHHHCCCC---CH--HHHEECCCCCCCEEEEEEEEECCHHHHHHH-
T ss_conf             899767632689999999777418759999764765415464---14--551112477675379999973548899987-


Q ss_pred             CCHHHHHHCEE--EEECCCCHHHHHHHHHHHHHHHHHHCCCEECCHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHH
Q ss_conf             01114320014--4306878689999998612766541035121117899999865420155564679889986533332
Q gi|254780163|r  351 KDKALVRRFQK--IDVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLPDKAIDVIDEAGASQI  428 (798)
Q Consensus       351 ~d~al~rrF~~--i~v~ep~~~~~~~iL~~~~~~ye~~h~v~~~~~al~~av~ls~ryi~~r~lPdkAidllDea~a~~~  428 (798)
                       |+-+..+|++  |..++=+.++-..||+.-..  +.+-.=.+++++++.|...+.+.-.|   --+|||+|..||-.+ 
T Consensus       173 -d~rv~s~l~~~~I~F~pY~a~el~~Il~~R~~--~~~~~~~~~~~vl~lia~~~a~~~GD---AR~aidilr~A~eiA-  245 (366)
T COG1474         173 -DPRVKSSLGPSEIVFPPYTAEELYDILRERVE--EGFSAGVIDDDVLKLIAALVAAESGD---ARKAIDILRRAGEIA-  245 (366)
T ss_pred             -HHHHHHCCCCCEEEECCCCHHHHHHHHHHHHH--HHHCCCCCCHHHHHHHHHHHHHCCCC---HHHHHHHHHHHHHHH-
T ss_conf             -56676506876355289898999999999998--54046874803999999988761864---776089999999986-


Q ss_pred             HHHHHHHHCCCCHHHHHHHHHH
Q ss_conf             1144322113657899986631
Q gi|254780163|r  429 LQPLSKRRKFITEKDIKKTIAS  450 (798)
Q Consensus       429 ~~~~~~~~~~~~~~~i~~~~~~  450 (798)
                         .......+++.++......
T Consensus       246 ---e~~~~~~v~~~~v~~a~~~  264 (366)
T COG1474         246 ---EREGSRKVSEDHVREAQEE  264 (366)
T ss_pred             ---HHCCCCCCCHHHHHHHHHH
T ss_conf             ---5407885370047889987


No 157
>PRK08691 DNA polymerase III subunits gamma and tau; Validated
Probab=98.81  E-value=4.2e-06  Score=63.00  Aligned_cols=40  Identities=10%  Similarity=0.267  Sum_probs=21.8

Q ss_pred             CHHHHEEEEEEEEHHHHHCCCCCCCHHHHHHHHHHHHHCCCCCEEEEE
Q ss_conf             834520144554046753063431237899999998720389839997
Q gi|254780163|r  255 PDILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIESYANAILYI  302 (798)
Q Consensus       255 p~~l~~~~i~~ld~~~l~ag~~~rg~fe~r~~~~~~~~~~~~~~ilfi  302 (798)
                      .+....++||-+|-.-|+....        +..+++.++..+.-+.||
T Consensus       114 ~P~~~~yKVyiiDEvhmLs~~a--------fNAlLKtLEEPP~~v~Fi  153 (704)
T PRK08691        114 APTAGKYKVYIIDEVHMLSKSA--------FNAMLKTLEEPPEHVKFI  153 (704)
T ss_pred             CCCCCCEEEEEEECHHHCCHHH--------HHHHHHHHCCCCCCEEEE
T ss_conf             8867853599983154438999--------999998614797560899


No 158
>PRK00149 dnaA chromosomal replication initiation protein; Reviewed
Probab=98.81  E-value=2.9e-07  Score=71.38  Aligned_cols=155  Identities=19%  Similarity=0.343  Sum_probs=102.4

Q ss_pred             CCEEEE-CCCCCHHHHHHHHHHHHHHCCCCCHHHHEEEEEEEEHHHHHC----CCCCCCHHHHHHHHHHHHHCCCCCEEE
Q ss_conf             874896-676411668999999998548988345201445540467530----634312378999999987203898399
Q gi|254780163|r  226 NNPLYV-GDPGVGKTAIAEGFAKQIVDGMVPDILLGARIFSLDMGNLIA----GTRYRGDFEERIKKIVKEIESYANAIL  300 (798)
Q Consensus       226 Nn~~lv-G~~gvGktaive~la~~i~~~~vp~~l~~~~i~~ld~~~l~a----g~~~rg~fe~r~~~~~~~~~~~~~~il  300 (798)
                      -||++| |.+|+|||.+.++++..+.+.. |    +++|+-+....++.    ..+- +..    ...-+..+ +- -+|
T Consensus       145 yNPLfIyG~~GlGKTHLl~AIgn~~~~~~-p----~~~v~Y~tae~F~~~~v~al~~-~~~----~~Fr~~yr-~~-DvL  212 (447)
T PRK00149        145 YNPLFIYGGVGLGKTHLLHAIGNYILEKN-P----NAKVVYVSSEKFTNDFVKALRN-NAM----EEFKEKYR-SV-DVL  212 (447)
T ss_pred             CCCEEEECCCCCCHHHHHHHHHHHHHHHC-C----CCEEEEEEHHHHHHHHHHHHHC-CCH----HHHHHHHH-CC-CEE
T ss_conf             78558977998878899999999999858-9----9728995499999999999851-869----99999997-28-854


Q ss_pred             EECCHHHHHCCCCCCCCCCCHHHHHHHHHCCCCEEEEEE-CCHHHHHHHHHCCHHHHHHCEE---EEECCCCHHHHHHHH
Q ss_conf             973616630155444344777888876630266038873-0489999985201114320014---430687868999999
Q gi|254780163|r  301 YIDEIHTLVGAGSASGISVDASNLLKPALSSGAVRCIGS-TTYSEYRQFFEKDKALVRRFQK---IDVSEPSIEDAIEIV  376 (798)
Q Consensus       301 fideih~ligag~~~g~~~d~an~lkP~L~rg~~~~Iga-tT~~ey~~~~e~d~al~rrF~~---i~v~ep~~~~~~~iL  376 (798)
                      .||+||-+-|-.++..   -.-+++--....|.--++.+ ..|.|...   -|.-|..||+-   +.+.+|+.+..+.||
T Consensus       213 liDDiqfl~gk~~tqe---eff~~fn~l~~~~kqiv~tsd~~P~~l~~---l~~rL~SRf~~Gl~~~i~~Pd~e~r~~Il  286 (447)
T PRK00149        213 LIDDIQFLAGKEKTQE---EFFHTFNALHENNKQIVITSDRPPKELEG---LEDRLRSRFEWGLTVDIEPPDLETRVAIL  286 (447)
T ss_pred             EECHHHHHHCCHHHHH---HHHHHHHHHHHCCCEEEEECCCCHHHCCC---CCHHHHHHHHCCEEEECCCCCHHHHHHHH
T ss_conf             3214888605577999---99999999998499689957889676565---11778867637626510599999999999


Q ss_pred             HHHHHHHHHHCCCEECCHHHHHHHHH
Q ss_conf             86127665410351211178999998
Q gi|254780163|r  377 KGIKPYFEEHHQLRYSKEAIRAAVQL  402 (798)
Q Consensus       377 ~~~~~~ye~~h~v~~~~~al~~av~l  402 (798)
                      +....    .+++.+++++++..++-
T Consensus       287 ~~k~~----~~~~~l~~~v~~~iA~~  308 (447)
T PRK00149        287 QKKAE----EEGINLPNEVLEFIAKR  308 (447)
T ss_pred             HHHHH----HCCCCCCHHHHHHHHHH
T ss_conf             99999----72899998999999971


No 159
>COG1223 Predicted ATPase (AAA+ superfamily) [General function prediction only]
Probab=98.80  E-value=2.5e-07  Score=71.80  Aligned_cols=221  Identities=26%  Similarity=0.417  Sum_probs=143.4

Q ss_pred             HHHHHHCCCCHHHHHHHHHHHHHHHHHHCCCCC----------CEEEECCCCCHHHHHHHHHHHHHHCCCCCHHHHEEEE
Q ss_conf             588775486112221789999999986226778----------7489667641166899999999854898834520144
Q gi|254780163|r  194 LTEKVKKGKVDILVGRHEEINRTIQILCRRSKN----------NPLYVGDPGVGKTAIAEGFAKQIVDGMVPDILLGARI  263 (798)
Q Consensus       194 LTe~AreGKLDPVIGRd~EI~riiqIL~RR~KN----------n~~lvG~~gvGktaive~la~~i~~~~vp~~l~~~~i  263 (798)
                      .++.-.+-.+|-|||.++- +|-..++.+--+|          |++.-|+||.|||-.+..||.   +.+||       +
T Consensus       111 ~~e~~~~it~ddViGqEeA-K~kcrli~~yLenPe~Fg~WAPknVLFyGppGTGKTm~Akalan---e~kvp-------~  179 (368)
T COG1223         111 DREIISDITLDDVIGQEEA-KRKCRLIMEYLENPERFGDWAPKNVLFYGPPGTGKTMMAKALAN---EAKVP-------L  179 (368)
T ss_pred             HHHHHCCCCHHHHHCHHHH-HHHHHHHHHHHHCHHHHCCCCCCEEEEECCCCCCHHHHHHHHHC---CCCCC-------E
T ss_conf             5566136617664163988-88879999996496876345754168778999648799998725---45785-------4


Q ss_pred             EEEEHHHHHCCCCCCCHHHHHHHHHHHHHCCCCCEEEEECCHHHHHCC-CCCCCCCCCHH---HHHHHHH----CCCCEE
Q ss_conf             554046753063431237899999998720389839997361663015-54443447778---8887663----026603
Q gi|254780163|r  264 FSLDMGNLIAGTRYRGDFEERIKKIVKEIESYANAILYIDEIHTLVGA-GSASGISVDAS---NLLKPAL----SSGAVR  335 (798)
Q Consensus       264 ~~ld~~~l~ag~~~rg~fe~r~~~~~~~~~~~~~~ilfideih~liga-g~~~g~~~d~a---n~lkP~L----~rg~~~  335 (798)
                      +.+..+.|+.  .|.|+=-+|+..+.+-+++..+.|.||||+..|-=. +-++ --.|++   |-|..-|    .+-.+-
T Consensus       180 l~vkat~liG--ehVGdgar~Ihely~rA~~~aPcivFiDE~DAiaLdRryQe-lRGDVsEiVNALLTelDgi~eneGVv  256 (368)
T COG1223         180 LLVKATELIG--EHVGDGARRIHELYERARKAAPCIVFIDELDAIALDRRYQE-LRGDVSEIVNALLTELDGIKENEGVV  256 (368)
T ss_pred             EEECHHHHHH--HHHHHHHHHHHHHHHHHHHCCCEEEEEHHHHHHHHHHHHHH-HCCCHHHHHHHHHHHCCCCCCCCCEE
T ss_conf             8711688888--77435989999999988751984998400245553045788-64549999999998501744577569


Q ss_pred             EEEECCHHHHHHHHHCCHHHHHHCE-EEEECCCCHHHHHHHHHHHHHHHHHHCCCEECCHHHHHHHH----HHHHHCCCC
Q ss_conf             8873048999998520111432001-44306878689999998612766541035121117899999----865420155
Q gi|254780163|r  336 CIGSTTYSEYRQFFEKDKALVRRFQ-KIDVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQ----LSVRHFTSR  410 (798)
Q Consensus       336 ~IgatT~~ey~~~~e~d~al~rrF~-~i~v~ep~~~~~~~iL~~~~~~ye~~h~v~~~~~al~~av~----ls~ryi~~r  410 (798)
                      .|+||..-+     --|+|...||+ -|.-.=|+.++-+.||+-    |-+..-+...-. +.+.+.    +|.|-|.+|
T Consensus       257 tIaaTN~p~-----~LD~aiRsRFEeEIEF~LP~~eEr~~ile~----y~k~~Plpv~~~-~~~~~~~t~g~SgRdikek  326 (368)
T COG1223         257 TIAATNRPE-----LLDPAIRSRFEEEIEFKLPNDEERLEILEY----YAKKFPLPVDAD-LRYLAAKTKGMSGRDIKEK  326 (368)
T ss_pred             EEEECCCHH-----HCCHHHHHHHHHEEEEECCCHHHHHHHHHH----HHHHCCCCCCCC-HHHHHHHHCCCCCHHHHHH
T ss_conf             995059846-----507888865565065648885899999999----898589765568-9999998478772068999


Q ss_pred             CCHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHH
Q ss_conf             5646798899865333321144322113657899986631
Q gi|254780163|r  411 KLPDKAIDVIDEAGASQILQPLSKRRKFITEKDIKKTIAS  450 (798)
Q Consensus       411 ~lPdkAidllDea~a~~~~~~~~~~~~~~~~~~i~~~~~~  450 (798)
                      .|        ..|    -.++..+.+..|..+|+..++.+
T Consensus       327 vl--------K~a----Lh~Ai~ed~e~v~~edie~al~k  354 (368)
T COG1223         327 VL--------KTA----LHRAIAEDREKVEREDIEKALKK  354 (368)
T ss_pred             HH--------HHH----HHHHHHHCHHHHHHHHHHHHHHH
T ss_conf             99--------999----99998713444338899999986


No 160
>PRK05896 DNA polymerase III subunits gamma and tau; Validated
Probab=98.80  E-value=1.6e-06  Score=65.93  Aligned_cols=127  Identities=27%  Similarity=0.363  Sum_probs=73.8

Q ss_pred             HHHHCHHHHHHHHHHHHHHHHCCCCCCCCCCCEEEEECCCCHHHHHHHHHHHHHC-CCCEEEEEHHHHHCCCCCCH--HC
Q ss_conf             6653458999999999877520445657874068861432003889999987304-77337720688612465301--10
Q gi|254780163|r  477 TVVYGQEEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFAL-GVQLLRFDMSEYMERHAVSR--LI  553 (798)
Q Consensus       477 ~~v~GQ~~ai~~v~~~i~~~~~gl~~~~rP~g~flf~GptGvGKTelak~la~~~-~~~lir~dmsey~e~~~vs~--Li  553 (798)
                      ..|+||++++..+..++...|        ---+|||+||.|||||-+|+.+|..+ ..+--.-+   -+......+  .-
T Consensus        16 ~eIIGQe~iv~~L~nAI~~~R--------iaHAYLFsGPrGvGKTTlArifAkaLnC~~~~~~d---pCg~C~sC~~I~~   84 (613)
T PRK05896         16 KQIIGQELIKKILVNAILNNK--------LTHAYIFSGPRGIGKTSIAKIFAKAINCLNPKDGD---CCNSCSVCESINT   84 (613)
T ss_pred             HHHCCCHHHHHHHHHHHHCCC--------CCCEEEEECCCCCCHHHHHHHHHHHHCCCCCCCCC---CCCCCHHHHHHHC
T ss_conf             552382999999999998499--------76227755899848899999999996699999999---8888878999856


Q ss_pred             CCCCH--------HCCCCCCCCCCHHHHHCC----CEEEEECCHHHCCHHHHHHHHHHHHHHHCCCCCCCEECCCCEEEE
Q ss_conf             47800--------025644431003555158----517774044550289999999987775021779977612542999
Q gi|254780163|r  554 GAPPG--------YVGFGQGGILADSVDQNP----YSVVLLDEIEKSHPDVLNILLQIMDYGILTDQSGKKISFRNVILI  621 (798)
Q Consensus       554 GappG--------YvG~~egg~Lte~vr~~P----~sVvl~DEiEKAh~~v~~~llqild~G~ltd~~Gr~vdf~n~iii  621 (798)
                      |+-|-        .-|-++--.|.+.+...|    |-|.++||.+...++-+|.||..|+|-           =.++++|
T Consensus        85 g~h~DviEIdaasn~gIDeIReLie~~~~~P~~gkyKV~IIDEah~Ln~~AaNALLKtLEEP-----------P~~viFI  153 (613)
T PRK05896         85 NQSVDIVELDAASNNGVDEIRNIIDNINYLPTTFKYKVYIIDEAHMLSTSAWNALLKTLEEP-----------PKHVVFI  153 (613)
T ss_pred             CCCCCEEEEECCCCCCHHHHHHHHHHHCCCCCCCCCEEEEECCHHHCCHHHHHHHHHHCCCC-----------CCCCEEE
T ss_conf             99998688406555788999999997085875799459998162217999999999853489-----------8783799


Q ss_pred             EECC
Q ss_conf             9424
Q gi|254780163|r  622 MTTN  625 (798)
Q Consensus       622 ~TsN  625 (798)
                      |.|+
T Consensus       154 L~Tt  157 (613)
T PRK05896        154 FATT  157 (613)
T ss_pred             EEEC
T ss_conf             9828


No 161
>PRK07133 DNA polymerase III subunits gamma and tau; Validated
Probab=98.80  E-value=1.6e-06  Score=66.12  Aligned_cols=38  Identities=13%  Similarity=0.381  Sum_probs=23.5

Q ss_pred             HHHEEEEEEEEHHHHHCCCCCCCHHHHHHHHHHHHHCCCCCEEEEE
Q ss_conf             4520144554046753063431237899999998720389839997
Q gi|254780163|r  257 ILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIESYANAILYI  302 (798)
Q Consensus       257 ~l~~~~i~~ld~~~l~ag~~~rg~fe~r~~~~~~~~~~~~~~ilfi  302 (798)
                      .-..++||-+|-.-|+...        -..++++-++..+.-++||
T Consensus       115 ~~gkYKVyIIDEvHMLS~~--------AfNALLKtLEEPP~hvvFI  152 (718)
T PRK07133        115 QISKYKIYIIDEVHMLSKS--------AFNALLKTLEEPPKHVIFI  152 (718)
T ss_pred             CCCCEEEEEEECCCCCCHH--------HHHHHHHHHCCCCCCCEEE
T ss_conf             7787249999662007999--------9999998502798782799


No 162
>COG1474 CDC6 Cdc6-related protein, AAA superfamily ATPase [DNA replication, recombination, and repair / Posttranslational modification, protein turnover, chaperones]
Probab=98.79  E-value=1.9e-07  Score=72.70  Aligned_cols=209  Identities=21%  Similarity=0.210  Sum_probs=130.5

Q ss_pred             CCHHHHHHHCHHHHHHHHHHHHHHHHCCCCCCCCCCCEEEEECCCCHHHHHHHHHHHHHCCCC-----EEEEEHHHHHCC
Q ss_conf             000246653458999999999877520445657874068861432003889999987304773-----377206886124
Q gi|254780163|r  472 EKNLGTVVYGQEEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFALGVQ-----LLRFDMSEYMER  546 (798)
Q Consensus       472 ~~~l~~~v~GQ~~ai~~v~~~i~~~~~gl~~~~rP~g~flf~GptGvGKTelak~la~~~~~~-----lir~dmsey~e~  546 (798)
                      +..+..++.+-++-+.++...+.-.-.    ..+|. +++..||||+|||-+++-+....+..     .+.+||-+|..+
T Consensus        12 ~~~iP~~l~~Re~ei~~l~~~l~~~~~----~~~p~-n~~iyG~~GTGKT~~~~~v~~~l~~~~~~~~~~yINc~~~~t~   86 (366)
T COG1474          12 EDYIPEELPHREEEINQLASFLAPALR----GERPS-NIIIYGPTGTGKTATVKFVMEELEESSANVEVVYINCLELRTP   86 (366)
T ss_pred             CCCCCHHCCCHHHHHHHHHHHHHHHHC----CCCCC-CEEEECCCCCCHHHHHHHHHHHHHHHCCCCCEEEEEEEECCCH
T ss_conf             555822010348899999999999855----89986-0799889998732899999999973315675799951307878


Q ss_pred             CCCCHHC----CCCCHHCCCCCC---CCCCHHHHH-CCCEEEEECCHHHCCHHHHHHHHHHHHHHHCCCCCCCEECCCCE
Q ss_conf             6530110----478000256444---310035551-58517774044550289999999987775021779977612542
Q gi|254780163|r  547 HAVSRLI----GAPPGYVGFGQG---GILADSVDQ-NPYSVVLLDEIEKSHPDVLNILLQIMDYGILTDQSGKKISFRNV  618 (798)
Q Consensus       547 ~~vs~Li----GappGYvG~~eg---g~Lte~vr~-~P~sVvl~DEiEKAh~~v~~~llqild~G~ltd~~Gr~vdf~n~  618 (798)
                      ..|...|    |.+| .-|.--.   ..|-+.+.. ....||.+||++.--..-.++|++++.-..   ..     -.+.
T Consensus        87 ~~i~~~i~~~~~~~p-~~g~~~~~~~~~l~~~~~~~~~~~IvvLDEid~L~~~~~~~LY~L~r~~~---~~-----~~~v  157 (366)
T COG1474          87 YQVLSKILNKLGKVP-LTGDSSLEILKRLYDNLSKKGKTVIVILDEVDALVDKDGEVLYSLLRAPG---EN-----KVKV  157 (366)
T ss_pred             HHHHHHHHHHHCCCC-CCCCCHHHHHHHHHHHHHHCCCEEEEEECCHHHHHCCCCCHHHHEECCCC---CC-----CEEE
T ss_conf             799999999826899-76763268999999977741875999976476541546414551112477---67-----5379


Q ss_pred             EEEEECCCCHHHHHHCCCCCCCCCCHHHHHHHHHHHCCHHHHCCCCEEEECCCCCHHHHHHHHHHHHHHHHHHHHHCCCE
Q ss_conf             99994242145533036898821114889999987288788177682896288999999999999999999999866988
Q gi|254780163|r  619 ILIMTTNAGALEMSKARIGFGSSRNDDADKEALRNFLSPEFLNRLDSIIPFFPLSSDIIRQVVHKFIMKLELQLQEKGIS  698 (798)
Q Consensus       619 iii~TsN~G~~~~~~~~~g~~~~~~~~~~~~~l~~~f~peflnRid~ii~F~~l~~~~~~~i~~~~l~~l~~~l~~~~i~  698 (798)
                      ++|..+|-         .     .-.....+.++..|.|       .-|+|.|.+.+++..|+........       ..
T Consensus       158 ~vi~i~n~---------~-----~~~~~ld~rv~s~l~~-------~~I~F~pY~a~el~~Il~~R~~~~~-------~~  209 (366)
T COG1474         158 SIIAVSND---------D-----KFLDYLDPRVKSSLGP-------SEIVFPPYTAEELYDILRERVEEGF-------SA  209 (366)
T ss_pred             EEEEEECC---------H-----HHHHHHHHHHHHCCCC-------CEEEECCCCHHHHHHHHHHHHHHHH-------CC
T ss_conf             99997354---------8-----8999875667650687-------6355289898999999999998540-------46


Q ss_pred             EEECHHHHHHHHHCCCCCCCCCHH
Q ss_conf             999889999999718981015326
Q gi|254780163|r  699 FHFSEEVINWLVSHGYDVKMGARP  722 (798)
Q Consensus       699 l~~~~~~~~~l~~~~~~~~~GAR~  722 (798)
                      -.+++.+.++++...-...--||-
T Consensus       210 ~~~~~~vl~lia~~~a~~~GDAR~  233 (366)
T COG1474         210 GVIDDDVLKLIAALVAAESGDARK  233 (366)
T ss_pred             CCCCHHHHHHHHHHHHHCCCCHHH
T ss_conf             874803999999988761864776


No 163
>TIGR02928 TIGR02928 orc1/cdc6 family replication initiation protein; InterPro: IPR014277   This set of DNA binding proteins shows homology to the origin recognition complex subunit 1/cell division control protein 6 family in eukaryotes. The proteins in this entry are found exclusively in the archaea. Several members may be found in a genome and interact with each other..
Probab=98.79  E-value=3.8e-08  Score=77.72  Aligned_cols=220  Identities=18%  Similarity=0.279  Sum_probs=145.9

Q ss_pred             CHHHH--HHHCHHHHHHHHHHHHHHHHC-CCCCCCCCCCEEEEECCCCHHHHHHHHHHH---------HHCC-CCEEEEE
Q ss_conf             00246--653458999999999877520-445657874068861432003889999987---------3047-7337720
Q gi|254780163|r  473 KNLGT--VVYGQEEAIKKLSSSIKIARA-GLSDPNKPIGCYVFSGPTGVGKTEISKQLA---------FALG-VQLLRFD  539 (798)
Q Consensus       473 ~~l~~--~v~GQ~~ai~~v~~~i~~~~~-gl~~~~rP~g~flf~GptGvGKTelak~la---------~~~~-~~lir~d  539 (798)
                      ..+-.  +++|=|+=|+.++.+++-+.- |    .+|.-+|+ -||||||||-.+|.+.         ++.. -..+.+|
T Consensus        11 dY~Pden~i~hRdeqI~~l~~~L~~~l~PG----~~P~Ni~i-YGkTGtGKT~vt~~v~~~l~~~~~~~d~~D~~~~~~N   85 (383)
T TIGR02928        11 DYVPDENRIVHRDEQIEELAKALRPILRPG----SRPSNIFI-YGKTGTGKTAVTKYVMKELEEAAEDRDVRDVSTVYIN   85 (383)
T ss_pred             CCCCCCCCCCCCHHHHHHHHHHHHHHHCCC----CCCCCEEE-ECCCCCCHHHHHHHHHHHHHHHHHCCCCCCEEEEEEC
T ss_conf             770274246686789999999988750674----89872588-7888987889999999999998622699715899977


Q ss_pred             HH----HHHCCCCCCH-H----CCCCCHHCCCCCC---CCCCHHHH-H-CCCEEEEECCHHHC---CHH---HHHHHHHH
Q ss_conf             68----8612465301-1----0478000256444---31003555-1-58517774044550---289---99999998
Q gi|254780163|r  540 MS----EYMERHAVSR-L----IGAPPGYVGFGQG---GILADSVD-Q-NPYSVVLLDEIEKS---HPD---VLNILLQI  599 (798)
Q Consensus       540 ms----ey~e~~~vs~-L----iGappGYvG~~eg---g~Lte~vr-~-~P~sVvl~DEiEKA---h~~---v~~~llqi  599 (798)
                      |-    +|+---++.. |    .|.-+=+-|+-..   ..|.+.+. . ...-||.||||++=   +.|   .-.+|+|+
T Consensus        86 C~~~~T~y~~~~~L~~~ln~~~~~~~vP~tG~s~~~~~~~l~~~l~~~~~~~~~ivLDEiD~Lv~~~~d~PAyS~~LY~L  165 (383)
T TIGR02928        86 CQILDTSYQVLVELANQLNRRGSGEEVPTTGLSTSEVFRELYKELNRERGDSLIIVLDEIDKLVRKDDDDPAYSKLLYQL  165 (383)
T ss_pred             CCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHCCCEEEEEECCCCHHHCCCCCCHHHHHHHHHH
T ss_conf             85468469999999998515778888988778789999999999832018879998623102215888880787885343


Q ss_pred             HHHHHCCCCCCCEECCCCEEEEEECCCCHHHHHHCCCCCCCCCCHHHHHHHHHHHCCHHHHCCCCEEEECCCCCHHHHHH
Q ss_conf             77750217799776125429999424214553303689882111488999998728878817768289628899999999
Q gi|254780163|r  600 MDYGILTDQSGKKISFRNVILIMTTNAGALEMSKARIGFGSSRNDDADKEALRNFLSPEFLNRLDSIIPFFPLSSDIIRQ  679 (798)
Q Consensus       600 ld~G~ltd~~Gr~vdf~n~iii~TsN~G~~~~~~~~~g~~~~~~~~~~~~~l~~~f~peflnRid~ii~F~~l~~~~~~~  679 (798)
                      .--    .++|..=+++=+||-.|.++          .|     .+.+.+.++..|.|       +-|.|-|.+.++++.
T Consensus       166 ~Ra----~~~~~~~~~~vgvIgISND~----------~f-----~~~Ld~RVkSsL~~-------eei~FpPYdA~eL~~  219 (383)
T TIGR02928       166 SRA----RENGDLENAKVGVIGISNDL----------KF-----RENLDPRVKSSLCE-------EEIVFPPYDAEELRD  219 (383)
T ss_pred             HHH----HHCCCCCCCCEEEEEEECCC----------HH-----HHHCCCCEECCCCC-------CCCEECCCCHHHHHH
T ss_conf             310----00357788534899986571----------43-----64457530132487-------400407988699999


Q ss_pred             HHHHHH-HH-HHHHHHHCCCEEEECHHHHHHHHHCCCCCCCCCHHHHHHHHHHH
Q ss_conf             999999-99-99999866988999889999999718981015326799999862
Q gi|254780163|r  680 VVHKFI-MK-LELQLQEKGISFHFSEEVINWLVSHGYDVKMGARPLERIIKEHV  731 (798)
Q Consensus       680 i~~~~l-~~-l~~~l~~~~i~l~~~~~~~~~l~~~~~~~~~GAR~l~r~i~~~i  731 (798)
                      |+.... +. +.     -|   .++|+|+...|..+=...--||--=++++.-.
T Consensus       220 IL~~R~v~~AF~-----dG---vl~d~VI~lcAA~aAq~hGDAR~AiDLLR~AG  265 (383)
T TIGR02928       220 ILENRAVEKAFY-----DG---VLDDGVIPLCAALAAQEHGDARKAIDLLRVAG  265 (383)
T ss_pred             HHHHHHHHHCCC-----CC---CCCHHHHHHHHHHHHCCCCCHHHHHHHHHHHH
T ss_conf             997203120336-----88---54622799999986206787899999999876


No 164
>KOG0739 consensus
Probab=98.79  E-value=7.8e-08  Score=75.45  Aligned_cols=133  Identities=27%  Similarity=0.479  Sum_probs=100.1

Q ss_pred             CCCEEEECCCCCHHHHHHHHHHHHHHCCCCCHHHHEEEEEEEEHHHHHCCCCCCCHHHHHHHHHHHHHCCCCCEEEEECC
Q ss_conf             78748966764116689999999985489883452014455404675306343123789999999872038983999736
Q gi|254780163|r  225 KNNPLYVGDPGVGKTAIAEGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIESYANAILYIDE  304 (798)
Q Consensus       225 KNn~~lvG~~gvGktaive~la~~i~~~~vp~~l~~~~i~~ld~~~l~ag~~~rg~fe~r~~~~~~~~~~~~~~ilfide  304 (798)
                      =...+|-|+||.||+-++..+|..          .|..+|+++-.-|++  |+-||-|.-++++++-++.+++.|+||||
T Consensus       166 wrgiLLyGPPGTGKSYLAKAVATE----------AnSTFFSvSSSDLvS--KWmGESEkLVknLFemARe~kPSIIFiDE  233 (439)
T KOG0739         166 WRGILLYGPPGTGKSYLAKAVATE----------ANSTFFSVSSSDLVS--KWMGESEKLVKNLFEMARENKPSIIFIDE  233 (439)
T ss_pred             CEEEEEECCCCCCHHHHHHHHHHH----------CCCCEEEEEHHHHHH--HHHCCHHHHHHHHHHHHHHCCCCEEEEEH
T ss_conf             425788679997577999998741----------477068730178899--87321799999999998734994798634


Q ss_pred             HHHHHCCCCCCCCCCCHHHHHHHHHC---------CCCEEEEEECCHHHHHHHHHCCHHHHHHCEE-EEECCCCHHHHHH
Q ss_conf             16630155444344777888876630---------2660388730489999985201114320014-4306878689999
Q gi|254780163|r  305 IHTLVGAGSASGISVDASNLLKPALS---------SGAVRCIGSTTYSEYRQFFEKDKALVRRFQK-IDVSEPSIEDAIE  374 (798)
Q Consensus       305 ih~ligag~~~g~~~d~an~lkP~L~---------rg~~~~IgatT~~ey~~~~e~d~al~rrF~~-i~v~ep~~~~~~~  374 (798)
                      |..+-|+++...  -+++.-+|.-+-         ...+-+.|||..- |    --|.|+.|||++ |.|+=|....-..
T Consensus       234 iDslcg~r~enE--seasRRIKTEfLVQMqGVG~d~~gvLVLgATNiP-w----~LDsAIRRRFekRIYIPLPe~~AR~~  306 (439)
T KOG0739         234 IDSLCGSRSENE--SEASRRIKTEFLVQMQGVGNDNDGVLVLGATNIP-W----VLDSAIRRRFEKRIYIPLPEAHARAR  306 (439)
T ss_pred             HHHHCCCCCCCC--HHHHHHHHHHHHHHHHCCCCCCCCEEEEECCCCC-H----HHHHHHHHHHHCCEECCCCCHHHHHH
T ss_conf             444326887771--1777777778887640666588864897237884-3----67799998765023010873787655


Q ss_pred             HH
Q ss_conf             99
Q gi|254780163|r  375 IV  376 (798)
Q Consensus       375 iL  376 (798)
                      |.
T Consensus       307 MF  308 (439)
T KOG0739         307 MF  308 (439)
T ss_pred             HH
T ss_conf             50


No 165
>pfam06068 TIP49 TIP49 C-terminus. This family consists of the C-terminal region of several eukaryotic and archaeal RuvB-like 1 (Pontin or TIP49a) and RuvB-like 2 (Reptin or TIP49b) proteins. The N-terminal domain contains the pfam00004 domain. In zebrafish, the liebeskummer (lik) mutation, causes development of hyperplastic embryonic hearts. lik encodes Reptin, a component of a DNA-stimulated ATPase complex. Beta-catenin and Pontin, a DNA-stimulated ATPase that is often part of complexes with Reptin, are in the same genetic pathways. The Reptin/Pontin ratio serves to regulate heart growth during development, at least in part via the beta-catenin pathway. TBP-interacting protein 49 (TIP49) was originally identified as a TBP-binding protein, and two related proteins are encoded by individual genes, tip49a and b. Although the function of this gene family has not been elucidated, they are supposed to play a critical role in nuclear events because they interact with various kinds of nuclear
Probab=98.79  E-value=6.2e-07  Score=69.01  Aligned_cols=104  Identities=21%  Similarity=0.333  Sum_probs=79.7

Q ss_pred             EEEEECCHHHCCHHHHHHHHHHHHHHHCCCCCCCEECCCCEEEEEECCCCHHHHHHCCCCCCCCCCHHHHHHHHHHHCCH
Q ss_conf             17774044550289999999987775021779977612542999942421455330368988211148899999872887
Q gi|254780163|r  578 SVVLLDEIEKSHPDVLNILLQIMDYGILTDQSGKKISFRNVILIMTTNAGALEMSKARIGFGSSRNDDADKEALRNFLSP  657 (798)
Q Consensus       578 sVvl~DEiEKAh~~v~~~llqild~G~ltd~~Gr~vdf~n~iii~TsN~G~~~~~~~~~g~~~~~~~~~~~~~l~~~f~p  657 (798)
                      .|++.||+.=-+.+.|..|-..|+.-           | --||||.||=|-..+...    +...+         .-.+.
T Consensus       277 GVLFIDEvHMLDiEcFsfLnralEs~-----------l-aPivI~ATNRG~~~IRGT----d~~sP---------HGiP~  331 (395)
T pfam06068       277 GVLFIDEVHMLDIECFSFLNRALESE-----------L-APIVILATNRGICTIRGT----DIISP---------HGIPL  331 (395)
T ss_pred             CCEEEECCHHCCHHHHHHHHHHHCCC-----------C-CCEEEEEECCCCEEECCC----CCCCC---------CCCCH
T ss_conf             74688500000058998887765056-----------7-876999844652035256----77588---------89987


Q ss_pred             HHHCCCCEEEECCCCCHHHHHHHHHHHHHHHHHHHHHCCCEEEECHHHHHHHHHCCCCC
Q ss_conf             88177682896288999999999999999999999866988999889999999718981
Q gi|254780163|r  658 EFLNRLDSIIPFFPLSSDIIRQVVHKFIMKLELQLQEKGISFHFSEEVINWLVSHGYDV  716 (798)
Q Consensus       658 eflnRid~ii~F~~l~~~~~~~i~~~~l~~l~~~l~~~~i~l~~~~~~~~~l~~~~~~~  716 (798)
                      .||.|+ -||.-.|++.+++.+|+.....+         -.+.++++++++|++-|...
T Consensus       332 DlLDRl-lII~T~py~~~ei~~Ii~iRa~~---------E~v~l~~~al~~L~~ig~~~  380 (395)
T pfam06068       332 DLLDRL-LIITTEPYTREEIKQILEIRAQE---------EGVEISEEALDLLAKIGEET  380 (395)
T ss_pred             HHHHHE-EEEECCCCCHHHHHHHHHHHHHH---------HCCCCCHHHHHHHHHHHHHC
T ss_conf             777302-58856889989999999987776---------07877989999999865320


No 166
>TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda. Members of this protein family are Hda (Homologous to DnaA). These proteins are about half the length of DnaA and homologous over length of Hda. In the model species Escherichia coli, the initiation of DNA replication requires DnaA bound to ATP rather than ADP; Hda helps facilitate the conversion of DnaA-ATP to DnaA-ADP.
Probab=98.78  E-value=5.8e-07  Score=69.21  Aligned_cols=157  Identities=18%  Similarity=0.373  Sum_probs=100.2

Q ss_pred             EEEECCCCHHHHHHHHHHHH---HCCCCEEEEEHHHHHCCCCCCHHCCCCCHHCCCCCCCCCCHHHHHCCCEEEEECCHH
Q ss_conf             88614320038899999873---047733772068861246530110478000256444310035551585177740445
Q gi|254780163|r  510 YVFSGPTGVGKTEISKQLAF---ALGVQLLRFDMSEYMERHAVSRLIGAPPGYVGFGQGGILADSVDQNPYSVVLLDEIE  586 (798)
Q Consensus       510 flf~GptGvGKTelak~la~---~~~~~lir~dmsey~e~~~vs~LiGappGYvG~~egg~Lte~vr~~P~sVvl~DEiE  586 (798)
                      +.+.||+|+|||.|+.+.+.   ....+.+.++|.++..... .-+                 +.+  +.+.++++|+|+
T Consensus        41 l~i~G~~GsGKTHLl~a~~~~~~~~~~~~~yl~~~~~~~~~~-~~l-----------------~~l--~~~d~l~iDDi~  100 (226)
T TIGR03420        41 LYLWGESGSGKSHLLQAACAAAEERGKSAIYLPLAELAQADP-EVL-----------------EGL--EQADLVCLDDVE  100 (226)
T ss_pred             EEEECCCCCCHHHHHHHHHHHHHCCCCCEEEECHHHHHHHHH-HHH-----------------HHC--CCCCEEEEECHH
T ss_conf             999899999889999999999862699579952999877539-999-----------------727--448999996633


Q ss_pred             HC--CHHHHHHHHHHHHHHHCCCCCCCEECCCCEEEEEECCCCHHHHHHCCCCCCCCCCHHHHHHHHHHHCCHHHHCCC-
Q ss_conf             50--289999999987775021779977612542999942421455330368988211148899999872887881776-
Q gi|254780163|r  587 KS--HPDVLNILLQIMDYGILTDQSGKKISFRNVILIMTTNAGALEMSKARIGFGSSRNDDADKEALRNFLSPEFLNRL-  663 (798)
Q Consensus       587 KA--h~~v~~~llqild~G~ltd~~Gr~vdf~n~iii~TsN~G~~~~~~~~~g~~~~~~~~~~~~~l~~~f~peflnRi-  663 (798)
                      .-  .++....|..++.  .+.++        ++-|++||+.....+                     +++-|.+..|+ 
T Consensus       101 ~i~~~~~~e~~lF~l~N--~~~~~--------~~~ilits~~~p~~l---------------------~~~l~dL~SRl~  149 (226)
T TIGR03420       101 AIAGQPEWQEALFHLYN--RVREA--------GGRLLIAGRAAPAQL---------------------PLRLPDLRTRLA  149 (226)
T ss_pred             HHCCCHHHHHHHHHHHH--HHHHH--------CCEEEEECCCCHHHC---------------------CCCHHHHHHHHH
T ss_conf             34378378999999999--99865--------282898678882320---------------------320177999996


Q ss_pred             -CEEEECCCCCHHHHHHHHHHHHHHHHHHHHHCCCEEEECHHHHHHHHHCCCCCCCCCHHHHHHHHH
Q ss_conf             -828962889999999999999999999998669889998899999997189810153267999998
Q gi|254780163|r  664 -DSIIPFFPLSSDIIRQVVHKFIMKLELQLQEKGISFHFSEEVINWLVSHGYDVKMGARPLERIIKE  729 (798)
Q Consensus       664 -d~ii~F~~l~~~~~~~i~~~~l~~l~~~l~~~~i~l~~~~~~~~~l~~~~~~~~~GAR~l~r~i~~  729 (798)
                       --++-..+++.+.+..|+.+..       .++|+  .+++++++||+++... .+  |.+..++.+
T Consensus       150 ~~~~~~I~~pdd~~~~~iL~k~~-------~~r~i--~i~~~vi~yl~~r~~R-~~--~~l~~~l~~  204 (226)
T TIGR03420       150 WGLVFQLPPLSDEEKIAALQSRA-------ARRGL--QLPDEVADYLLRHGSR-DM--GSLMALLDA  204 (226)
T ss_pred             CCCEEECCCCCHHHHHHHHHHHH-------HHCCC--CCCHHHHHHHHHHCCC-CH--HHHHHHHHH
T ss_conf             88568527999999999999999-------98599--8899999999986379-89--999999999


No 167
>pfam00493 MCM MCM2/3/5 family.
Probab=98.77  E-value=7e-07  Score=68.60  Aligned_cols=221  Identities=17%  Similarity=0.239  Sum_probs=129.1

Q ss_pred             HHHHHHCCHHHHHHHCHHHHHHHHHHHHHHHHCCCC----CCC--CCCCEEEEECCCCHHHHHHHHHHHHHCCCCEEEEE
Q ss_conf             334210000246653458999999999877520445----657--87406886143200388999998730477337720
Q gi|254780163|r  466 SVLSNLEKNLGTVVYGQEEAIKKLSSSIKIARAGLS----DPN--KPIGCYVFSGPTGVGKTEISKQLAFALGVQLLRFD  539 (798)
Q Consensus       466 ~~l~~l~~~l~~~v~GQ~~ai~~v~~~i~~~~~gl~----~~~--rP~g~flf~GptGvGKTelak~la~~~~~~lir~d  539 (798)
                      +.+..|-+.+--.|+|.+..-.++.-.+.-   |-.    +..  |---..|++|-+|+|||.|.|..+.....+...-.
T Consensus        13 ~~~~~l~~siaP~i~G~~~vK~ai~l~l~g---g~~~~~~~~~~~Rg~ihiLLvGdPG~gKSqlLk~~~~~~pr~~~tsg   89 (327)
T pfam00493        13 DIYDKLARSIAPSIYGHEDVKKAILLQLFG---GVKKNLPDGTRLRGDINVLLVGDPGTAKSQLLKYVAKLAPRAVYTSG   89 (327)
T ss_pred             CHHHHHHHHHCCCCCCCHHHHHHHHHHHCC---CCCCCCCCCCCCCCCCEEEEECCCCCCHHHHHHHHHHHCCCCEEECC
T ss_conf             399999998597124987999999999808---98765888862036511898469981560999999986887088317


Q ss_pred             HHHHHCCCCCCHHCCCC---CHHCCCC-CCCCCCHHHHHCCCEEEEECCHHHCCHHHHHHHHHHHHHHHCCCCC-CCEEC
Q ss_conf             68861246530110478---0002564-4431003555158517774044550289999999987775021779-97761
Q gi|254780163|r  540 MSEYMERHAVSRLIGAP---PGYVGFG-QGGILADSVDQNPYSVVLLDEIEKSHPDVLNILLQIMDYGILTDQS-GKKIS  614 (798)
Q Consensus       540 msey~e~~~vs~LiGap---pGYvG~~-egg~Lte~vr~~P~sVvl~DEiEKAh~~v~~~llqild~G~ltd~~-Gr~vd  614 (798)
                      ++     .|..-|.++-   |.-=+|- |+|-|.-+    --.|++.|||+|+.+.....|++.|++++++=++ |-+..
T Consensus        90 ~~-----ss~~GLTa~~~~d~~~~~~~leaGalvlA----d~Gv~cIDEfdk~~~~d~saL~EAMEqqtVsIaKaGi~~t  160 (327)
T pfam00493        90 KG-----SSAAGLTAAVVRDPDTGEWTLEAGALVLA----DGGVCCIDEFDKMNEEDRVAIHEAMEQQTISIAKAGIVAT  160 (327)
T ss_pred             CC-----CCCCCCEEEEEEECCCCCEEEECCCEEEC----CCCEEEEECCCCCCHHHHHHHHHHHHHCEEEEECCCEEEE
T ss_conf             76-----65677615899806888369836847755----8982785005558876799999999868177633853897


Q ss_pred             CC-CEEEEEECCCCHHHHHHCCCC-CCCCCCHHHHHHHHHHHCCHHHHCCCCEEEECC-CCCHHHHHHHHHHHHH-----
Q ss_conf             25-429999424214553303689-882111488999998728878817768289628-8999999999999999-----
Q gi|254780163|r  615 FR-NVILIMTTNAGALEMSKARIG-FGSSRNDDADKEALRNFLSPEFLNRLDSIIPFF-PLSSDIIRQVVHKFIM-----  686 (798)
Q Consensus       615 f~-n~iii~TsN~G~~~~~~~~~g-~~~~~~~~~~~~~l~~~f~peflnRid~ii~F~-~l~~~~~~~i~~~~l~-----  686 (798)
                      +. .|.||.|.|-        ..| |+..   ....+-  -.++|.++.|+|-|++.. .-+.+.=..|++..+.     
T Consensus       161 L~ar~sVlAaaNP--------~~g~yd~~---~~~~~n--i~Lp~~lLsRFDLif~l~D~~~~~~D~~ia~~i~~~~~~~  227 (327)
T pfam00493       161 LNARCSVLAAANP--------IFGRYDPK---KSVAEN--INLPPPLLSRFDLIFVLLDKPDEEKDEELAKHIVDLHRHG  227 (327)
T ss_pred             ECCCCEEEEEECC--------CCCCCCCC---CCHHHH--CCCCHHHHCCEEEEEEEECCCCHHHHHHHHHHHHHHHHCC
T ss_conf             2587179985277--------67737888---898885--5897677450107988406898688999999999987446


Q ss_pred             --------------HHHH--HHHHCCCEEEECHHHHHHHHH
Q ss_conf             --------------9999--998669889998899999997
Q gi|254780163|r  687 --------------KLEL--QLQEKGISFHFSEEVINWLVS  711 (798)
Q Consensus       687 --------------~l~~--~l~~~~i~l~~~~~~~~~l~~  711 (798)
                                    .+.+  .++++.+.-.+++++.++|..
T Consensus       228 ~~~~~~~~~~~~~~~l~~yi~~ar~~~~P~ls~ea~~~i~~  268 (327)
T pfam00493       228 EEEEIETEDYVDPELLRKYIAYARENIFPKLSDEAREKLVN  268 (327)
T ss_pred             CCCCCCCCCCCCHHHHHHHHHHHHHHCCCCCCHHHHHHHHH
T ss_conf             88655568879999999999999852788779899999999


No 168
>KOG0737 consensus
Probab=98.76  E-value=7.7e-07  Score=68.29  Aligned_cols=137  Identities=28%  Similarity=0.511  Sum_probs=104.3

Q ss_pred             CCEEEECCCCCHHHHHHHHHHHHHHCCCCCHHHHEEEEEEEEHHHHHCCCCCCCHHHHHHHHHHHHHCCCCCEEEEECCH
Q ss_conf             87489667641166899999999854898834520144554046753063431237899999998720389839997361
Q gi|254780163|r  226 NNPLYVGDPGVGKTAIAEGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIESYANAILYIDEI  305 (798)
Q Consensus       226 Nn~~lvG~~gvGktaive~la~~i~~~~vp~~l~~~~i~~ld~~~l~ag~~~rg~fe~r~~~~~~~~~~~~~~ilfidei  305 (798)
                      .+++|-|+||.|||-++..+|.+          .+...+.++++.+..  |.-||=|.-++.+..-+.+-.+.|+||||+
T Consensus       128 kGiLL~GPpG~GKTmlAKA~Ake----------aga~fInv~~s~lt~--KWfgE~eKlv~AvFslAsKl~P~iIFIDEv  195 (386)
T KOG0737         128 KGILLYGPPGTGKTMLAKAIAKE----------AGANFINVSVSNLTS--KWFGEAQKLVKAVFSLASKLQPSIIFIDEV  195 (386)
T ss_pred             CCCEECCCCCCHHHHHHHHHHHH----------CCCCCCEEECCCCCH--HHHHHHHHHHHHHHHHHHHCCCCEEEHHHH
T ss_conf             43051189982188999999987----------279710001365532--667778889999982065348615656658


Q ss_pred             HHHHCCCCCCCCCCCHHHHHHHH--------HCCCC--EEEEEECCHHHHHHHHHCCHHHHHHC-EEEEECCCCHHHHHH
Q ss_conf             66301554443447778888766--------30266--03887304899999852011143200-144306878689999
Q gi|254780163|r  306 HTLVGAGSASGISVDASNLLKPA--------LSSGA--VRCIGSTTYSEYRQFFEKDKALVRRF-QKIDVSEPSIEDAIE  374 (798)
Q Consensus       306 h~ligag~~~g~~~d~an~lkP~--------L~rg~--~~~IgatT~~ey~~~~e~d~al~rrF-~~i~v~ep~~~~~~~  374 (798)
                      -+..|.-+++.  -.|--++|--        .+.+.  +=+.|||.-     -++-|.|.-||| +..+|.-|+.++-.+
T Consensus       196 ds~L~~R~s~d--HEa~a~mK~eFM~~WDGl~s~~~~rVlVlgATNR-----P~DlDeAiiRR~p~rf~V~lP~~~qR~k  268 (386)
T KOG0737         196 DSFLGQRRSTD--HEATAMMKNEFMALWDGLSSKDSERVLVLGATNR-----PFDLDEAIIRRLPRRFHVGLPDAEQRRK  268 (386)
T ss_pred             HHHHHHCCCCH--HHHHHHHHHHHHHHHCCCCCCCCCEEEEEECCCC-----CCCHHHHHHHHCCCEEEECCCCHHHHHH
T ss_conf             88986404642--7999999999999861646788715999707999-----8437899998476436537984444999


Q ss_pred             HHHHHHH
Q ss_conf             9986127
Q gi|254780163|r  375 IVKGIKP  381 (798)
Q Consensus       375 iL~~~~~  381 (798)
                      ||+-+..
T Consensus       269 ILkviLk  275 (386)
T KOG0737         269 ILKVILK  275 (386)
T ss_pred             HHHHHHC
T ss_conf             9999942


No 169
>KOG0733 consensus
Probab=98.76  E-value=7.5e-08  Score=75.56  Aligned_cols=137  Identities=30%  Similarity=0.478  Sum_probs=57.1

Q ss_pred             CCCEEEECCCCCHHHHHHHHHHHHHHCCCCCHHHHEEEEEEEEHHHHHCCCCCCCHHHHHHHHHHHHHCCCCCEEEEECC
Q ss_conf             78748966764116689999999985489883452014455404675306343123789999999872038983999736
Q gi|254780163|r  225 KNNPLYVGDPGVGKTAIAEGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIESYANAILYIDE  304 (798)
Q Consensus       225 KNn~~lvG~~gvGktaive~la~~i~~~~vp~~l~~~~i~~ld~~~l~ag~~~rg~fe~r~~~~~~~~~~~~~~ilfide  304 (798)
                      -..++|-|+||-|||-++...|.-          .+.-++++-..-|+  -+|.||-|.-++.++-.++.+.+.|.|+||
T Consensus       545 PsGvLL~GPPGCGKTLlAKAVANE----------ag~NFisVKGPELl--NkYVGESErAVR~vFqRAR~saPCVIFFDE  612 (802)
T KOG0733         545 PSGVLLCGPPGCGKTLLAKAVANE----------AGANFISVKGPELL--NKYVGESERAVRQVFQRARASAPCVIFFDE  612 (802)
T ss_pred             CCCEEEECCCCCCHHHHHHHHHHH----------CCCCEEEECCHHHH--HHHHHHHHHHHHHHHHHHHCCCCEEEEECC
T ss_conf             872387579986188999998503----------04754762388999--877423789999999986238983898511


Q ss_pred             HHHHHC---CCCCCCCCCCHHHHHHHHH----CCCCEEEEEECCHHHHHHHHHCCHHHHH--HCEE-EEECCCCHHHHHH
Q ss_conf             166301---5544434477788887663----0266038873048999998520111432--0014-4306878689999
Q gi|254780163|r  305 IHTLVG---AGSASGISVDASNLLKPAL----SSGAVRCIGSTTYSEYRQFFEKDKALVR--RFQK-IDVSEPSIEDAIE  374 (798)
Q Consensus       305 ih~lig---ag~~~g~~~d~an~lkP~L----~rg~~~~IgatT~~ey~~~~e~d~al~r--rF~~-i~v~ep~~~~~~~  374 (798)
                      +..|+-   -+.++. +--+-|-|.--|    .|-.+-+||||.--.     --|+|+-|  ||.+ ..|.-|+.++-..
T Consensus       613 iDaL~p~R~~~~s~~-s~RvvNqLLtElDGl~~R~gV~viaATNRPD-----iIDpAiLRPGRlDk~LyV~lPn~~eR~~  686 (802)
T KOG0733         613 IDALVPRRSDEGSSV-SSRVVNQLLTELDGLEERRGVYVIAATNRPD-----IIDPAILRPGRLDKLLYVGLPNAEERVA  686 (802)
T ss_pred             HHHCCCCCCCCCCHH-HHHHHHHHHHHHCCCCCCCCEEEEEECCCCC-----CCCHHHCCCCCCCCEEEECCCCHHHHHH
T ss_conf             120276557777505-8999999998731621114259995068976-----5556551877557424506998788999


Q ss_pred             HHHHH
Q ss_conf             99861
Q gi|254780163|r  375 IVKGI  379 (798)
Q Consensus       375 iL~~~  379 (798)
                      ||+.+
T Consensus       687 ILK~~  691 (802)
T KOG0733         687 ILKTI  691 (802)
T ss_pred             HHHHH
T ss_conf             99998


No 170
>TIGR01242 26Sp45 26S proteasome subunit P45 family; InterPro: IPR005937    Intracellular proteins, including short-lived proteins such as cyclin, Mos, Myc, p53, NF-kappaB, and IkappaB, are degraded by the ubiquitin-proteasome system. The 26S proteasome (a 2 MDa complex) is made up of two subcomplexes: the 20S proteasome and the regulatory complex. The former is a 700 kDa cylindrical protease complex consisting of four stacks of heptameric rings with 28 subunits (i.e., 7777) with molecular masses of about 20-35 kDa, whereas the latter is a 700-1000 kDa complex consisting of at least 18 subunits with molecular masses of 28-110 kDa, including 6 putative ATPases (Rpt1-Rpt6) and 12 non-ATPase subunits (Rpn1-12).     Members of the 26S proteasome subunit P45 family: ATPase p45/Sug1/Rpt6 may be phosphorylated within the proteasome. This phosphorylation event may play a key role in ATP-dependent proteolysis because a good correlation exists between the inhibition pattern of protein kinase inhibitors against the phosphorylation of p45 and that against the ATP-dependent proteolytic activity , .   More information about these protein can be found at Protein of the Month: AAA ATPases .; GO: 0016787 hydrolase activity, 0030163 protein catabolic process, 0005634 nucleus, 0005737 cytoplasm.
Probab=98.75  E-value=5.3e-08  Score=76.68  Aligned_cols=124  Identities=30%  Similarity=0.561  Sum_probs=92.8

Q ss_pred             HHHHCHHHHHHHHHHHHH--------HHHCCCCCCCCCCCEEEEECCCCHHHHHHHHHHHHHCCCCEEEEEHHHHHCCCC
Q ss_conf             665345899999999987--------752044565787406886143200388999998730477337720688612465
Q gi|254780163|r  477 TVVYGQEEAIKKLSSSIK--------IARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFALGVQLLRFDMSEYMERHA  548 (798)
Q Consensus       477 ~~v~GQ~~ai~~v~~~i~--------~~~~gl~~~~rP~g~flf~GptGvGKTelak~la~~~~~~lir~dmsey~e~~~  548 (798)
                      +.|=|=++-+..|-+++.        -...|+.+|.   |++|+ ||+|+|||-|||++|...+--|||+=-|||-.+  
T Consensus       122 ~diGGL~~Q~~E~~E~v~LPlk~PeLF~~vGI~PPK---GvLLy-GPPGtGKTLlAKAvA~et~ATFIrvVgSElV~K--  195 (364)
T TIGR01242       122 EDIGGLEKQIREIREAVELPLKKPELFEEVGIEPPK---GVLLY-GPPGTGKTLLAKAVAHETNATFIRVVGSELVRK--  195 (364)
T ss_pred             ECCCCHHHHHHHHHHHHHCCCCCCHHHHHCCCCCCC---CEEEE-CCCCCCHHHHHHHHHCCCCCEEEEEEHHHHHHH--
T ss_conf             026787899999988873468883167762889898---65700-757976889999863145512688604444444--


Q ss_pred             CCHHCCCCCHHCCCCCCCCCCHHH-----HHCCCEEEEECCHHH-----------CCHHHHHHHHHHHHHHHCCCCCCCE
Q ss_conf             301104780002564443100355-----515851777404455-----------0289999999987775021779977
Q gi|254780163|r  549 VSRLIGAPPGYVGFGQGGILADSV-----DQNPYSVVLLDEIEK-----------SHPDVLNILLQIMDYGILTDQSGKK  612 (798)
Q Consensus       549 vs~LiGappGYvG~~egg~Lte~v-----r~~P~sVvl~DEiEK-----------Ah~~v~~~llqild~G~ltd~~Gr~  612 (798)
                                |+|  ||-.|..-|     -+.| |+|+.|||+-           ..++|+..|+|+|-|=-=-|..|  
T Consensus       196 ----------yIG--EGArLV~~~F~LAkEKaP-sIiFIDEiDAiaakR~~~~TsGdREV~RTlmQLLAElDGFd~rg--  260 (364)
T TIGR01242       196 ----------YIG--EGARLVREVFELAKEKAP-SIIFIDEIDAIAAKRVDSSTSGDREVQRTLMQLLAELDGFDPRG--  260 (364)
T ss_pred             ----------HHC--CHHHHHHHHHHHHHCCCC-CEEEEECHHHHHHHHCCCCCCCCHHHHHHHHHHHHHHCCCCCCC--
T ss_conf             ----------413--316899999998530698-16861013335432114677873157889999997524888767--


Q ss_pred             ECCCCEEEEEECC
Q ss_conf             6125429999424
Q gi|254780163|r  613 ISFRNVILIMTTN  625 (798)
Q Consensus       613 vdf~n~iii~TsN  625 (798)
                          |.-||-.+|
T Consensus       261 ----~VkviaATN  269 (364)
T TIGR01242       261 ----NVKVIAATN  269 (364)
T ss_pred             ----CEEEEEECC
T ss_conf             ----616887207


No 171
>COG5271 MDN1 AAA ATPase containing von Willebrand factor type A (vWA) domain [General function prediction only]
Probab=98.75  E-value=5.4e-07  Score=69.42  Aligned_cols=148  Identities=30%  Similarity=0.485  Sum_probs=101.5

Q ss_pred             CCCCCEEEEECCCCHHHHHHHHHHHHHCCCCEEEEEHHHHHCCCCCCHHCCCCCHHCCCCCC------CCCCHHHHHCCC
Q ss_conf             78740688614320038899999873047733772068861246530110478000256444------310035551585
Q gi|254780163|r  504 NKPIGCYVFSGPTGVGKTEISKQLAFALGVQLLRFDMSEYMERHAVSRLIGAPPGYVGFGQG------GILADSVDQNPY  577 (798)
Q Consensus       504 ~rP~g~flf~GptGvGKTelak~la~~~~~~lir~dmsey~e~~~vs~LiGappGYvG~~eg------g~Lte~vr~~P~  577 (798)
                      +=|   .|.-|||..|||-+-+-||...+..++|||--|-+   ...--||+   ||--+.|      |.|.||+|+ .|
T Consensus       888 ~fP---~LiQGpTSSGKTSMI~yla~~tghkfVRINNHEHT---dlqeYiGT---yvTdd~G~lsFkEGvLVeAlR~-Gy  957 (4600)
T COG5271         888 NFP---LLIQGPTSSGKTSMILYLARETGHKFVRINNHEHT---DLQEYIGT---YVTDDDGSLSFKEGVLVEALRR-GY  957 (4600)
T ss_pred             CCC---EEEECCCCCCCCHHHHHHHHHHCCCEEEECCCCCC---HHHHHHHC---EEECCCCCEEEEHHHHHHHHHC-CC
T ss_conf             786---79866888770049999998737607986585543---49987430---3506898565401078998856-86


Q ss_pred             EEEEECCHHHCCHHHHHHHHHHHHHHH---CCCCCCCEECCCCEEEEEECCCCHHHHHHCCCCCCCCCCHHHHHHHHHHH
Q ss_conf             177740445502899999999877750---21779977612542999942421455330368988211148899999872
Q gi|254780163|r  578 SVVLLDEIEKSHPDVLNILLQIMDYGI---LTDQSGKKISFRNVILIMTTNAGALEMSKARIGFGSSRNDDADKEALRNF  654 (798)
Q Consensus       578 sVvl~DEiEKAh~~v~~~llqild~G~---ltd~~Gr~vdf~n~iii~TsN~G~~~~~~~~~g~~~~~~~~~~~~~l~~~  654 (798)
                      . |.+||.--|-.||+..|=.+||+-|   +-.-+--.+---|-.++.|-|        +..|++.           |++
T Consensus       958 W-IVLDELNLApTDVLEaLNRLLDDNRelfIPETqevV~PHp~F~lFATQN--------ppg~YgG-----------RK~ 1017 (4600)
T COG5271         958 W-IVLDELNLAPTDVLEALNRLLDDNRELFIPETQEVVVPHPNFRLFATQN--------PPGGYGG-----------RKG 1017 (4600)
T ss_pred             E-EEEECCCCCCHHHHHHHHHHHCCCCCEECCCCCEEECCCCCEEEEEECC--------CCCCCCC-----------HHH
T ss_conf             7-9961024670779999998644664020677552433588736886138--------9865341-----------277


Q ss_pred             CCHHHHCCCCEEEECCCCCHHHHHHHHH
Q ss_conf             8878817768289628899999999999
Q gi|254780163|r  655 LSPEFLNRLDSIIPFFPLSSDIIRQVVH  682 (798)
Q Consensus       655 f~peflnRid~ii~F~~l~~~~~~~i~~  682 (798)
                      .+-.|.||+=+ +.|....++++..|+.
T Consensus      1018 LSrAFRNRFlE-~hFddipedEle~ILh 1044 (4600)
T COG5271        1018 LSRAFRNRFLE-MHFDDIPEDELEEILH 1044 (4600)
T ss_pred             HHHHHHHHHHH-HHCCCCCHHHHHHHHH
T ss_conf             77999865676-4213585789999996


No 172
>PRK12422 chromosomal replication initiation protein; Provisional
Probab=98.75  E-value=3.9e-07  Score=70.43  Aligned_cols=171  Identities=19%  Similarity=0.345  Sum_probs=108.0

Q ss_pred             HHHHHHHHHH-HHHHHHCCC------CCCEEEE-CCCCCHHHHHHHHHHHHHHCCCCCHHHHEEEEEEEEHHHH----HC
Q ss_conf             2217899999-999862267------7874896-6764116689999999985489883452014455404675----30
Q gi|254780163|r  206 LVGRHEEINR-TIQILCRRS------KNNPLYV-GDPGVGKTAIAEGFAKQIVDGMVPDILLGARIFSLDMGNL----IA  273 (798)
Q Consensus       206 VIGRd~EI~r-iiqIL~RR~------KNn~~lv-G~~gvGktaive~la~~i~~~~vp~~l~~~~i~~ld~~~l----~a  273 (798)
                      |+|...++-. ..+-.++.-      .-||+.| |++|+|||.+.++++..+.+   |    +++|+-+....+    +.
T Consensus       114 VvG~~N~lA~~aa~~va~~~~~~~g~~yNPLfIyG~~GlGKTHLL~AIgn~i~~---~----~~kV~Yvtae~F~~~~v~  186 (455)
T PRK12422        114 LVTPENDLPFRILQEFAKVSEQGKGFPFNPIYLFGPEGSGKTHLMQAAVSALRE---S----GGKILYVSSELFTEHLVS  186 (455)
T ss_pred             EECCCCHHHHHHHHHHHHCCCCCCCCCCCCEEEECCCCCCHHHHHHHHHHHHHC---C----CCEEEEECHHHHHHHHHH
T ss_conf             315860999999999983755358876787588789999789999999998537---9----986999749999999999


Q ss_pred             CCCC--CCHHHHHHHHHHHHHCCCCCEEEEECCHHHHHCCCCCCCCCCCHHHHHHHHHCCCCEEEEEEC-CHHHHHHHHH
Q ss_conf             6343--123789999999872038983999736166301554443447778888766302660388730-4899999852
Q gi|254780163|r  274 GTRY--RGDFEERIKKIVKEIESYANAILYIDEIHTLVGAGSASGISVDASNLLKPALSSGAVRCIGST-TYSEYRQFFE  350 (798)
Q Consensus       274 g~~~--rg~fe~r~~~~~~~~~~~~~~ilfideih~ligag~~~g~~~d~an~lkP~L~rg~~~~Igat-T~~ey~~~~e  350 (798)
                      ..+-  -.+|-++       .+ +- -+|.||+||-+-|-.++..   -.-+++--...+|.-=+|.+. .|.|....  
T Consensus       187 ai~~~~~~~Fr~~-------yr-~~-DvLLIDDIQfl~gK~~tqe---Eff~tfN~L~~~~KQIVitsDr~P~el~~l--  252 (455)
T PRK12422        187 AIRSGEMQRFRSF-------YR-NV-DALFIEDIEVFSGKGATQE---EFFHTFNSLHTEGKLIVISSSYAPGDLKAM--  252 (455)
T ss_pred             HHHCCCHHHHHHH-------HH-CC-CEEEEEHHHHHHCCHHHHH---HHHHHHHHHHHCCCEEEEECCCCHHHHHHH--
T ss_conf             9975889999999-------96-38-8776314788728488999---999999999985996999689895765126--


Q ss_pred             CCHHHHHHCEE---EEECCCCHHHHHHHHHHHHHHHHHHCCCEECCHHHHHHHHH
Q ss_conf             01114320014---43068786899999986127665410351211178999998
Q gi|254780163|r  351 KDKALVRRFQK---IDVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQL  402 (798)
Q Consensus       351 ~d~al~rrF~~---i~v~ep~~~~~~~iL~~~~~~ye~~h~v~~~~~al~~av~l  402 (798)
                       +.-|..||+-   +.|.+|+.|.-+.||+...    ..+++.+++++++..+.-
T Consensus       253 -~~RL~SRf~~GL~v~I~~Pd~etr~~Il~~k~----~~~~~~l~~ev~~~iA~~  302 (455)
T PRK12422        253 -EERLISRFEWGIAIPIHPLTREGLRSFLMRQA----EQLSIRIEETALDFLIQA  302 (455)
T ss_pred             -HHHHHHHHHCCEEECCCCCCHHHHHHHHHHHH----HHCCCCCCHHHHHHHHHH
T ss_conf             -89999886376132168999899999999999----871888844689999999


No 173
>PRK10787 DNA-binding ATP-dependent protease La; Provisional
Probab=98.74  E-value=1.2e-06  Score=66.83  Aligned_cols=178  Identities=24%  Similarity=0.418  Sum_probs=114.8

Q ss_pred             HHHHHHHHHHHHHHHHCCCC-CC-----EEEECCCCCHHHHHHHHHHHHHHCCCCCHHHHEEEEEEEEHHHH-----HCC
Q ss_conf             22178999999998622677-87-----48966764116689999999985489883452014455404675-----306
Q gi|254780163|r  206 LVGRHEEINRTIQILCRRSK-NN-----PLYVGDPGVGKTAIAEGFAKQIVDGMVPDILLGARIFSLDMGNL-----IAG  274 (798)
Q Consensus       206 VIGRd~EI~riiqIL~RR~K-Nn-----~~lvG~~gvGktaive~la~~i~~~~vp~~l~~~~i~~ld~~~l-----~ag  274 (798)
                      =.|=++-=+|+++-|+=|.. ++     -||||+||||||+|....|.-+          |...+.+++|.+     +-|
T Consensus       324 HyGL~~vKeRile~lAv~~~~~~~kg~IlclvGpPGvGKTSl~~sIA~al----------~r~f~rislGGv~DeaeirG  393 (784)
T PRK10787        324 HYGLERVKDRILEYLAVQSRVNKIKGPILCLVGPPGVGKTSLGQSIAKAT----------GRKYVRMALGGVRDEAEIRG  393 (784)
T ss_pred             HCCHHHHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCHHHHHHHHHHHH----------CCCEEEEECCCCCCHHHHCC
T ss_conf             30657799999999999986246778779964699877246999999985----------89869980688788888256


Q ss_pred             C--CCCCHHHHHHHHHHHHHCCCCCEEEEECCHHHHHCCCCCCCCCCCHHHHHHHHHC-----------------CCCEE
Q ss_conf             3--4312378999999987203898399973616630155444344777888876630-----------------26603
Q gi|254780163|r  275 T--RYRGDFEERIKKIVKEIESYANAILYIDEIHTLVGAGSASGISVDASNLLKPALS-----------------SGAVR  335 (798)
Q Consensus       275 ~--~~rg~fe~r~~~~~~~~~~~~~~ilfideih~ligag~~~g~~~d~an~lkP~L~-----------------rg~~~  335 (798)
                      -  .|-|-.-.|+-.-|..+.. .|.+..+|||.-+ |.+ -.|   |-|.-|--.|-                 -..+-
T Consensus       394 HrrTYvgampGrii~~l~~a~~-~nPv~llDEiDK~-~~~-~~G---dp~salLEvLDpeQN~~F~Dhyl~~~~DlS~v~  467 (784)
T PRK10787        394 HRRTYIGSMPGKLIQKMAKVGV-KNPLFLLDEIDKM-SSD-MRG---DPASALLEVLDPEQNVAFSDHYLEVDYDLSDVM  467 (784)
T ss_pred             CCCCCCCCCCHHHHHHHHHHCC-CCCEEEEHHHHHH-CCC-CCC---CHHHHHHHHCCHHHCCCCCCCEEECCCCHHHEE
T ss_conf             4334344368389999997489-8856650035552-245-589---988999984597655640003220464522258


Q ss_pred             EEEECCHHHHHHHHHCCHHHHHHCEEEEECCCCHHHHHHHHHH-HHHHHHHHC-----CCEECCHHHHHHHHHHHH
Q ss_conf             8873048999998520111432001443068786899999986-127665410-----351211178999998654
Q gi|254780163|r  336 CIGSTTYSEYRQFFEKDKALVRRFQKIDVSEPSIEDAIEIVKG-IKPYFEEHH-----QLRYSKEAIRAAVQLSVR  405 (798)
Q Consensus       336 ~IgatT~~ey~~~~e~d~al~rrF~~i~v~ep~~~~~~~iL~~-~~~~ye~~h-----~v~~~~~al~~av~ls~r  405 (798)
                      +|+  |-..    +.--++|-.|.+.|.+.--+.++-+.|-+. +.++--..|     .+.|+++|+...++--.|
T Consensus       468 Fi~--TaN~----~~ip~pLlDRmE~i~~~gYt~~eK~~Ia~~~l~p~~~~~~gl~~~~~~~~~~~~~~ii~~ytr  537 (784)
T PRK10787        468 FVA--TSNS----MNIPAPLLDRMEVIRLSGYTEDEKLNIAKRHLLPKQIERNALKKGELTVDDSAIIGIIRYYTR  537 (784)
T ss_pred             EEE--ECCC----CCCCHHHHHHEEEEEECCCCHHHHHHHHHHHCHHHHHHHHCCCCCCCCCCHHHHHHHHHHCCC
T ss_conf             997--3276----778767763121554116767889999997453999998289965674399999998753365


No 174
>PRK13407 bchI magnesium chelatase subunit I; Provisional
Probab=98.73  E-value=1.3e-06  Score=66.72  Aligned_cols=232  Identities=20%  Similarity=0.305  Sum_probs=120.2

Q ss_pred             HHHHHHHHHHHHHHHH-CCCCCCEEEECCCCCHHHHHHHHHHHHHHC-----C---------CCCHHH---------HEE
Q ss_conf             2217899999999862-267787489667641166899999999854-----8---------988345---------201
Q gi|254780163|r  206 LVGRHEEINRTIQILC-RRSKNNPLYVGDPGVGKTAIAEGFAKQIVD-----G---------MVPDIL---------LGA  261 (798)
Q Consensus       206 VIGRd~EI~riiqIL~-RR~KNn~~lvG~~gvGktaive~la~~i~~-----~---------~vp~~l---------~~~  261 (798)
                      |+|- ++.++-+.+.. --.-.|.++.|+||.|||.++.+|+..+-.     +         ..|+..         +..
T Consensus        10 IvGQ-e~~K~AL~laav~p~~ggvLi~G~~GtgKStlaR~l~~iLP~~~~~e~~~~~~~~~~~~~~~~~~~~~~~~~~~~   88 (334)
T PRK13407         10 IVGQ-EEMKQAMVLTAIDPGIGGVLVFGDRGTGKSTAVRALAALLPLIKAVEGCPVNSARPEDCPEWAEVSSTTMVERPT   88 (334)
T ss_pred             HCCC-HHHHHHHHHHHCCCCCCEEEEECCCCCCHHHHHHHHHHHCCCCCHHCCCCCCCCCCCCCHHHHHCCCCCCCCCCC
T ss_conf             6493-999999999772789860899789986599999999972899511036755667742113343114555344899


Q ss_pred             EEE-------------EEEHH-HHHCCCCCCCHHHHHHHHHHHHHCCCCCEEEEECCHHHHHCCCCCCCCCCCHHHHHHH
Q ss_conf             445-------------54046-7530634312378999999987203898399973616630155444344777888876
Q gi|254780163|r  262 RIF-------------SLDMG-NLIAGTRYRGDFEERIKKIVKEIESYANAILYIDEIHTLVGAGSASGISVDASNLLKP  327 (798)
Q Consensus       262 ~i~-------------~ld~~-~l~ag~~~rg~fe~r~~~~~~~~~~~~~~ilfideih~ligag~~~g~~~d~an~lkP  327 (798)
                      .++             ++|+. +|..|.+   .|+-      -++..+-+=|||+||+.-+         .-..-++|.-
T Consensus        89 p~v~lPl~atedr~~G~ldie~al~~G~~---~~~P------GlLa~Ah~GVLylDEinll---------~~~vld~Ll~  150 (334)
T PRK13407         89 PVIDLPLGATEDRVVGALDIERALTRGEK---AFEP------GLLARANRGYLYIDEVNLL---------EDHIVDLLLD  150 (334)
T ss_pred             CCCCCCCCCCCCCCCCCCCHHHHHHCCCC---CCCC------CHHHHCCCCEEEEECHHHC---------CHHHHHHHHH
T ss_conf             87678999998664474218888626987---7886------0543402886787205333---------3889999998


Q ss_pred             HHCCCC---------------EEEEEECCHHHHHHHHHCCHHHHHHCE-EEEECCC-CHHHHHHHHHHHHHHHHHHCCCE
Q ss_conf             630266---------------038873048999998520111432001-4430687-86899999986127665410351
Q gi|254780163|r  328 ALSSGA---------------VRCIGSTTYSEYRQFFEKDKALVRRFQ-KIDVSEP-SIEDAIEIVKGIKPYFEEHHQLR  390 (798)
Q Consensus       328 ~L~rg~---------------~~~IgatT~~ey~~~~e~d~al~rrF~-~i~v~ep-~~~~~~~iL~~~~~~ye~~h~v~  390 (798)
                      +++.|+               +.+||+..|+|-    +--+.|-.||- .|.|..| +.++-++|++. +..|+..+...
T Consensus       151 ~~e~G~~~IeReg~s~~~ParF~LVatmNPeEg----~Lrp~lLDRf~l~v~v~~~~~~~~r~eiv~r-~~~~~~~~~~~  225 (334)
T PRK13407        151 VAQSGENVVEREGLSIRHPARFVLVGSGNPEEG----ELRPQLLDRFGLSVEVRSPRDVETRVEVITR-RDAYDADHDAF  225 (334)
T ss_pred             HHHCCCEEEEECCEEEECCCCCEEEEEECCCCC----CCCHHHHHHHCEEEEECCCCCHHHHHHHHHH-HHHHHHCHHHH
T ss_conf             871695799977634603662658982088877----7598998361006871487887776688999-99865387999


Q ss_pred             E-----CCHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHH---------------HHHHHHHHHCCCCHHHHHHHH--
Q ss_conf             2-----111789999986542015556467988998653333---------------211443221136578999866--
Q gi|254780163|r  391 Y-----SKEAIRAAVQLSVRHFTSRKLPDKAIDVIDEAGASQ---------------ILQPLSKRRKFITEKDIKKTI--  448 (798)
Q Consensus       391 ~-----~~~al~~av~ls~ryi~~r~lPdkAidllDea~a~~---------------~~~~~~~~~~~~~~~~i~~~~--  448 (798)
                      .     .+..+..-+..+...++.-..||..+..+=+.|...               +..+.-..+..|+.+||..++  
T Consensus       226 ~~~~~~e~~~l~~~i~~Ar~~l~~v~~~d~~~~~~~~~~~~~~~~g~Ra~i~l~r~ARa~AaL~Gr~~V~~~dl~~aa~l  305 (334)
T PRK13407        226 MAKWGAEDMQLRGRILGARAALPQLKTPDTVLHDCAALCIALGSDGLRGELTLLRAARAQAAFEGAETVGRSHLRSVATS  305 (334)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHH
T ss_conf             99889899999999999987511468999999999999998589871099999999999999749997899999999998


Q ss_pred             --HHCCCCCCHHHHH
Q ss_conf             --3102453101110
Q gi|254780163|r  449 --ASMNRSIHTTSFS  461 (798)
Q Consensus       449 --~~~~~gip~~~~~  461 (798)
                        ..+..--|.....
T Consensus       306 vL~HRlRr~P~e~~~  320 (334)
T PRK13407        306 ALSHRLRRDPLDEAG  320 (334)
T ss_pred             HCCCCCCCCCCCCCC
T ss_conf             533124589865578


No 175
>smart00382 AAA ATPases associated with a variety of cellular activities. AAA - ATPases associated with a variety of cellular activities. This profile/alignment only detects a fraction of this vast family. The poorly conserved N-terminal helix is missing from the alignment.
Probab=98.73  E-value=2.5e-08  Score=79.04  Aligned_cols=116  Identities=23%  Similarity=0.222  Sum_probs=78.1

Q ss_pred             CEEEEECCCCHHHHHHHHHHHHHCCC---CEEEEEHHHHHCCCCCCH----HCCCCCHHCCCCCCCCCCHHHHHCCCEEE
Q ss_conf             06886143200388999998730477---337720688612465301----10478000256444310035551585177
Q gi|254780163|r  508 GCYVFSGPTGVGKTEISKQLAFALGV---QLLRFDMSEYMERHAVSR----LIGAPPGYVGFGQGGILADSVDQNPYSVV  580 (798)
Q Consensus       508 g~flf~GptGvGKTelak~la~~~~~---~lir~dmsey~e~~~vs~----LiGappGYvG~~egg~Lte~vr~~P~sVv  580 (798)
                      ...++.||+|+|||.+++.+|.....   .++.++++.+.+......    .-...+.+.+...-..+.+.+++.+++|+
T Consensus         3 ~~ill~G~~GsGKTtl~~~la~~~~~~~~~v~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~vi   82 (148)
T smart00382        3 EVILIVGPPGSGKTTLARALARELGPPGGGVIYIDGEDILEEVLDQLLLIIVGGKKASGSGELRLRLALALARKLKPDVL   82 (148)
T ss_pred             CEEEEECCCCHHHHHHHHHHHHHHCCCCCCEEEEEHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHHHHHHHHHHCCCCEE
T ss_conf             78999999970299999999987266899689987599898889876530001122105199999999999984499899


Q ss_pred             EECCHHHCCHHHHHHHHHHHHHHHCCCCCCCEECCCCEEEEEECCC
Q ss_conf             7404455028999999998777502177997761254299994242
Q gi|254780163|r  581 LLDEIEKSHPDVLNILLQIMDYGILTDQSGKKISFRNVILIMTTNA  626 (798)
Q Consensus       581 l~DEiEKAh~~v~~~llqild~G~ltd~~Gr~vdf~n~iii~TsN~  626 (798)
                      ++||+++..+............   ...........++.+|+|+|.
T Consensus        83 iiDei~~~~~~~~~~~~~~~~~---~~~~~~~~~~~~~~vi~~~n~  125 (148)
T smart00382       83 ILDEITSLLDAEQEALLLLLEE---LRLLLLLKSEKNLTVILTTND  125 (148)
T ss_pred             EEECCHHHCCCCCHHHHHHHHH---HHHHCCCCCCCCEEEEEEECC
T ss_conf             9827502147620799999999---998517657899899995699


No 176
>pfam00308 Bac_DnaA Bacterial dnaA protein.
Probab=98.72  E-value=3.6e-07  Score=70.71  Aligned_cols=159  Identities=16%  Similarity=0.267  Sum_probs=66.4

Q ss_pred             CCCCEEEEECCCCHHHHHHHHHHHH-----HCCCCEEEEEHHHHHCCCCCCHHCCCCCHHCCCCCCCCCCHHHHHCCCEE
Q ss_conf             8740688614320038899999873-----04773377206886124653011047800025644431003555158517
Q gi|254780163|r  505 KPIGCYVFSGPTGVGKTEISKQLAF-----ALGVQLLRFDMSEYMERHAVSRLIGAPPGYVGFGQGGILADSVDQNPYSV  579 (798)
Q Consensus       505 rP~g~flf~GptGvGKTelak~la~-----~~~~~lir~dmsey~e~~~vs~LiGappGYvG~~egg~Lte~vr~~P~sV  579 (798)
                      .|...+++.||+|+|||.|..+++.     .-+...+-+++++|... .+.-+-..        +...+-+..  .-..+
T Consensus        32 ~~~npl~i~G~~G~GKTHLLqA~~~~~~~~~~~~~v~yl~~~~~~~~-~~~~l~~~--------~~~~f~~~l--~~~d~  100 (219)
T pfam00308        32 KAYNPLFIYGGVGLGKTHLLHAIGNYALRNFPNLRVVYLTSEEFLND-FVDALRDN--------KIEAFKKSY--RNVDL  100 (219)
T ss_pred             CCCCCEEEECCCCCCHHHHHHHHHHHHHHHCCCCEEEEEEHHHHHHH-HHHHHHCC--------CHHHHHHHH--HHCCH
T ss_conf             76782699889999888999999999998499982888439999998-89999818--------888999997--63233


Q ss_pred             EEECCHHHC--CHHHHHHHHHHHHHHHCCCCCCCEECCCCEEEEEECCCCHHHHHHCCCCCCCCCCHHHHHHHHHHHCCH
Q ss_conf             774044550--289999999987775021779977612542999942421455330368988211148899999872887
Q gi|254780163|r  580 VLLDEIEKS--HPDVLNILLQIMDYGILTDQSGKKISFRNVILIMTTNAGALEMSKARIGFGSSRNDDADKEALRNFLSP  657 (798)
Q Consensus       580 vl~DEiEKA--h~~v~~~llqild~G~ltd~~Gr~vdf~n~iii~TsN~G~~~~~~~~~g~~~~~~~~~~~~~l~~~f~p  657 (798)
                      +++|+|+.-  .+.....|..+++.  +.++.+        -+|+||+.....+                     ..+.|
T Consensus       101 l~iDDi~~l~~~~~~ee~lf~l~N~--~~~~~~--------~lllts~~~p~~l---------------------~~~~~  149 (219)
T pfam00308       101 LLIDDIQFLAGKEKTQEEFFHTFNA--LHENNK--------QIVLTSDRPPKEL---------------------EGFED  149 (219)
T ss_pred             HHHCCHHHHCCCHHHHHHHHHHHHH--HHHCCC--------EEEEECCCCCCCC---------------------CCCCH
T ss_conf             6522367656864789999999999--997298--------6999779981002---------------------45327


Q ss_pred             HHHCCC--CEEEECCCCCHHHHHHHHHHHHHHHHHHHHHCCCEEEECHHHHHHHHHCCC
Q ss_conf             881776--828962889999999999999999999998669889998899999997189
Q gi|254780163|r  658 EFLNRL--DSIIPFFPLSSDIIRQVVHKFIMKLELQLQEKGISFHFSEEVINWLVSHGY  714 (798)
Q Consensus       658 eflnRi--d~ii~F~~l~~~~~~~i~~~~l~~l~~~l~~~~i~l~~~~~~~~~l~~~~~  714 (798)
                      .+..|+  --++.-.+++.++...|+.+..       .++|+.  +++++.+||+.+..
T Consensus       150 dL~SRL~~g~~~~i~~pdd~~~~~iL~~~a-------~~r~l~--l~~~v~~yl~~r~~  199 (219)
T pfam00308       150 RLRSRFEWGLIIAIEPPDLETRLAILRKKA-------EEENIN--IPNEVLNFIAQRIT  199 (219)
T ss_pred             HHHHHHHCCEEEECCCCCHHHHHHHHHHHH-------HHCCCC--CCHHHHHHHHHHCC
T ss_conf             799998687566116999999999999999-------984999--99999999998427


No 177
>pfam06309 Torsin Torsin. This family consists of several eukaryotic torsin proteins. Torsion dystonia is an autosomal dominant movement disorder characterized by involuntary, repetitive muscle contractions and twisted postures. The most severe early-onset form of dystonia has been linked to mutations in the human DYT1 (TOR1A) gene encoding a protein termed torsinA. While causative genetic alterations have been identified, the function of torsin proteins and the molecular mechanism underlying dystonia remain unknown. Phylogenetic analysis of the torsin protein family indicates these proteins share distant sequence similarity with the large and diverse family of (pfam00004) proteins. It has been suggested that torsins play a role in effectively managing protein folding and that possible breakdown in a neuroprotective mechanism that is, in part, mediated by torsins may be responsible for the neuronal dysfunction associated with dystonia.
Probab=98.72  E-value=4.1e-08  Score=77.48  Aligned_cols=106  Identities=22%  Similarity=0.325  Sum_probs=74.8

Q ss_pred             HHHHHHCCHHHHHHHCHHHHHHHHHHHHHHHHCCCCCCCCCCCEEEEECCCCHHHHHHHHHHH-----HHCCCCEEEEEH
Q ss_conf             334210000246653458999999999877520445657874068861432003889999987-----304773377206
Q gi|254780163|r  466 SVLSNLEKNLGTVVYGQEEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLA-----FALGVQLLRFDM  540 (798)
Q Consensus       466 ~~l~~l~~~l~~~v~GQ~~ai~~v~~~i~~~~~gl~~~~rP~g~flf~GptGvGKTelak~la-----~~~~~~lir~dm  540 (798)
                      -.+..|+..|.++++||.-|.+.|..+++.-... .+|+||+ ++-|-||||+||+..|+.+|     .|+...+++.=.
T Consensus        14 ~~~~~Le~~L~~~lfGQhla~~~v~~al~~~l~~-~~p~KpL-VlSfHG~tGtGKn~vs~liA~~Ly~~G~~S~~Vh~fi   91 (127)
T pfam06309        14 FNYHGLERDLARRLFGQHLVKQLVVRSVKGHWEN-PKPRKPL-VLSFHGWTGTGKNFVAEIIADNLYRDGLRSPYVHHFV   91 (127)
T ss_pred             CCHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHCC-CCCCCCE-EEEECCCCCCCHHHHHHHHHHHHHHCCCCCCCEEEEC
T ss_conf             8779999999875347798999999999999748-9999974-8870189998798999999999875434787568842


Q ss_pred             HHHHCCCCCCHHCCCCCHHCC-CCC--CCCCCHHHHHCCCEEEEE
Q ss_conf             886124653011047800025-644--431003555158517774
Q gi|254780163|r  541 SEYMERHAVSRLIGAPPGYVG-FGQ--GGILADSVDQNPYSVVLL  582 (798)
Q Consensus       541 sey~e~~~vs~LiGappGYvG-~~e--gg~Lte~vr~~P~sVvl~  582 (798)
                      +..-=+|         |.+|- |.+  -.+.-..|++.|.|+.+|
T Consensus        92 ~~~hFPh---------~~~v~~YK~~L~~~I~~~v~~C~rslFIF  127 (127)
T pfam06309        92 ATNHFPH---------PKYVELYKVELKNQIRGTLRACQRSIFIF  127 (127)
T ss_pred             CCCCCCC---------HHHHHHHHHHHHHHHHHHHHCCCCCEEEC
T ss_conf             4224897---------68899999999999999996499652319


No 178
>PRK05648 DNA polymerase III subunits gamma and tau; Reviewed
Probab=98.71  E-value=2.4e-08  Score=79.14  Aligned_cols=197  Identities=21%  Similarity=0.271  Sum_probs=124.7

Q ss_pred             HHHCCCCHHHHHHHHHHHHHHHHHHCCCCCC-EEEECCCCCHHHHHHHHHHHHHHCCCCCHHH-HE-------------E
Q ss_conf             7754861122217899999999862267787-4896676411668999999998548988345-20-------------1
Q gi|254780163|r  197 KVKKGKVDILVGRHEEINRTIQILCRRSKNN-PLYVGDPGVGKTAIAEGFAKQIVDGMVPDIL-LG-------------A  261 (798)
Q Consensus       197 ~AreGKLDPVIGRd~EI~riiqIL~RR~KNn-~~lvG~~gvGktaive~la~~i~~~~vp~~l-~~-------------~  261 (798)
                      +-|-..++-|||-+--++-+..-|..-+=.. -++.|.-|||||+|+.-||.-+.-..-+..- .|             .
T Consensus         9 k~rp~~f~~~~gq~~~~~~l~~~~~~~~~~~a~l~~g~rg~gkt~~ar~~ak~lnc~~~~~~~pc~~c~~c~~i~~~~~~   88 (705)
T PRK05648          9 KWRPRSFREMVGQTHVLKALINALDNQRLHHAYLFTGTRGVGKTTIARIIAKCLNCETGVSSTPCGECSVCREIDEGRFV   88 (705)
T ss_pred             HHCCCCHHHHCCHHHHHHHHHHHHHCCCCCCEEEEECCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCCHHHHHHHCCCCC
T ss_conf             31787576632819999999999970986304650078988898999999998677899988978776004666248977


Q ss_pred             EEEEEEHHHHHCCCCCCCHHHHHHHHHHHHHCC---CCC-EEEEECCHHHHHCCCCCCCCCCCHHH-HHHHHHC--CCCE
Q ss_conf             445540467530634312378999999987203---898-39997361663015544434477788-8876630--2660
Q gi|254780163|r  262 RIFSLDMGNLIAGTRYRGDFEERIKKIVKEIES---YAN-AILYIDEIHTLVGAGSASGISVDASN-LLKPALS--SGAV  334 (798)
Q Consensus       262 ~i~~ld~~~l~ag~~~rg~fe~r~~~~~~~~~~---~~~-~ilfideih~ligag~~~g~~~d~an-~lkP~L~--rg~~  334 (798)
                      -++++|.++      -+|-  +-++.+++.+.-   .|+ -|..|||+|+|-         -.+-| +|| -|.  ---+
T Consensus        89 d~~e~d~as------~~~v--~~~r~~~~~~~~~p~~~~~kv~~idevhmls---------~~~fnallk-tleepp~~v  150 (705)
T PRK05648         89 DLIEVDAAS------RTKV--EDTRELLDNVQYAPTRGRYKVYLIDEVHMLS---------SHSFNALLK-TLEEPPPHV  150 (705)
T ss_pred             CEEEECCCC------CCCH--HHHHHHHHHCCCCCCCCCEEEEEEEHHHHCC---------HHHHHHHHH-HCCCCCCCE
T ss_conf             634451554------4788--9999999855517767745799984265417---------999999987-404797545


Q ss_pred             EEEEECCHHHHHHHHHCCHHHHHHCEEEEECCCCHHHHHHHHHHHHHHHHHHCCCEECCHHHHHHHHHHHHHCCCCCCHH
Q ss_conf             38873048999998520111432001443068786899999986127665410351211178999998654201555646
Q gi|254780163|r  335 RCIGSTTYSEYRQFFEKDKALVRRFQKIDVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLPD  414 (798)
Q Consensus       335 ~~IgatT~~ey~~~~e~d~al~rrF~~i~v~ep~~~~~~~iL~~~~~~ye~~h~v~~~~~al~~av~ls~ryi~~r~lPd  414 (798)
                      ++|-|||.-+  |.  .-.-|.| -+..+.+-.+.++-..-|..+.    ..-+|.|.++||....+.+.--+.|     
T Consensus       151 ~f~~att~~~--k~--p~t~~sr-c~~~~~~~~~~~~~~~~l~~~~----~~e~~~~~~~~~~~~~~~~~g~~rd-----  216 (705)
T PRK05648        151 KFLLATTDPQ--KL--PVTILSR-CLQFSLKNMSPERVVEHLSHVL----GAENVPFEEDALWLLGRAADGSMRD-----  216 (705)
T ss_pred             EEEEECCCHH--HC--CHHHHHH-HHHCCCCCCCHHHHHHHHHHHH----HHCCCCCCHHHHHHHHHHCCCCHHH-----
T ss_conf             9998428735--37--5899976-6430236899999999999999----9759977899999999974896777-----


Q ss_pred             HHHHHHHHHHHH
Q ss_conf             798899865333
Q gi|254780163|r  415 KAIDVIDEAGAS  426 (798)
Q Consensus       415 kAidllDea~a~  426 (798)
                       |..|+|.|-|.
T Consensus       217 -~ls~~dq~~~~  227 (705)
T PRK05648        217 -AMSLTDQAIAF  227 (705)
T ss_pred             -HHHHHHHHHHC
T ss_conf             -99999999860


No 179
>TIGR00763 lon ATP-dependent protease La; InterPro: IPR004815   Proteolytic enzymes that exploit serine in their catalytic activity are ubiquitous, being found in viruses, bacteria and eukaryotes . They include a wide range of peptidase activity, including exopeptidase, endopeptidase, oligopeptidase and omega-peptidase activity. Over 20 families (denoted S1 - S66) of serine protease have been identified, these being grouped into clans on the basis of structural similarity and other functional evidence . Structures are known for members of the clans and the structures indicate that some appear to be totally unrelated, suggesting different evolutionary origins for the serine peptidases .   Not withstanding their different evolutionary origins, there are similarities in the reaction mechanisms of several peptidases. Chymotrypsin, subtilisin and carboxypeptidase C have a catalytic triad of serine, aspartate and histidine in common: serine acts as a nucleophile, aspartate as an electrophile, and histidine as a base . The geometric orientations of the catalytic residues are similar between families, despite different protein folds . The linear arrangements of the catalytic residues commonly reflect clan relationships. For example the catalytic triad in the chymotrypsin clan (PA) is ordered HDS, but is ordered DHS in the subtilisin clan (SB) and SDH in the carboxypeptidase clan (SC) , .   Peptidases are grouped into clans and families. Clans are groups of families for which there is evidence of common ancestry. Each clan is identified with two letters, the first representing the catalytic type of the families included in the clan (with the letter 'P' being used for a clan containing families of more than one of the catalytic types serine, threonine and cysteine). Some families cannot yet be assigned to clans, and when a formal assignment is required, such a family is described as belonging to clan A-, C-, M-, S-, T- or U-, according to the catalytic type. Some clans are divided into subclans because there is evidence of a very ancient divergence within the clan, for example MA(E), the gluzincins, and MA(M), the metzincins.   Families are grouped by their catalytic type, the first character representing the catalytic type: A, aspartic; C, cysteine; G, glutamic acid; M, metallo; S, serine; T, threonine; and U, unknown. The serine, threonine and cysteine peptidases utilise the amino acid as a nucleophile and form an acyl intermediate - these peptidases can also readily act as transferases. In the case of aspartic, glutamic and metallopeptidases, the nucleophile is an activated water molecule.    This signature defines the bacterial and eukaryotic lon proteases, which are ATP-dependent serine peptidases belonging to the MEROPS peptidase family S16 (lon protease family, clan SF). This family of sequences does not include the archaeal lon homologs, IPR004663 from INTERPRO. In the eukaryotes the majority of the proteins are located in the mitochondrial matrix , . In yeast, Pim1, is located in the mitochondrial matrix, is required for mitochondrial function, is constitutively expressed but is increased after thermal stress, suggesting that Pim1 may play a role in the heat shock response .; GO: 0004176 ATP-dependent peptidase activity, 0005524 ATP binding, 0006510 ATP-dependent proteolysis.
Probab=98.70  E-value=1.7e-07  Score=72.97  Aligned_cols=152  Identities=28%  Similarity=0.428  Sum_probs=111.8

Q ss_pred             EEECCCCCHHHHHHHHHHHHHHCCCCCHHHHEEEEEEEEHHHH--HC---CC--CCCCHHHHHHHHHHHHHCCCCCEEEE
Q ss_conf             8966764116689999999985489883452014455404675--30---63--43123789999999872038983999
Q gi|254780163|r  229 LYVGDPGVGKTAIAEGFAKQIVDGMVPDILLGARIFSLDMGNL--IA---GT--RYRGDFEERIKKIVKEIESYANAILY  301 (798)
Q Consensus       229 ~lvG~~gvGktaive~la~~i~~~~vp~~l~~~~i~~ld~~~l--~a---g~--~~rg~fe~r~~~~~~~~~~~~~~ilf  301 (798)
                      |||||||||||+|....|.-+          |+.++.+++|.|  +|   |-  .|-|-.=.|+-.-|+.++.. |.+.-
T Consensus       454 ClvGPPGVGKTSlg~SIA~AL----------nRkFvR~SlGG~~DeAEIrGHRRTYvGAMPGriiQ~lk~~~t~-NPl~L  522 (941)
T TIGR00763       454 CLVGPPGVGKTSLGKSIAKAL----------NRKFVRFSLGGVRDEAEIRGHRRTYVGAMPGRIIQGLKKAKTK-NPLIL  522 (941)
T ss_pred             EEECCCCCCHHHHHHHHHHHH----------CCEEEEEEECCCEEHHHCCCCCCCCCCCCHHHHHHHHHHCCCC-CCEEE
T ss_conf             720726954222789999996----------8804999526722031127864320346725789998760415-88068


Q ss_pred             ECCHHHHH-CCCCCCCCC-----------------------CCHHHHHHHHHCCCCEEEEEECCHHHHHHHHHCCH-HHH
Q ss_conf             73616630-155444344-----------------------77788887663026603887304899999852011-143
Q gi|254780163|r  302 IDEIHTLV-GAGSASGIS-----------------------VDASNLLKPALSSGAVRCIGSTTYSEYRQFFEKDK-ALV  356 (798)
Q Consensus       302 ideih~li-gag~~~g~~-----------------------~d~an~lkP~L~rg~~~~IgatT~~ey~~~~e~d~-al~  356 (798)
                      ||||-=|- ++|-.+.-+                       .|.|++| -       -+|+  |-.    .++.=| .|-
T Consensus       523 lDEIDK~~~~~~~~GDPaSALLEvLDPEQN~~F~DHYldvp~DLS~V~-C-------yFi~--TAN----~~d~IP~PLL  588 (941)
T TIGR00763       523 LDEIDKIGLKSSFRGDPASALLEVLDPEQNNAFSDHYLDVPFDLSKVL-C-------YFIA--TAN----SIDTIPRPLL  588 (941)
T ss_pred             EEEEEEECCCCCCCCCHHHHHHHHCCHHHCCCCCCCCCCCCCCHHHHH-H-------HEEE--CCC----CCCCCCCCCC
T ss_conf             620220016788655637888641286436042553002340042002-1-------0002--447----5767772213


Q ss_pred             HHCEEEEECCCCHHHHHHHHHH-HHHHHHHHCC-----CEECCHHHHHHHHHHHH
Q ss_conf             2001443068786899999986-1276654103-----51211178999998654
Q gi|254780163|r  357 RRFQKIDVSEPSIEDAIEIVKG-IKPYFEEHHQ-----LRYSKEAIRAAVQLSVR  405 (798)
Q Consensus       357 rrF~~i~v~ep~~~~~~~iL~~-~~~~ye~~h~-----v~~~~~al~~av~ls~r  405 (798)
                      .|-+.|.|.==+.+|-+.|-++ |-++-=.-||     |.|+|+||...++.=.|
T Consensus       589 DRMEvI~lsGY~~~EK~~IA~~yLiP~~~~~~GL~~~~l~~~d~al~~lI~~YtR  643 (941)
T TIGR00763       589 DRMEVIELSGYTEEEKLEIAKKYLIPKALEDHGLKPDELKISDEALLLLIKYYTR  643 (941)
T ss_pred             CCEEEEECCCCCHHHHHHHHHHCCHHHHHHHHCCCCCCEEECHHHHHHHHHHHHH
T ss_conf             7402452388876789999985471367987088813221268999999987513


No 180
>KOG0735 consensus
Probab=98.69  E-value=3.2e-07  Score=71.04  Aligned_cols=98  Identities=22%  Similarity=0.421  Sum_probs=60.5

Q ss_pred             CEEEEECCCCHHHHHHHHHHHHHCCCCE----EEEEHHHHHCCC--CCCHHCCCCCHHCCCCCCCCCCHHHHHCCCEEEE
Q ss_conf             0688614320038899999873047733----772068861246--5301104780002564443100355515851777
Q gi|254780163|r  508 GCYVFSGPTGVGKTEISKQLAFALGVQL----LRFDMSEYMERH--AVSRLIGAPPGYVGFGQGGILADSVDQNPYSVVL  581 (798)
Q Consensus       508 g~flf~GptGvGKTelak~la~~~~~~l----ir~dmsey~e~~--~vs~LiGappGYvG~~egg~Lte~vr~~P~sVvl  581 (798)
                      |..|+.||.|.|||-|+|+++...++++    .++|||+...+.  .+.+++           ....+++++..| |||+
T Consensus       432 ~~Ill~G~~GsGKT~L~kal~~~~~k~~~~hv~~v~Cs~l~~~~~e~iQk~l-----------~~vfse~~~~~P-SiIv  499 (952)
T KOG0735         432 GNILLNGPKGSGKTNLVKALFDYYSKDLIAHVEIVSCSTLDGSSLEKIQKFL-----------NNVFSEALWYAP-SIIV  499 (952)
T ss_pred             CCEEEECCCCCCHHHHHHHHHHHHCCCCCEEEEEEECHHCCCHHHHHHHHHH-----------HHHHHHHHHHCC-CEEE
T ss_conf             6189867998777699999998751565069999752210420489999999-----------999999886378-0899


Q ss_pred             ECCHHH-CC------------HHHHHHHH-HHHHHHHCCCCCCCEECCCCEEEEEECC
Q ss_conf             404455-02------------89999999-9877750217799776125429999424
Q gi|254780163|r  582 LDEIEK-SH------------PDVLNILL-QIMDYGILTDQSGKKISFRNVILIMTTN  625 (798)
Q Consensus       582 ~DEiEK-Ah------------~~v~~~ll-qild~G~ltd~~Gr~vdf~n~iii~TsN  625 (798)
                      ||.+|- ||            ..-++.|| |+.+. .++++  +.     ..+|.|++
T Consensus       500 LDdld~l~~~s~~e~~q~~~~~~rla~flnqvi~~-y~~~~--~~-----ia~Iat~q  549 (952)
T KOG0735         500 LDDLDCLASASSNENGQDGVVSERLAAFLNQVIKI-YLKRN--RK-----IAVIATGQ  549 (952)
T ss_pred             ECCHHHHHCCCCCCCCCCHHHHHHHHHHHHHHHHH-HHCCC--CE-----EEEEEECH
T ss_conf             70503540568444773028999999999999999-87068--57-----99998514


No 181
>PRK08770 DNA polymerase III subunits gamma and tau; Validated
Probab=98.68  E-value=7.2e-08  Score=75.70  Aligned_cols=258  Identities=19%  Similarity=0.242  Sum_probs=155.2

Q ss_pred             HHHCCCCHHHHHHHHHHHHHHHHHHCCCCCC-EEEECCCCCHHHHHHHHHHHHHHCCCCCH-HH-------------HEE
Q ss_conf             7754861122217899999999862267787-48966764116689999999985489883-45-------------201
Q gi|254780163|r  197 KVKKGKVDILVGRHEEINRTIQILCRRSKNN-PLYVGDPGVGKTAIAEGFAKQIVDGMVPD-IL-------------LGA  261 (798)
Q Consensus       197 ~AreGKLDPVIGRd~EI~riiqIL~RR~KNn-~~lvG~~gvGktaive~la~~i~~~~vp~-~l-------------~~~  261 (798)
                      +-|-..++-|||-+--++-+..-|..-+=.. -++.|.-|||||+|+.-||.-+....-+. .-             +-.
T Consensus         9 k~rp~~f~~~~gq~~~~~~l~~~~~~~~~~~a~lf~g~rg~gkt~~ar~~a~~lnc~~~~~~~pc~~c~~c~~i~~~~~~   88 (663)
T PRK08770          9 KWRPKRFAELVGQEHVVRALSNALDSGRVHHAFLFTGTRGVGKTTIARIFAKSLNCETGTSADPCGQCPACLDIDAGRYI   88 (663)
T ss_pred             HHCCCCHHHHCCCHHHHHHHHHHHHCCCCCEEEEEECCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCCHHHHHHHCCCCC
T ss_conf             50887464522859999999999970997404762279988888999999998678999999978778778988548988


Q ss_pred             EEEEEEHHHHHCCCCCCCHHHHHHHHHHHHHCC---CCC-EEEEECCHHHHHCCCCCCCCCCCHHH-HHHHHHC--CCCE
Q ss_conf             445540467530634312378999999987203---898-39997361663015544434477788-8876630--2660
Q gi|254780163|r  262 RIFSLDMGNLIAGTRYRGDFEERIKKIVKEIES---YAN-AILYIDEIHTLVGAGSASGISVDASN-LLKPALS--SGAV  334 (798)
Q Consensus       262 ~i~~ld~~~l~ag~~~rg~fe~r~~~~~~~~~~---~~~-~ilfideih~ligag~~~g~~~d~an-~lkP~L~--rg~~  334 (798)
                      -++++|.++      -+|-  +-++.+++.+.-   .+. -|..|||+|+|-         -.+-| +|| -|.  -.-+
T Consensus        89 d~~e~daas------~~~v--~~~r~~~~~~~~~p~~~~~kvy~idevhmls---------~~~fna~lk-tleepp~~v  150 (663)
T PRK08770         89 DLLEIDAAS------NTGV--DDVREVIENAQYMPSRGKFKVYLIDEVHMLS---------KAAFNALLK-TLEEPPEHV  150 (663)
T ss_pred             CEEEEECCC------CCCH--HHHHHHHHHCCCCCCCCCEEEEEEECHHHCC---------HHHHHHHHH-HHCCCCCCE
T ss_conf             658864676------5888--9999999844358877743699970043328---------999999987-402786442


Q ss_pred             EEEEECCHHHHHHHHHCCHHHHHHCEEEEECCCCHHHHHHHHHHHHHHHHHHCCCEECCHHHHHHHHHHHHHCCCCCCHH
Q ss_conf             38873048999998520111432001443068786899999986127665410351211178999998654201555646
Q gi|254780163|r  335 RCIGSTTYSEYRQFFEKDKALVRRFQKIDVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLPD  414 (798)
Q Consensus       335 ~~IgatT~~ey~~~~e~d~al~rrF~~i~v~ep~~~~~~~iL~~~~~~ye~~h~v~~~~~al~~av~ls~ryi~~r~lPd  414 (798)
                      ++|-|||.-  +|.  .-.-|.|. +....+-.+.++-..-|..+..    .-+|.|.++||....+.+.--+.|     
T Consensus       151 ~f~~att~~--~k~--p~t~~src-~~f~~~~~~~~~~~~~l~~~~~----~e~~~~~~~~~~~~~~~~~gs~rd-----  216 (663)
T PRK08770        151 KFLLATTDP--QKL--PVTVLSRC-LQFNLKRLDEDQIQGQMTRILA----AEQIESDPSAIVQLSKAADGSLRD-----  216 (663)
T ss_pred             EEEEECCCH--HHC--CHHHHHHH-HHCCCCCCCHHHHHHHHHHHHH----HCCCCCCHHHHHHHHHHCCCCHHH-----
T ss_conf             899854873--337--48999888-7634377999999999999999----839976999999999974785677-----


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHCCCCCC---HHHHHCCHHHHHHHHCCHHHHHHHCHHHHHHHHHH
Q ss_conf             798899865333321144322113657899986631024531---01110011233421000024665345899999999
Q gi|254780163|r  415 KAIDVIDEAGASQILQPLSKRRKFITEKDIKKTIASMNRSIH---TTSFSRDDDSVLSNLEKNLGTVVYGQEEAIKKLSS  491 (798)
Q Consensus       415 kAidllDea~a~~~~~~~~~~~~~~~~~~i~~~~~~~~~gip---~~~~~~~~~~~l~~l~~~l~~~v~GQ~~ai~~v~~  491 (798)
                       |..|+|.|-|..        ...|+.++|..++-..-.+..   +..+...+...++.+-+.|..+-+.=+.+.+.+..
T Consensus       217 -~lsl~~q~~~~~--------~~~~~~~~v~~mlg~~~~~~~~~l~~al~~~d~~~~~~~~~~~~~~~~~~~~~l~~l~~  287 (663)
T PRK08770        217 -GLSLLDQAIAYA--------GGALREDVVRTMLGTVDRTQVGAMLQALADGDGARLLQVVAALAEFSPDWSGVLEALAE  287 (663)
T ss_pred             -HHHHHHHHHHHC--------CCCCCHHHHHHHHCCCCHHHHHHHHHHHHHCCHHHHHHHHHHHHHHCCCHHHHHHHHHH
T ss_conf             -888999999866--------89768999999848888789999999999668999999999999868899999999999


Q ss_pred             HHHH
Q ss_conf             9877
Q gi|254780163|r  492 SIKI  495 (798)
Q Consensus       492 ~i~~  495 (798)
                      .+.+
T Consensus       288 ~~~~  291 (663)
T PRK08770        288 ALHR  291 (663)
T ss_pred             HHHH
T ss_conf             9999


No 182
>COG0593 DnaA ATPase involved in DNA replication initiation [DNA replication, recombination, and repair]
Probab=98.65  E-value=3.4e-06  Score=63.65  Aligned_cols=209  Identities=21%  Similarity=0.357  Sum_probs=121.7

Q ss_pred             CCEEEE-CCCCCHHHHHHHHHHHHHHCCCCCHHHHEEEEEEEEHHHHHCCCCCCCHHHHHHHHHH----HHHC-CCCCE-
Q ss_conf             874896-6764116689999999985489883452014455404675306343123789999999----8720-38983-
Q gi|254780163|r  226 NNPLYV-GDPGVGKTAIAEGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGDFEERIKKIV----KEIE-SYANA-  298 (798)
Q Consensus       226 Nn~~lv-G~~gvGktaive~la~~i~~~~vp~~l~~~~i~~ld~~~l~ag~~~rg~fe~r~~~~~----~~~~-~~~~~-  298 (798)
                      -||+++ |+.|.|||.+.+.....+.+...     +.+++-+......         .+-+.++.    ++.+ .. ++ 
T Consensus       113 ~nplfi~G~~GlGKTHLl~Aign~~~~~~~-----~a~v~y~~se~f~---------~~~v~a~~~~~~~~Fk~~y-~~d  177 (408)
T COG0593         113 YNPLFIYGGVGLGKTHLLQAIGNEALANGP-----NARVVYLTSEDFT---------NDFVKALRDNEMEKFKEKY-SLD  177 (408)
T ss_pred             CCCEEEECCCCCCHHHHHHHHHHHHHHHCC-----CCEEEECCHHHHH---------HHHHHHHHHHHHHHHHHHH-CCC
T ss_conf             895799879999789999999999986299-----8648850489989---------9999998850488888764-267


Q ss_pred             EEEECCHHHHHCCCCCCCCCCCHHHHHHHHHCCCCEEEEEEC--CHHHHHHHHHCCHHHHHHCE---EEEECCCCHHHHH
Q ss_conf             999736166301554443447778888766302660388730--48999998520111432001---4430687868999
Q gi|254780163|r  299 ILYIDEIHTLVGAGSASGISVDASNLLKPALSSGAVRCIGST--TYSEYRQFFEKDKALVRRFQ---KIDVSEPSIEDAI  373 (798)
Q Consensus       299 ilfideih~ligag~~~g~~~d~an~lkP~L~rg~~~~Igat--T~~ey~~~~e~d~al~rrF~---~i~v~ep~~~~~~  373 (798)
                      .|.||+|+-+.|..++..   -.=+++--....|. |+|-+.  +|.|...   .++-|..||.   .+.|.+|+.++.+
T Consensus       178 lllIDDiq~l~gk~~~qe---efFh~FN~l~~~~k-qIvltsdr~P~~l~~---~~~rL~SR~~~Gl~~~I~~Pd~e~r~  250 (408)
T COG0593         178 LLLIDDIQFLAGKERTQE---EFFHTFNALLENGK-QIVLTSDRPPKELNG---LEDRLRSRLEWGLVVEIEPPDDETRL  250 (408)
T ss_pred             EEEECHHHHHCCCHHHHH---HHHHHHHHHHHCCC-EEEEECCCCCHHHCC---CCHHHHHHHHCEEEEEECCCCHHHHH
T ss_conf             355513867567715799---99999998885088-799970788322110---35889989863057752798889999


Q ss_pred             HHHHHHHHHHHHHCCCEECCHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHH-----------HHHHH-HHHHCCCCH
Q ss_conf             999861276654103512111789999986542015556467988998653333-----------21144-322113657
Q gi|254780163|r  374 EIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLPDKAIDVIDEAGASQ-----------ILQPL-SKRRKFITE  441 (798)
Q Consensus       374 ~iL~~~~~~ye~~h~v~~~~~al~~av~ls~ryi~~r~lPdkAidllDea~a~~-----------~~~~~-~~~~~~~~~  441 (798)
                      .||+.    -....++.++++++...+.-..|=+.+  |. -|++-||..+...           .+... ....+ ++.
T Consensus       251 aiL~k----ka~~~~~~i~~ev~~~la~~~~~nvRe--Le-gaL~~l~~~a~~~~~~iTi~~v~e~L~~~~~~~~~-iti  322 (408)
T COG0593         251 AILRK----KAEDRGIEIPDEVLEFLAKRLDRNVRE--LE-GALNRLDAFALFTKRAITIDLVKEILKDLLRAGEK-ITI  322 (408)
T ss_pred             HHHHH----HHHHCCCCCCHHHHHHHHHHHHCCHHH--HH-HHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHCCCC-CCH
T ss_conf             99999----998658888879999999970030999--99-99999999998538757699999999986401455-899


Q ss_pred             HHHHHHHHHCCCCCCHHHHHCCHH
Q ss_conf             899986631024531011100112
Q gi|254780163|r  442 KDIKKTIASMNRSIHTTSFSRDDD  465 (798)
Q Consensus       442 ~~i~~~~~~~~~gip~~~~~~~~~  465 (798)
                      ++|..+|++.- +|++..+....+
T Consensus       323 e~I~~~Va~~y-~v~~~dl~s~~R  345 (408)
T COG0593         323 EDIQKIVAEYY-NVKVSDLLSKSR  345 (408)
T ss_pred             HHHHHHHHHHH-CCCHHHHHCCCC
T ss_conf             99999999884-988999624566


No 183
>PRK05648 DNA polymerase III subunits gamma and tau; Reviewed
Probab=98.65  E-value=2.5e-05  Score=57.42  Aligned_cols=39  Identities=8%  Similarity=0.239  Sum_probs=22.0

Q ss_pred             HHHHEEEEEEEEHHHHHCCCCCCCHHHHHHHHHHHHHCCCCCEEEEE
Q ss_conf             34520144554046753063431237899999998720389839997
Q gi|254780163|r  256 DILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIESYANAILYI  302 (798)
Q Consensus       256 ~~l~~~~i~~ld~~~l~ag~~~rg~fe~r~~~~~~~~~~~~~~ilfi  302 (798)
                      +.-..++||-+|=--|++...        +..+++.++.-+.-+.||
T Consensus       115 p~~~~~kv~~idevhmls~~~--------fnallktleepp~~v~f~  153 (705)
T PRK05648        115 PTRGRYKVYLIDEVHMLSSHS--------FNALLKTLEEPPPHVKFL  153 (705)
T ss_pred             CCCCCEEEEEEEHHHHCCHHH--------HHHHHHHCCCCCCCEEEE
T ss_conf             767745799984265417999--------999987404797545999


No 184
>KOG2028 consensus
Probab=98.64  E-value=8.2e-08  Score=75.31  Aligned_cols=213  Identities=16%  Similarity=0.254  Sum_probs=125.2

Q ss_pred             HHCCCCHHHHHHHHHHCCCCCCHHHHHCCHHHHHHHHCCHHHHHHHCHHHHHHHHHHHHHHHHCCCCCCCCCCCEEEEEC
Q ss_conf             21136578999866310245310111001123342100002466534589999999998775204456578740688614
Q gi|254780163|r  435 RRKFITEKDIKKTIASMNRSIHTTSFSRDDDSVLSNLEKNLGTVVYGQEEAIKKLSSSIKIARAGLSDPNKPIGCYVFSG  514 (798)
Q Consensus       435 ~~~~~~~~~i~~~~~~~~~gip~~~~~~~~~~~l~~l~~~l~~~v~GQ~~ai~~v~~~i~~~~~gl~~~~rP~g~flf~G  514 (798)
                      ++......++...+    .+-|+..     +.+     -+--.-++||++++..  +.+.|+..  . .+| +-|+.|-|
T Consensus       110 ~~~~l~~~e~R~~~----qh~PLae-----rmR-----PktL~dyvGQ~hlv~q--~gllrs~i--e-q~~-ipSmIlWG  169 (554)
T KOG2028         110 HKRALAAEEIRQML----QHKPLAE-----RMR-----PKTLDDYVGQSHLVGQ--DGLLRSLI--E-QNR-IPSMILWG  169 (554)
T ss_pred             CCCHHHHHHHHHHH----CCCCHHH-----HCC-----CCHHHHHCCHHHHCCC--CHHHHHHH--H-CCC-CCCEEEEC
T ss_conf             42112048888775----1697455-----418-----4368775053441483--26899998--7-088-87058866


Q ss_pred             CCCHHHHHHHHHHHHHCCCCEEEEE-HHHHHCCCCCCHHCCCCCHHCCCCCCCCCCHHHHHCCCEEEEECCHHHCCHHHH
Q ss_conf             3200388999998730477337720-688612465301104780002564443100355515851777404455028999
Q gi|254780163|r  515 PTGVGKTEISKQLAFALGVQLLRFD-MSEYMERHAVSRLIGAPPGYVGFGQGGILADSVDQNPYSVVLLDEIEKSHPDVL  593 (798)
Q Consensus       515 ptGvGKTelak~la~~~~~~lir~d-msey~e~~~vs~LiGappGYvG~~egg~Lte~vr~~P~sVvl~DEiEKAh~~v~  593 (798)
                      |.|+|||-||+.++....++-.||= .|-  ....+.-+-+.      +++.-.+  ..-.+--+|+++|||..-+..-+
T Consensus       170 ppG~GKTtlArlia~tsk~~SyrfvelSA--t~a~t~dvR~i------fe~aq~~--~~l~krkTilFiDEiHRFNksQQ  239 (554)
T KOG2028         170 PPGTGKTTLARLIASTSKKHSYRFVELSA--TNAKTNDVRDI------FEQAQNE--KSLTKRKTILFIDEIHRFNKSQQ  239 (554)
T ss_pred             CCCCCHHHHHHHHHHHCCCCCEEEEEEEC--CCCCHHHHHHH------HHHHHHH--HHHHCCEEEEEEHHHHHHHHHHH
T ss_conf             99876588999998605777427999741--45661889999------9998878--76524406987377655323211


Q ss_pred             HHHHHHHHHHHCCCCCCCEECCCCEEEEEECCCCHHHHHHCCCCCCCCCCHHHHHHHHHHHCCHHHHCCCCEEEECCCCC
Q ss_conf             99999877750217799776125429999424214553303689882111488999998728878817768289628899
Q gi|254780163|r  594 NILLQIMDYGILTDQSGKKISFRNVILIMTTNAGALEMSKARIGFGSSRNDDADKEALRNFLSPEFLNRLDSIIPFFPLS  673 (798)
Q Consensus       594 ~~llqild~G~ltd~~Gr~vdf~n~iii~TsN~G~~~~~~~~~g~~~~~~~~~~~~~l~~~f~peflnRid~ii~F~~l~  673 (798)
                      ++||-..++|.+|            +|=.|+       .+.+  |       .    |    -..++.|. .|++.++|.
T Consensus       240 D~fLP~VE~G~I~------------lIGATT-------ENPS--F-------q----l----n~aLlSRC-~VfvLekL~  282 (554)
T KOG2028         240 DTFLPHVENGDIT------------LIGATT-------ENPS--F-------Q----L----NAALLSRC-RVFVLEKLP  282 (554)
T ss_pred             HCCCCEECCCCEE------------EEECCC-------CCCC--C-------C----H----HHHHHHCC-CEEEECCCC
T ss_conf             0034213067069------------985366-------8976--0-------1----1----27787316-066733688


Q ss_pred             HHHHHHHHHHHHHHHHHHHHH----CCCEEEECHHHHHHHHHCCC
Q ss_conf             999999999999999999986----69889998899999997189
Q gi|254780163|r  674 SDIIRQVVHKFIMKLELQLQE----KGISFHFSEEVINWLVSHGY  714 (798)
Q Consensus       674 ~~~~~~i~~~~l~~l~~~l~~----~~i~l~~~~~~~~~l~~~~~  714 (798)
                      .+++..|+..-+.-|..--+.    -+-.+.+++++++||+..+-
T Consensus       283 ~n~v~~iL~raia~l~dser~~~~l~n~s~~ve~siidyla~lsd  327 (554)
T KOG2028         283 VNAVVTILMRAIASLGDSERPTDPLPNSSMFVEDSIIDYLAYLSD  327 (554)
T ss_pred             HHHHHHHHHHHHHHHCCCCCCCCCCCCCCHHHHHHHHHHHHHHCC
T ss_conf             899999999998763210256889998312456889999987047


No 185
>PRK08084 DNA replication initiation factor; Provisional
Probab=98.64  E-value=3.7e-06  Score=63.39  Aligned_cols=187  Identities=14%  Similarity=0.185  Sum_probs=99.0

Q ss_pred             HHHHHHHHHHHHHHHHCCCCCCE-EEECCCCCHHHHHHHHHHHHHHCCCCCHHHHEEEEEEEEHHHHHCCCCCCCHHHHH
Q ss_conf             22178999999998622677874-89667641166899999999854898834520144554046753063431237899
Q gi|254780163|r  206 LVGRHEEINRTIQILCRRSKNNP-LYVGDPGVGKTAIAEGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGDFEER  284 (798)
Q Consensus       206 VIGRd~EI~riiqIL~RR~KNn~-~lvG~~gvGktaive~la~~i~~~~vp~~l~~~~i~~ld~~~l~ag~~~rg~fe~r  284 (798)
                      |+|-..++-..++......-+++ .|.|++|+|||.+.+.+...+.+.       +++++-+.+...          .+.
T Consensus        25 i~g~n~~~~~al~~~~~~~~~~~l~l~G~~G~GKTHLLqA~~~~~~~~-------~~~~~yl~~~~~----------~~~   87 (235)
T PRK08084         25 YPGDNDSLLAALQNVLRQEHSGYIYLWGREGAGRSHLLHAACAELSQR-------GDAVGYVPLDKR----------AWF   87 (235)
T ss_pred             CCCCCHHHHHHHHHHHHCCCCCEEEEECCCCCCHHHHHHHHHHHHHCC-------CCCEEEEEHHHH----------HHH
T ss_conf             448869999999999857898769998999988899999999999707-------985799877986----------651


Q ss_pred             HHHHHHHHCCCCCEEEEECCHHHHHCCCCCCCCCCCHHHHHHHHHCCCCEEEEEE-CCHHHHHHHHHCCHHHHHHCE---
Q ss_conf             9999987203898399973616630155444344777888876630266038873-048999998520111432001---
Q gi|254780163|r  285 IKKIVKEIESYANAILYIDEIHTLVGAGSASGISVDASNLLKPALSSGAVRCIGS-TTYSEYRQFFEKDKALVRRFQ---  360 (798)
Q Consensus       285 ~~~~~~~~~~~~~~ilfideih~ligag~~~g~~~d~an~lkP~L~rg~~~~Iga-tT~~ey~~~~e~d~al~rrF~---  360 (798)
                      ...+++.++..  -++.||+||.+.|....+.   -.-|++--...+|.-++|-+ ..+-..-....  +-|..||+   
T Consensus        88 ~~~~l~~l~~~--dll~iDDi~~i~g~~~~ee---~lF~l~N~~~~~g~~~ll~ts~~~P~~l~~~l--~DL~SRl~~g~  160 (235)
T PRK08084         88 VPEVLEGMEQL--SLVCIDNIECIAGDELWEM---AIFDLYNRILESGKTRLLITGDRPPRQLNLGL--PDLASRLDWGQ  160 (235)
T ss_pred             HHHHHHHHHHC--CEEEEECHHHHCCCHHHHH---HHHHHHHHHHHHCCCEEEEECCCCHHHCCCCC--HHHHHHHHCCC
T ss_conf             79999876418--9899827455469978999---99999999998489669996798824302312--88999995697


Q ss_pred             EEEECCCCHHHHHHHHHHHHHHHHHHCCCEECCHHHHHHHHHHHHHCCCCCCHHHHHHHHHHH
Q ss_conf             443068786899999986127665410351211178999998654201555646798899865
Q gi|254780163|r  361 KIDVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLPDKAIDVIDEA  423 (798)
Q Consensus       361 ~i~v~ep~~~~~~~iL~~~~~~ye~~h~v~~~~~al~~av~ls~ryi~~r~lPdkAidllDea  423 (798)
                      .+.+.+|+.++-+.||+..    -...|+.++++++.+.++-..|=+..   =..+++-||.+
T Consensus       161 ~~~i~~~dde~~~~iL~~~----a~~rgl~l~~~V~~yl~~~~~R~~~~---L~~~l~~Ld~~  216 (235)
T PRK08084        161 IYKLQPLSDEEKLQALQLR----ARLRGFELPEDVGRFLLKRLDREMRT---LFMTLDQLDKA  216 (235)
T ss_pred             EEEECCCCHHHHHHHHHHH----HHHCCCCCCHHHHHHHHHHCCCCHHH---HHHHHHHHHHH
T ss_conf             2785599989999999999----99739999989999999861588999---99999999999


No 186
>CHL00081 chlI Mg-protoporyphyrin IX chelatase
Probab=98.64  E-value=2.2e-06  Score=65.09  Aligned_cols=238  Identities=21%  Similarity=0.267  Sum_probs=122.6

Q ss_pred             HHHHHHHHHHHHHHHHCCCCCCEEEECCCCCHHHHHHHHHHHHHHC-----CC-------CCH-----------------
Q ss_conf             2217899999999862267787489667641166899999999854-----89-------883-----------------
Q gi|254780163|r  206 LVGRHEEINRTIQILCRRSKNNPLYVGDPGVGKTAIAEGFAKQIVD-----GM-------VPD-----------------  256 (798)
Q Consensus       206 VIGRd~EI~riiqIL~RR~KNn~~lvG~~gvGktaive~la~~i~~-----~~-------vp~-----------------  256 (798)
                      |+|-|+=...++=.+--.+=..+++-|++|+|||.+|.+||..+-.     +.       .|+                 
T Consensus        14 IvGQe~~k~aLll~av~p~iGgVLi~G~~GtgKStlvRala~lLP~i~~v~~~~f~~~p~~p~~~~~~~~~~~~~~~~~~   93 (347)
T CHL00081         14 IVGQEEMKLALLLNVIDPKIGGVMIMGDRGTGKSTTIRALVDLLPEIEVVKNDPFNSDPRDPDLMSDEVRERIRNGEKIP   93 (347)
T ss_pred             HCCHHHHHHHHHHHHCCCCCCEEEEECCCCCCHHHHHHHHHHHCCCCEEECCCCCCCCCCCCCCCCHHHHHHHCCCCCCC
T ss_conf             53849999999998257887869987899874999999999857874220688767898981002426665431466675


Q ss_pred             -HHHEEEEEEEEHHHH---HCCCCCCCHHHHHHH--------HHHHHHCCCCCEEEEECCHHHHHCCCCCCCCCCCHHHH
Q ss_conf             -452014455404675---306343123789999--------99987203898399973616630155444344777888
Q gi|254780163|r  257 -ILLGARIFSLDMGNL---IAGTRYRGDFEERIK--------KIVKEIESYANAILYIDEIHTLVGAGSASGISVDASNL  324 (798)
Q Consensus       257 -~l~~~~i~~ld~~~l---~ag~~~rg~fe~r~~--------~~~~~~~~~~~~ilfideih~ligag~~~g~~~d~an~  324 (798)
                       ......+++|-+++-   +.|+-   ++|.-++        .++.++  + .=|||||||.-+         .-...|.
T Consensus        94 ~~~~~~p~v~lPlgaTEDrv~Gsl---Die~al~~G~~~f~pGlLa~A--~-rGiLyvDEINll---------~d~~v~~  158 (347)
T CHL00081         94 TKKIKIPMVDLPLGATEDRVCGTI---DIEKALTEGVKAFEPGLLAKA--N-RGILYVDEVNLL---------DDHLVDI  158 (347)
T ss_pred             CEECCCCEEECCCCCCCCEECCCH---HHHHHHHCCCCCCCCCHHHHC--C-CCEEEEEHHHHH---------HHHHHHH
T ss_conf             211468625368888523011400---099898458711565312220--3-885886145432---------3799999


Q ss_pred             HHHHHCCCCE---------------EEEEECCHHHHHHHHHCCHHHHHHCE-EEEEC-CCCHHHHHHHHHHHHHHHHH--
Q ss_conf             8766302660---------------38873048999998520111432001-44306-87868999999861276654--
Q gi|254780163|r  325 LKPALSSGAV---------------RCIGSTTYSEYRQFFEKDKALVRRFQ-KIDVS-EPSIEDAIEIVKGIKPYFEE--  385 (798)
Q Consensus       325 lkP~L~rg~~---------------~~IgatT~~ey~~~~e~d~al~rrF~-~i~v~-ep~~~~~~~iL~~~~~~ye~--  385 (798)
                      |--+++.|..               -+||+.-|+|.    |--++|..||- .|.+. +++.++-++|++.. ..|+.  
T Consensus       159 LLda~a~G~~~VEReG~S~~~Pa~F~liaT~NPeEg----eLrp~llDRF~l~v~v~~~~~~e~R~eiv~~r-~~f~~~p  233 (347)
T CHL00081        159 LLDSAASGWNTVEREGISIRHPARFVLIGSGNPEEG----ELRPQLLDRFGMHAEIRTVKDPELRVKIVEQR-SNFDKNP  233 (347)
T ss_pred             HHHHHHCCEEEECCCCEEECCCCCEEEEECCCCCCC----CCCHHHHHHEEEEEECCCCCCHHHHHHHHHHH-HHHHHCH
T ss_conf             999985580898046423305750068855786556----74888882632267458878989999999999-9765196


Q ss_pred             --HC-CCEECCHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHH---------------HHHHHHHHCCCCHHHHHHH
Q ss_conf             --10-35121117899999865420155564679889986533332---------------1144322113657899986
Q gi|254780163|r  386 --HH-QLRYSKEAIRAAVQLSVRHFTSRKLPDKAIDVIDEAGASQI---------------LQPLSKRRKFITEKDIKKT  447 (798)
Q Consensus       386 --~h-~v~~~~~al~~av~ls~ryi~~r~lPdkAidllDea~a~~~---------------~~~~~~~~~~~~~~~i~~~  447 (798)
                        |. ...-..+.+..-+..+...+++-..||..+..+-+.|....               ..+.-..+..|+.+||..+
T Consensus       234 ~~f~~~~~~~~~~l~~~I~~Ar~~L~~V~v~~~~~~~i~~~~~~~~v~g~RA~I~l~raARA~AAL~GR~~V~~eDv~~a  313 (347)
T CHL00081        234 ENFREKYSESQDALKTQIILARQLLPNVEIDYDLRVKISQICSELDVDGLRGDIVTNRAAKALAAFNGRDEVTPGDIEKV  313 (347)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHCCCCCCCHHHHHHH
T ss_conf             99999988789999999999986447735599999999999998489987189999999999999869983689999999


Q ss_pred             HH----HCCCCCCHHHHHCC
Q ss_conf             63----10245310111001
Q gi|254780163|r  448 IA----SMNRSIHTTSFSRD  463 (798)
Q Consensus       448 ~~----~~~~gip~~~~~~~  463 (798)
                      ..    .+.+-.|......+
T Consensus       314 a~lVL~HRlrr~P~e~~~s~  333 (347)
T CHL00081        314 ITLCLRHRLRKDPLESIDSG  333 (347)
T ss_pred             HHHHHHHHCCCCCCCCCCCC
T ss_conf             99842010579962001652


No 187
>pfam07728 AAA_5 AAA domain (dynein-related subfamily). This Pfam entry includes some of the AAA proteins not detected by the pfam00004 model.
Probab=98.64  E-value=2.7e-08  Score=78.72  Aligned_cols=116  Identities=24%  Similarity=0.267  Sum_probs=65.5

Q ss_pred             CEEEECCCCCHHHHHHHHHHHHHHCCCCCHHHHEEEEEEEEHHHHHCCCCC---CCHHHHHHHHHHHHHCCCCCEEEEEC
Q ss_conf             748966764116689999999985489883452014455404675306343---12378999999987203898399973
Q gi|254780163|r  227 NPLYVGDPGVGKTAIAEGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRY---RGDFEERIKKIVKEIESYANAILYID  303 (798)
Q Consensus       227 n~~lvG~~gvGktaive~la~~i~~~~vp~~l~~~~i~~ld~~~l~ag~~~---rg~fe~r~~~~~~~~~~~~~~ilfid  303 (798)
                      +++|+|+||+|||++++.+|+++....+  ...+.. -..+...|+.+..+   ...|..   ..+-...+.+ -+||+|
T Consensus         1 ~vll~Gp~G~GKT~la~~la~~l~~~~~--~~i~~~-~~~~~~dl~G~~~~~~~~~~~~~---g~l~~a~~~g-~vl~lD   73 (139)
T pfam07728         1 GVLLVGPPGTGKSELAERLAAALSNRPV--FYVQLT-RDTTEEDLKGRRNIANGTTSWVD---GPLVRAAREG-EIAVLD   73 (139)
T ss_pred             CEEEECCCCCHHHHHHHHHHHHCCCCCC--HHHCCC-CCCCHHHCCCCEECCCCCEEEEC---CHHHCCCCCC-CEEEEC
T ss_conf             9899989975699999999998079831--112146-55652220573423799357815---5141010128-689963


Q ss_pred             CHHHHHCCCCCCCCCCCHHHHHHHHHCCCC--------------------EEEEEECCHHHHHHHHHCCHHHHHHC
Q ss_conf             616630155444344777888876630266--------------------03887304899999852011143200
Q gi|254780163|r  304 EIHTLVGAGSASGISVDASNLLKPALSSGA--------------------VRCIGSTTYSEYRQFFEKDKALVRRF  359 (798)
Q Consensus       304 eih~ligag~~~g~~~d~an~lkP~L~rg~--------------------~~~IgatT~~ey~~~~e~d~al~rrF  359 (798)
                      ||...         +-++-+.|-+.|..++                    +++|+++.+. |+...+-|+||.|||
T Consensus        74 Ein~a---------~~~v~~~L~~~le~~~~~~~~~~~~~~~~~~~~~~~f~viaT~N~~-~~g~~~l~~Al~~RF  139 (139)
T pfam07728        74 EINRA---------NPDVLNSLLSLLDERRLLLPEGGELVKVAPDDFAKRFRLIATMNPL-DRGLNELSPALRSRF  139 (139)
T ss_pred             CHHHC---------CHHHHHHHHHHHCCCEEEECCCCEEECCCCCCCCCCEEEEEEECCC-CCCCCCCCHHHHCCC
T ss_conf             43448---------9999999999974896983689727336666789996999975896-547800998997509


No 188
>PRK12377 putative replication protein; Provisional
Probab=98.63  E-value=6.2e-07  Score=68.99  Aligned_cols=122  Identities=25%  Similarity=0.340  Sum_probs=73.1

Q ss_pred             CHHHHHHHHHHHHHHHHCCCCCCCCCCCEEEEECCCCHHHHHHHHHHHH---HCCCCEEEEEHHHHHCCCCCCHHCCCCC
Q ss_conf             4589999999998775204456578740688614320038899999873---0477337720688612465301104780
Q gi|254780163|r  481 GQEEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAF---ALGVQLLRFDMSEYMERHAVSRLIGAPP  557 (798)
Q Consensus       481 GQ~~ai~~v~~~i~~~~~gl~~~~rP~g~flf~GptGvGKTelak~la~---~~~~~lir~dmsey~e~~~vs~LiGapp  557 (798)
                      ||..|+..--.-.    .++.+   -.++++|+||+|||||.||-+++.   ..+....-+.+++.++     +|-.+  
T Consensus        82 ~~~~a~~~a~~~~----~~F~~---~~~NlIf~G~pGtGKTHLA~AIg~~a~~~G~sVlF~t~~dLv~-----~L~~a--  147 (248)
T PRK12377         82 GQRYALSQAKSIA----DELMT---GCTNFVFSGKPGTGKNHLAAAIGNRLLAKGRSVIVVTVPDVMS-----RLHES--  147 (248)
T ss_pred             HHHHHHHHHHHHH----HHHHC---CCCEEEEECCCCCCHHHHHHHHHHHHHHCCCEEEEEEHHHHHH-----HHHHH--
T ss_conf             8999999999999----98731---8860899899998788999999999998799699988999999-----99999--


Q ss_pred             HHCCCCCCCCCCHH-HH-HCCCEEEEECCH--HHCCHHHHHHHHHHHHHHHCCCCCCCEECCCCEEEEEECCCCHHHH
Q ss_conf             00256444310035-55-158517774044--5502899999999877750217799776125429999424214553
Q gi|254780163|r  558 GYVGFGQGGILADS-VD-QNPYSVVLLDEI--EKSHPDVLNILLQIMDYGILTDQSGKKISFRNVILIMTTNAGALEM  631 (798)
Q Consensus       558 GYvG~~egg~Lte~-vr-~~P~sVvl~DEi--EKAh~~v~~~llqild~G~ltd~~Gr~vdf~n~iii~TsN~G~~~~  631 (798)
                          |++ |.+-+. ++ -.-+-++.+||+  ....+.--++|.|+++.-.-. .         .=+|+|||+.-.+.
T Consensus       148 ----~~~-g~~~~k~l~~l~~~dLLIIDElG~~~~s~~~~~llfqlI~~Ry~~-~---------ks~IiTTNL~f~ew  210 (248)
T PRK12377        148 ----YDN-GQSGEKFLQELCKVDLLVLDEIGIQRETKNEQVVLNQIIDRRTAS-M---------RSVGMLTNLNHEAM  210 (248)
T ss_pred             ----HHC-CCCHHHHHHHHHCCCEEEEHHCCCCCCCHHHHHHHHHHHHHHHHC-C---------CCEEEECCCCHHHH
T ss_conf             ----984-850999999973389898600057889867999999999999855-7---------98689758997799


No 189
>COG2812 DnaX DNA polymerase III, gamma/tau subunits [DNA replication, recombination, and repair]
Probab=98.63  E-value=2.8e-07  Score=71.47  Aligned_cols=212  Identities=23%  Similarity=0.330  Sum_probs=125.7

Q ss_pred             HHHHCCCCHHHHHHHHHHHHHHHHHHCCCCCC-EEEECCCCCHHHHHHHHHHHHHHCCC--CCHHH----------HE--
Q ss_conf             87754861122217899999999862267787-48966764116689999999985489--88345----------20--
Q gi|254780163|r  196 EKVKKGKVDILVGRHEEINRTIQILCRRSKNN-PLYVGDPGVGKTAIAEGFAKQIVDGM--VPDIL----------LG--  260 (798)
Q Consensus       196 e~AreGKLDPVIGRd~EI~riiqIL~RR~KNn-~~lvG~~gvGktaive~la~~i~~~~--vp~~l----------~~--  260 (798)
                      .+-|--.++-|+|-+.-.+.+...|.-.+=.+ -++-|+-|||||+++.-+|.-+...+  ..+..          .|  
T Consensus         8 rKyRP~~F~evvGQe~v~~~L~nal~~~ri~hAYlfsG~RGvGKTt~Ari~AkalNC~~~~~~ePC~~C~~Ck~I~~g~~   87 (515)
T COG2812           8 RKYRPKTFDDVVGQEHVVKTLSNALENGRIAHAYLFSGPRGVGKTTIARILAKALNCENGPTAEPCGKCISCKEINEGSL   87 (515)
T ss_pred             HHHCCCCHHHHCCCHHHHHHHHHHHHHCCCHHHHHHCCCCCCCCHHHHHHHHHHHCCCCCCCCCCCHHHHHHHHHHCCCC
T ss_conf             88583007776364899999999998084233365137777671049999999956889877772253166686514886


Q ss_pred             EEEEEEEHHHHHCCCCCCCHHHHHHHHHHHHHCC----CCCEEEEECCHHHHHCCCCCCCCCCCHHH-HHHHHHC--CCC
Q ss_conf             1445540467530634312378999999987203----89839997361663015544434477788-8876630--266
Q gi|254780163|r  261 ARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIES----YANAILYIDEIHTLVGAGSASGISVDASN-LLKPALS--SGA  333 (798)
Q Consensus       261 ~~i~~ld~~~l~ag~~~rg~fe~r~~~~~~~~~~----~~~~ilfideih~ligag~~~g~~~d~an-~lkP~L~--rg~  333 (798)
                      .-++++|.++      -+|=  +-++.+++++.-    ...-|..|||+|++-         --|-| +|| -|.  ---
T Consensus        88 ~DviEiDaAS------n~gV--ddiR~i~e~v~y~P~~~ryKVyiIDEvHMLS---------~~afNALLK-TLEEPP~h  149 (515)
T COG2812          88 IDVIEIDAAS------NTGV--DDIREIIEKVNYAPSEGRYKVYIIDEVHMLS---------KQAFNALLK-TLEEPPSH  149 (515)
T ss_pred             CCCHHHHHHH------CCCH--HHHHHHHHHHCCCCCCCCCEEEEEECHHHHH---------HHHHHHHHC-CCCCCCCC
T ss_conf             4101136444------5486--7999999872468866664189983187643---------788888751-11368667


Q ss_pred             EEEEEECCHHHHHHHHHCCHHHHHHCEEEEECCCCHHHHHHHHHHHHHHHHHHCCCEECCHHHHHHHHHHHHHCCCCCCH
Q ss_conf             03887304899999852011143200144306878689999998612766541035121117899999865420155564
Q gi|254780163|r  334 VRCIGSTTYSEYRQFFEKDKALVRRFQKIDVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLP  413 (798)
Q Consensus       334 ~~~IgatT~~ey~~~~e~d~al~rrF~~i~v~ep~~~~~~~iL~~~~~~ye~~h~v~~~~~al~~av~ls~ryi~~r~lP  413 (798)
                      +.+|=|||..  +|.  +.. .-.|-|.-...--+.++-..-|..+.    .--++.+.++|+....+.|.-=+.|    
T Consensus       150 V~FIlATTe~--~Ki--p~T-IlSRcq~f~fkri~~~~I~~~L~~i~----~~E~I~~e~~aL~~ia~~a~Gs~RD----  216 (515)
T COG2812         150 VKFILATTEP--QKI--PNT-ILSRCQRFDFKRLDLEEIAKHLAAIL----DKEGINIEEDALSLIARAAEGSLRD----  216 (515)
T ss_pred             EEEEEECCCC--CCC--CHH-HHHCCCCCCCCCCCHHHHHHHHHHHH----HHCCCCCCHHHHHHHHHHCCCCHHH----
T ss_conf             4899853886--768--404-55212202225799999999999998----7448754799999999982897456----


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHH
Q ss_conf             67988998653333211443221136578999866
Q gi|254780163|r  414 DKAIDVIDEAGASQILQPLSKRRKFITEKDIKKTI  448 (798)
Q Consensus       414 dkAidllDea~a~~~~~~~~~~~~~~~~~~i~~~~  448 (798)
                        |..|||.+-+..      .  ..|+..+|..++
T Consensus       217 --alslLDq~i~~~------~--~~It~~~v~~~l  241 (515)
T COG2812         217 --ALSLLDQAIAFG------E--GEITLESVRDML  241 (515)
T ss_pred             --HHHHHHHHHHCC------C--CCCCHHHHHHHH
T ss_conf             --777899999706------7--765699999996


No 190
>PRK07764 DNA polymerase III subunits gamma and tau; Validated
Probab=98.63  E-value=9.5e-06  Score=60.45  Aligned_cols=118  Identities=26%  Similarity=0.309  Sum_probs=74.0

Q ss_pred             HHHHHCHHHHHHHHHHHHHHHHCCCCCCCCCCCEEEEECCCCHHHHHHHHHHHHHC--CCC------EEEEEHHHHHCCC
Q ss_conf             46653458999999999877520445657874068861432003889999987304--773------3772068861246
Q gi|254780163|r  476 GTVVYGQEEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFAL--GVQ------LLRFDMSEYMERH  547 (798)
Q Consensus       476 ~~~v~GQ~~ai~~v~~~i~~~~~gl~~~~rP~g~flf~GptGvGKTelak~la~~~--~~~------lir~dmsey~e~~  547 (798)
                      -..||||++.++.+.++|...|        ---.|||+||.|||||-+|+.||..+  +..      -..-.|-+...-+
T Consensus        14 F~eviGQe~v~~~L~~Ai~~gr--------i~HAYLFsGprG~GKTt~ARilAkaLNC~~~~~~~PCg~C~sC~~i~~g~   85 (775)
T PRK07764         14 FAEVVGQEHVTEPLSTALDSGR--------INHAYLFSGPRGCGKTSSARILARSLNCAQGPTSTPCGVCDSCVALAPGG   85 (775)
T ss_pred             HHHHCCCHHHHHHHHHHHHCCC--------CCCEEEEECCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCCHHHHHHHCCC
T ss_conf             6662285999999999998199--------76337623788878889999999996689999989888876378886389


Q ss_pred             ----CCCHHCCCCCHHCCCCCCCCCCHHHHHCC----CEEEEECCHHHCCHHHHHHHHHHHHHH
Q ss_conf             ----53011047800025644431003555158----517774044550289999999987775
Q gi|254780163|r  548 ----AVSRLIGAPPGYVGFGQGGILADSVDQNP----YSVVLLDEIEKSHPDVLNILLQIMDYG  603 (798)
Q Consensus       548 ----~vs~LiGappGYvG~~egg~Lte~vr~~P----~sVvl~DEiEKAh~~v~~~llqild~G  603 (798)
                          .|-.+=++.  +-|-++=-.|.|.++..|    |-|.++||++.-...-||.||.+|+|=
T Consensus        86 ~~~~DviEiDAAS--~~gVddiReL~e~~~y~P~~~ryKVyIIDEaHmls~~afNALLKtLEEP  147 (775)
T PRK07764         86 PGSLDVVEIDAAS--HGGVDDARELRERAFFAPAQSRYRIFIIDEAHMVTTAGFNALLKIVEEP  147 (775)
T ss_pred             CCCCCEEEECCCC--CCCHHHHHHHHHHCCCCCCCCCEEEEEEECHHHHCHHHHHHHHHHHCCC
T ss_conf             8888668731565--5688999999985476876786359998535440799999998862278


No 191
>KOG0737 consensus
Probab=98.62  E-value=2.1e-07  Score=72.36  Aligned_cols=200  Identities=22%  Similarity=0.358  Sum_probs=115.0

Q ss_pred             HHHHHHHHHHHHHCCCEECCHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHCCC
Q ss_conf             99986127665410351211178999998654201555646798899865333321144322113657899986631024
Q gi|254780163|r  374 EIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLPDKAIDVIDEAGASQILQPLSKRRKFITEKDIKKTIASMNR  453 (798)
Q Consensus       374 ~iL~~~~~~ye~~h~v~~~~~al~~av~ls~ryi~~r~lPdkAidllDea~a~~~~~~~~~~~~~~~~~~i~~~~~~~~~  453 (798)
                      .|.......|+.|..+...|+-.. +-+-|-         -|+..++....+.   +  +.+...|...+-...+++.. 
T Consensus        18 ~i~~~A~~~~~~~~~~~~~d~~~~-~~~eS~---------~~~~~~l~~~~~~---~--s~k~~~i~~ne~E~~i~s~~-   81 (386)
T KOG0737          18 KIVAAAISHHLVHLLVPRLDPNLK-ASRESL---------EKTEELLKNLEAE---L--SLKYRIIQKNEYEKRIASDV-   81 (386)
T ss_pred             HHHHHHHHHHHHHCCCCCCCHHHH-HHHHHH---------HHHHHHHHHHHHH---C--CHHHHHHHHHHHHHHHHHCC-
T ss_conf             999999999999713323271333-348889---------9899999864320---1--01444201317878764020-


Q ss_pred             CCCHHHH--HCCHHHHHHHHCCHHHHHHHCHHHHHHHHHHHHHHHHCCCCCCCCCCCEEEEECCCCHHHHHHHHHHHHHC
Q ss_conf             5310111--00112334210000246653458999999999877520445657874068861432003889999987304
Q gi|254780163|r  454 SIHTTSF--SRDDDSVLSNLEKNLGTVVYGQEEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFAL  531 (798)
Q Consensus       454 gip~~~~--~~~~~~~l~~l~~~l~~~v~GQ~~ai~~v~~~i~~~~~gl~~~~rP~g~flf~GptGvGKTelak~la~~~  531 (798)
                       ||...+  +-++...|....+.|++.|+=+-.-.+-.+      +.+|-.  .|.|++|| ||+|+|||.+||++|...
T Consensus        82 -v~p~~I~v~f~DIggLe~v~~~L~e~VilPlr~pelF~------~g~Ll~--p~kGiLL~-GPpG~GKTmlAKA~Akea  151 (386)
T KOG0737          82 -VPPSEIGVSFDDIGGLEEVKDALQELVILPLRRPELFA------KGKLLR--PPKGILLY-GPPGTGKTMLAKAIAKEA  151 (386)
T ss_pred             -CCHHHCEEEHHHCCCHHHHHHHHHHHHHHCCCCHHHHC------CCCCCC--CCCCCEEC-CCCCCHHHHHHHHHHHHC
T ss_conf             -14223202024133528999999987752012466641------453146--86430511-899821889999999872


Q ss_pred             CCCEEEEEHHHHHCCCCCCHHCCCCCHHCCCCCCCCCCHHHH-----HCCCEEEEECCHHH-----------CCHHHHHH
Q ss_conf             773377206886124653011047800025644431003555-----15851777404455-----------02899999
Q gi|254780163|r  532 GVQLLRFDMSEYMERHAVSRLIGAPPGYVGFGQGGILADSVD-----QNPYSVVLLDEIEK-----------SHPDVLNI  595 (798)
Q Consensus       532 ~~~lir~dmsey~e~~~vs~LiGappGYvG~~egg~Lte~vr-----~~P~sVvl~DEiEK-----------Ah~~v~~~  595 (798)
                      +.++|-+.||+-++++              |+|+--|+.+|-     -+| |+|..|||+-           |-.-.-+=
T Consensus       152 ga~fInv~~s~lt~KW--------------fgE~eKlv~AvFslAsKl~P-~iIFIDEvds~L~~R~s~dHEa~a~mK~e  216 (386)
T KOG0737         152 GANFINVSVSNLTSKW--------------FGEAQKLVKAVFSLASKLQP-SIIFIDEVDSFLGQRRSTDHEATAMMKNE  216 (386)
T ss_pred             CCCCCEEECCCCCHHH--------------HHHHHHHHHHHHHHHHHCCC-CEEEHHHHHHHHHHCCCCHHHHHHHHHHH
T ss_conf             7971000136553266--------------77788899999820653486-15656658889864046427999999999


Q ss_pred             HHHHHHHHHCCCCCCCEECCCCEEEEE
Q ss_conf             999877750217799776125429999
Q gi|254780163|r  596 LLQIMDYGILTDQSGKKISFRNVILIM  622 (798)
Q Consensus       596 llqild~G~ltd~~Gr~vdf~n~iii~  622 (798)
                      |.-.. +|..|+.+-|       |+||
T Consensus       217 FM~~W-DGl~s~~~~r-------VlVl  235 (386)
T KOG0737         217 FMALW-DGLSSKDSER-------VLVL  235 (386)
T ss_pred             HHHHH-CCCCCCCCCE-------EEEE
T ss_conf             99986-1646788715-------9997


No 192
>pfam00308 Bac_DnaA Bacterial dnaA protein.
Probab=98.62  E-value=3e-06  Score=64.10  Aligned_cols=191  Identities=17%  Similarity=0.269  Sum_probs=112.6

Q ss_pred             HHHHHHHHHCC--CCCCEEEE-CCCCCHHHHHHHHHHHHHHCCCCCHHHHEEEEEEEEHHHHHCCCCCCCH-HHHHHHHH
Q ss_conf             99999986226--77874896-6764116689999999985489883452014455404675306343123-78999999
Q gi|254780163|r  213 INRTIQILCRR--SKNNPLYV-GDPGVGKTAIAEGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGD-FEERIKKI  288 (798)
Q Consensus       213 I~riiqIL~RR--~KNn~~lv-G~~gvGktaive~la~~i~~~~vp~~l~~~~i~~ld~~~l~ag~~~rg~-fe~r~~~~  288 (798)
                      .-+..+-+++.  ...||+++ |++|+|||.+.++++..+.+..     .+.++.-++...+..-  |-.- .+..+...
T Consensus        19 a~~~~~~i~~~~~~~~npl~i~G~~G~GKTHLLqA~~~~~~~~~-----~~~~v~yl~~~~~~~~--~~~~l~~~~~~~f   91 (219)
T pfam00308        19 AHAAALAVAEAPGKAYNPLFIYGGVGLGKTHLLHAIGNYALRNF-----PNLRVVYLTSEEFLND--FVDALRDNKIEAF   91 (219)
T ss_pred             HHHHHHHHHHCCCCCCCCEEEECCCCCCHHHHHHHHHHHHHHHC-----CCCEEEEEEHHHHHHH--HHHHHHCCCHHHH
T ss_conf             99999999967587678269988999988899999999999849-----9982888439999998--8999981888899


Q ss_pred             HHHHCCCCCEEEEECCHHHHHCCCCCCCCCCCHHHHHHHHHCCCCEEEEEECC-HHHHHHHHHCCHHHHHHC---EEEEE
Q ss_conf             98720389839997361663015544434477788887663026603887304-899999852011143200---14430
Q gi|254780163|r  289 VKEIESYANAILYIDEIHTLVGAGSASGISVDASNLLKPALSSGAVRCIGSTT-YSEYRQFFEKDKALVRRF---QKIDV  364 (798)
Q Consensus       289 ~~~~~~~~~~ilfideih~ligag~~~g~~~d~an~lkP~L~rg~~~~IgatT-~~ey~~~~e~d~al~rrF---~~i~v  364 (798)
                      .+.+..  --+|.||+||.+.|....+.   -.-+++--...+|.--+|.+.. |.+.. .+.+|  |..||   -.+.|
T Consensus        92 ~~~l~~--~d~l~iDDi~~l~~~~~~ee---~lf~l~N~~~~~~~~lllts~~~p~~l~-~~~~d--L~SRL~~g~~~~i  163 (219)
T pfam00308        92 KKSYRN--VDLLLIDDIQFLAGKEKTQE---EFFHTFNALHENNKQIVLTSDRPPKELE-GFEDR--LRSRFEWGLIIAI  163 (219)
T ss_pred             HHHHHH--CCHHHHCCHHHHCCCHHHHH---HHHHHHHHHHHCCCEEEEECCCCCCCCC-CCCHH--HHHHHHCCEEEEC
T ss_conf             999763--23365223676568647899---9999999999729869997799810024-53277--9999868756611


Q ss_pred             CCCCHHHHHHHHHHHHHHHHHHCCCEECCHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHH
Q ss_conf             6878689999998612766541035121117899999865420155564679889986533332
Q gi|254780163|r  365 SEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLPDKAIDVIDEAGASQI  428 (798)
Q Consensus       365 ~ep~~~~~~~iL~~~~~~ye~~h~v~~~~~al~~av~ls~ryi~~r~lPdkAidllDea~a~~~  428 (798)
                      .+|+.++-..||+.    +-...++.++++++.+.+.-..|=++      .=+..||.-++..+
T Consensus       164 ~~pdd~~~~~iL~~----~a~~r~l~l~~~v~~yl~~r~~R~~r------~L~~~L~~L~~~~~  217 (219)
T pfam00308       164 EPPDLETRLAILRK----KAEEENINIPNEVLNFIAQRITDNVR------ELEGALNRLLAFAS  217 (219)
T ss_pred             CCCCHHHHHHHHHH----HHHHCCCCCCHHHHHHHHHHCCCCHH------HHHHHHHHHHHHHC
T ss_conf             69999999999999----99984999999999999984279899------99999999998550


No 193
>PRK06872 DNA polymerase III subunits gamma and tau; Provisional
Probab=98.62  E-value=1.5e-07  Score=73.43  Aligned_cols=196  Identities=19%  Similarity=0.223  Sum_probs=123.5

Q ss_pred             HHCCCCHHHHHHHHHHHHHHHHHHCCCCCC-EEEECCCCCHHHHHHHHHHHHHHCCCC--CHH----------H--HEEE
Q ss_conf             754861122217899999999862267787-489667641166899999999854898--834----------5--2014
Q gi|254780163|r  198 VKKGKVDILVGRHEEINRTIQILCRRSKNN-PLYVGDPGVGKTAIAEGFAKQIVDGMV--PDI----------L--LGAR  262 (798)
Q Consensus       198 AreGKLDPVIGRd~EI~riiqIL~RR~KNn-~~lvG~~gvGktaive~la~~i~~~~v--p~~----------l--~~~~  262 (798)
                      -|-..++-|||-+.-++-+..-|..-+=.+ -++-|.-|||||+|+.-||.-+.-.+-  ...          -  +..-
T Consensus        10 ~rp~~f~~~vgq~~v~~~l~~a~~~~r~~haylf~g~rg~gktt~ari~ak~lnc~~~~~~~pcg~c~~c~~i~~g~~~d   89 (696)
T PRK06872         10 WRPKTFSEVVGQEHILTALSNGLKENRLHHAYLFSGTRGVGKTSIARLFAKGLNCVHGVTATPCGECENCKAIEEGNFID   89 (696)
T ss_pred             HCCCCHHHHCCCHHHHHHHHHHHHCCCCCCEEEEECCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCCHHHHHHHCCCCCC
T ss_conf             18875645238599999999999719863047511789888889999999986789999999788862257674478775


Q ss_pred             EEEEEHHHHHCCCCCCCHHHHHHHHHHHHHC---CCCC-EEEEECCHHHHHCCCCCCCCCCCHHH-HHHHHHC--CCCEE
Q ss_conf             4554046753063431237899999998720---3898-39997361663015544434477788-8876630--26603
Q gi|254780163|r  263 IFSLDMGNLIAGTRYRGDFEERIKKIVKEIE---SYAN-AILYIDEIHTLVGAGSASGISVDASN-LLKPALS--SGAVR  335 (798)
Q Consensus       263 i~~ld~~~l~ag~~~rg~fe~r~~~~~~~~~---~~~~-~ilfideih~ligag~~~g~~~d~an-~lkP~L~--rg~~~  335 (798)
                      ++++|.++-   +   |  =+.++.+++.+.   ..++ -|..|||+|+|-         -.+=| +|| -|.  -.-++
T Consensus        90 ~~eidaas~---~---~--v~~~r~l~~~~~~~p~~~~~kvy~idevhmls---------~~~fnallk-tleepp~~v~  151 (696)
T PRK06872         90 LIEIDAASR---T---K--VEDTRELLDNVQYKPVVGRFKVYLIDEVHMLS---------RHSFNALLK-TLEEPPEYVK  151 (696)
T ss_pred             EEEEECCCC---C---C--HHHHHHHHHHCCCCCCCCCEEEEEEEHHHHCC---------HHHHHHHHH-HHCCCCCCEE
T ss_conf             467505655---7---8--89999999845457767754799970054438---------999999987-5027975448


Q ss_pred             EEEECCHHHHHHHHHCCHHHHHHCEEEEECCCCHHHHHHHHHHHHHHHHHHCCCEECCHHHHHHHHHHHHHCCCCCCHHH
Q ss_conf             88730489999985201114320014430687868999999861276654103512111789999986542015556467
Q gi|254780163|r  336 CIGSTTYSEYRQFFEKDKALVRRFQKIDVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLPDK  415 (798)
Q Consensus       336 ~IgatT~~ey~~~~e~d~al~rrF~~i~v~ep~~~~~~~iL~~~~~~ye~~h~v~~~~~al~~av~ls~ryi~~r~lPdk  415 (798)
                      +|-|||.-  +|.  .-.-|.|. +....+--+.++-..-|..+-    ..-++.|.++||....+.+.--+.|      
T Consensus       152 f~latt~~--~k~--p~tilsrc-~~f~~~~~~~~~i~~~l~~i~----~~e~~~~~~~al~~~a~~a~gs~rd------  216 (696)
T PRK06872        152 FLLATTDP--QKL--PITILSRC-MQFHLKALDQTQIAQHLEFIL----TQENIPFESPALEKLAKAAQGSIRD------  216 (696)
T ss_pred             EEEECCCH--HHC--CHHHHHHH-HHEECCCCCHHHHHHHHHHHH----HHCCCCCCHHHHHHHHHHCCCCHHH------
T ss_conf             99843863--227--48898766-530026899999999999999----9849977999999999975895677------


Q ss_pred             HHHHHHHHHHH
Q ss_conf             98899865333
Q gi|254780163|r  416 AIDVIDEAGAS  426 (798)
Q Consensus       416 AidllDea~a~  426 (798)
                      |+.|+|.|-|.
T Consensus       217 alsl~dqai~~  227 (696)
T PRK06872        217 SLSLTDQAIAM  227 (696)
T ss_pred             HHHHHHHHHHH
T ss_conf             88899999997


No 194
>PRK08770 DNA polymerase III subunits gamma and tau; Validated
Probab=98.60  E-value=4.4e-05  Score=55.66  Aligned_cols=40  Identities=8%  Similarity=0.208  Sum_probs=20.6

Q ss_pred             CHHHHEEEEEEEEHHHHHCCCCCCCHHHHHHHHHHHHHCCCCCEEEEE
Q ss_conf             834520144554046753063431237899999998720389839997
Q gi|254780163|r  255 PDILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIESYANAILYI  302 (798)
Q Consensus       255 p~~l~~~~i~~ld~~~l~ag~~~rg~fe~r~~~~~~~~~~~~~~ilfi  302 (798)
                      ++.-...+||-+|=--|++...        ++.+++.++.-+.-|.||
T Consensus       114 ~p~~~~~kvy~idevhmls~~~--------fna~lktleepp~~v~f~  153 (663)
T PRK08770        114 MPSRGKFKVYLIDEVHMLSKAA--------FNALLKTLEEPPEHVKFL  153 (663)
T ss_pred             CCCCCCEEEEEEECHHHCCHHH--------HHHHHHHHCCCCCCEEEE
T ss_conf             8877743699970043328999--------999987402786442899


No 195
>KOG0732 consensus
Probab=98.60  E-value=6e-07  Score=69.07  Aligned_cols=140  Identities=27%  Similarity=0.418  Sum_probs=95.5

Q ss_pred             CEEEECCCCCHHHHHHHHHHHHHHCCCCCHHHHEEEEEEEEHHHHHCCCCCCCHHHHHHHHHHHHHCCCCCEEEEECCHH
Q ss_conf             74896676411668999999998548988345201445540467530634312378999999987203898399973616
Q gi|254780163|r  227 NPLYVGDPGVGKTAIAEGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIESYANAILYIDEIH  306 (798)
Q Consensus       227 n~~lvG~~gvGktaive~la~~i~~~~vp~~l~~~~i~~ld~~~l~ag~~~rg~fe~r~~~~~~~~~~~~~~ilfideih  306 (798)
                      -+++-|+||.|||-++-.||--...++     +..-.|.-+.+..  =.|+.||-|+-++-+.+|+++....|.|.|||.
T Consensus       301 gvL~~GppGTGkTl~araLa~~~s~~~-----~kisffmrkgaD~--lskwvgEaERqlrllFeeA~k~qPSIIffdeId  373 (1080)
T KOG0732         301 GVLFHGPPGTGKTLMARALAAACSRGN-----RKISFFMRKGADC--LSKWVGEAERQLRLLFEEAQKTQPSIIFFDEID  373 (1080)
T ss_pred             CEEECCCCCCCHHHHHHHHHHHHCCCC-----CCCCHHHHCCCHH--HCCCCCCHHHHHHHHHHHHHCCCCEEEECCCCC
T ss_conf             323028998725688886665405411-----0202443148443--325447577889988988744485177305556


Q ss_pred             HHHCCCCCCCCCCC---HHHHH--HHHH-CCCCEEEEEECCHHHHHHHHHCCHHHHH--HCEE-EEECCCCHHHHHHHHH
Q ss_conf             63015544434477---78888--7663-0266038873048999998520111432--0014-4306878689999998
Q gi|254780163|r  307 TLVGAGSASGISVD---ASNLL--KPAL-SSGAVRCIGSTTYSEYRQFFEKDKALVR--RFQK-IDVSEPSIEDAIEIVK  377 (798)
Q Consensus       307 ~ligag~~~g~~~d---~an~l--kP~L-~rg~~~~IgatT~~ey~~~~e~d~al~r--rF~~-i~v~ep~~~~~~~iL~  377 (798)
                      -+--.-++.-...-   .+++|  -+.| +||.+.+||||-...|     -|+||-|  ||.. ....=|+.+....||.
T Consensus       374 GlapvrSskqEqih~SIvSTLLaLmdGldsRgqVvvigATnRpda-----~dpaLRRPgrfdref~f~lp~~~ar~~Il~  448 (1080)
T KOG0732         374 GLAPVRSSKQEQIHASIVSTLLALMDGLDSRGQVVVIGATNRPDA-----IDPALRRPGRFDREFYFPLPDVDARAKILD  448 (1080)
T ss_pred             CCCCCCCCHHHHHHHHHHHHHHHHCCCCCCCCCEEEECCCCCCCC-----CCHHHCCCCCCCEEEEEECCCHHHHHHHHH
T ss_conf             646565366777445677778876047777786589715678332-----465442886665257503786678889998


Q ss_pred             H
Q ss_conf             6
Q gi|254780163|r  378 G  378 (798)
Q Consensus       378 ~  378 (798)
                      -
T Consensus       449 I  449 (1080)
T KOG0732         449 I  449 (1080)
T ss_pred             H
T ss_conf             7


No 196
>PRK13765 ATP-dependent protease Lon; Provisional
Probab=98.58  E-value=1.7e-05  Score=58.65  Aligned_cols=141  Identities=16%  Similarity=0.271  Sum_probs=74.2

Q ss_pred             EEEECCHHHHH-C----------------CCCCCCCCCCHHHHHHHHHCCCCEEEEEECCHHHHHHHHHCCHHHHHHC--
Q ss_conf             99973616630-1----------------5544434477788887663026603887304899999852011143200--
Q gi|254780163|r  299 ILYIDEIHTLV-G----------------AGSASGISVDASNLLKPALSSGAVRCIGSTTYSEYRQFFEKDKALVRRF--  359 (798)
Q Consensus       299 ilfideih~li-g----------------ag~~~g~~~d~an~lkP~L~rg~~~~IgatT~~ey~~~~e~d~al~rrF--  359 (798)
                      +||||||.+|= +                .|.++.++   +.+++|-=---++++|++++++-|+..   .+||..|.  
T Consensus       229 vL~IDei~~L~~~~q~~Ll~alq~~k~~I~g~~e~Ss---gA~v~tepvP~Df~lV~aGn~d~~~~m---~palrsri~g  302 (637)
T PRK13765        229 VLFIDEINTLRLESQQSLLTAMQEKKYPITGQSERSS---GAMVRTEPVPCDFIMVAAGNLDAIENM---HPALRSRIRG  302 (637)
T ss_pred             EEEEEHHHHCCHHHHHHHHHHHHCCCEECCCCCCCCC---CCCCCCCCCCEEEEEEEECCHHHHHHC---CHHHHHHHHC
T ss_conf             6998445647988999999999659153236886667---762578986613699995372766643---9988865104


Q ss_pred             --EEEEECC---CCHHHHHHHHHHHHHHHHHHCCC-EECCHHHHHHHHHHHHHCCCC-CCH---HHHHHHHHHHHHHHHH
Q ss_conf             --1443068---78689999998612766541035-121117899999865420155-564---6798899865333321
Q gi|254780163|r  360 --QKIDVSE---PSIEDAIEIVKGIKPYFEEHHQL-RYSKEAIRAAVQLSVRHFTSR-KLP---DKAIDVIDEAGASQIL  429 (798)
Q Consensus       360 --~~i~v~e---p~~~~~~~iL~~~~~~ye~~h~v-~~~~~al~~av~ls~ryi~~r-~lP---dkAidllDea~a~~~~  429 (798)
                        -.|..+.   -+.+-..++++=+....+..-++ .++.+|+...++.+.|.--++ .|-   ..-.+|+-||+..++ 
T Consensus       303 ~gyev~~~~~m~dt~enr~k~arfiaqev~~dg~iPhfdr~AVaeII~eA~R~AG~k~kLTLrLReL~~LIReAgdiA~-  381 (637)
T PRK13765        303 YGYEVYMNDTMEDTPENRKKLVRFVAQEVKRDGKIPHFDREAVEEIIREARRRAGRKGHLTLKLRDLGGLVRVAGDIAR-  381 (637)
T ss_pred             CCEEEEECCCCCCCHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHHHHHHHH-
T ss_conf             7749982356778788999999999999974388899998999999999997405456630528988749999889999-


Q ss_pred             HHHHHHHCCCCHHHHHHHHH
Q ss_conf             14432211365789998663
Q gi|254780163|r  430 QPLSKRRKFITEKDIKKTIA  449 (798)
Q Consensus       430 ~~~~~~~~~~~~~~i~~~~~  449 (798)
                         .+.+..|+.+||.+...
T Consensus       382 ---~eg~~~Vta~hV~~A~~  398 (637)
T PRK13765        382 ---SEGADLVTAEHVLEAKK  398 (637)
T ss_pred             ---HCCCCCCCHHHHHHHHH
T ss_conf             ---75999664999999999


No 197
>KOG0729 consensus
Probab=98.58  E-value=8.4e-07  Score=68.04  Aligned_cols=133  Identities=25%  Similarity=0.416  Sum_probs=62.4

Q ss_pred             CEEEECCCCCHHHHHHHHHHHHHHCCCCCHHHHEEEEEEEEHHHHHCCCCCCCHHHHHHHHHHHHHCCCCCEEEEECCHH
Q ss_conf             74896676411668999999998548988345201445540467530634312378999999987203898399973616
Q gi|254780163|r  227 NPLYVGDPGVGKTAIAEGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIESYANAILYIDEIH  306 (798)
Q Consensus       227 n~~lvG~~gvGktaive~la~~i~~~~vp~~l~~~~i~~ld~~~l~ag~~~rg~fe~r~~~~~~~~~~~~~~ilfideih  306 (798)
                      .++|-|+||.|||-.+..+|.|-          +..++.+=.+.|+  .||.||=-.-++.++.-++..+..|+|+|||.
T Consensus       213 GvllyGPPGtGKTL~ARAVANRT----------dAcFIRViGSELV--QKYvGEGARMVRElFeMAr~KKACiiFFDEiD  280 (435)
T KOG0729         213 GVLLYGPPGTGKTLCARAVANRT----------DACFIRVIGSELV--QKYVGEGARMVRELFEMARTKKACIIFFDEID  280 (435)
T ss_pred             CEEEECCCCCCHHHHHHHHHCCC----------CCEEEEEHHHHHH--HHHHHHHHHHHHHHHHHHCCCCEEEEEEECCC
T ss_conf             33786899986108999874566----------7458763118999--99862468999999998523652799841010


Q ss_pred             HHHCCCCCCCCC---------CCHHHHHHHHHCCCCEEEEEECCHHHHHHHHHCCHHHHH--HC-EEEEECCCCHHHHHH
Q ss_conf             630155444344---------777888876630266038873048999998520111432--00-144306878689999
Q gi|254780163|r  307 TLVGAGSASGIS---------VDASNLLKPALSSGAVRCIGSTTYSEYRQFFEKDKALVR--RF-QKIDVSEPSIEDAIE  374 (798)
Q Consensus       307 ~ligag~~~g~~---------~d~an~lkP~L~rg~~~~IgatT~~ey~~~~e~d~al~r--rF-~~i~v~ep~~~~~~~  374 (798)
                      .+=||---.|..         +..-|-|--.=.||.|++.-||.--.     --|+||.|  |. .+|...=|+.+--..
T Consensus       281 AiGGaRFDDg~ggDNEVQRTMLEli~QLDGFDpRGNIKVlmATNRPd-----tLDpALlRPGRlDRKVEF~LPDlegR~~  355 (435)
T KOG0729         281 AIGGARFDDGAGGDNEVQRTMLELINQLDGFDPRGNIKVLMATNRPD-----TLDPALLRPGRLDRKVEFGLPDLEGRTH  355 (435)
T ss_pred             CCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCCCCCCEEEEEECCCCC-----CCCHHHCCCCCCCCCEECCCCCCCCCCE
T ss_conf             22672035788872799999999998603778888758986348988-----7687662876423112105876235512


Q ss_pred             HH
Q ss_conf             99
Q gi|254780163|r  375 IV  376 (798)
Q Consensus       375 iL  376 (798)
                      |+
T Consensus       356 I~  357 (435)
T KOG0729         356 IF  357 (435)
T ss_pred             EE
T ss_conf             57


No 198
>KOG0738 consensus
Probab=98.58  E-value=6.2e-07  Score=68.97  Aligned_cols=108  Identities=27%  Similarity=0.385  Sum_probs=72.5

Q ss_pred             HHCHHHHHHHHHHHHHH------HHCCCCCCCCCCCEEEEECCCCHHHHHHHHHHHHHCCCCEEEEEHHHHHCCCCCCHH
Q ss_conf             53458999999999877------520445657874068861432003889999987304773377206886124653011
Q gi|254780163|r  479 VYGQEEAIKKLSSSIKI------ARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFALGVQLLRFDMSEYMERHAVSRL  552 (798)
Q Consensus       479 v~GQ~~ai~~v~~~i~~------~~~gl~~~~rP~g~flf~GptGvGKTelak~la~~~~~~lir~dmsey~e~~~vs~L  552 (798)
                      |.|-.+|..-+-+|+..      ...|+..   |--..|++||+|+|||.|||++|-..+.-|..+--|..     +|| 
T Consensus       214 Iagl~~AK~lL~EAVvlPi~mPe~F~Girr---PWkgvLm~GPPGTGKTlLAKAvATEc~tTFFNVSsstl-----tSK-  284 (491)
T KOG0738         214 IAGLHEAKKLLKEAVVLPIWMPEFFKGIRR---PWKGVLMVGPPGTGKTLLAKAVATECGTTFFNVSSSTL-----TSK-  284 (491)
T ss_pred             HCCHHHHHHHHHHHHHHHHHHHHHHHHCCC---CCCEEEEECCCCCCHHHHHHHHHHHHCCEEEEECHHHH-----HHH-
T ss_conf             316499999999887544424888742446---53000556799974789999998861672787402456-----555-


Q ss_pred             CCCCCHHCCCCCC--CCCCHHHHHCCCEEEEECCHHH------------CCHHHHHHHHHHHH
Q ss_conf             0478000256444--3100355515851777404455------------02899999999877
Q gi|254780163|r  553 IGAPPGYVGFGQG--GILADSVDQNPYSVVLLDEIEK------------SHPDVLNILLQIMD  601 (798)
Q Consensus       553 iGappGYvG~~eg--g~Lte~vr~~P~sVvl~DEiEK------------Ah~~v~~~llqild  601 (798)
                            |-|-.|-  -+|.|--|..--|+|++|||+-            |...|-+=||+-||
T Consensus       285 ------wRGeSEKlvRlLFemARfyAPStIFiDEIDslcs~RG~s~EHEaSRRvKsELLvQmD  341 (491)
T KOG0738         285 ------WRGESEKLVRLLFEMARFYAPSTIFIDEIDSLCSQRGGSSEHEASRRVKSELLVQMD  341 (491)
T ss_pred             ------HCCCHHHHHHHHHHHHHHHCCCEEEHHHHHHHHHCCCCCCCHHHHHHHHHHHHHHHH
T ss_conf             ------325269999999999987488535335677887257986503678888889999863


No 199
>PRK07994 DNA polymerase III subunits gamma and tau; Validated
Probab=98.58  E-value=6.8e-05  Score=54.32  Aligned_cols=40  Identities=8%  Similarity=0.227  Sum_probs=23.9

Q ss_pred             CHHHHEEEEEEEEHHHHHCCCCCCCHHHHHHHHHHHHHCCCCCEEEEE
Q ss_conf             834520144554046753063431237899999998720389839997
Q gi|254780163|r  255 PDILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIESYANAILYI  302 (798)
Q Consensus       255 p~~l~~~~i~~ld~~~l~ag~~~rg~fe~r~~~~~~~~~~~~~~ilfi  302 (798)
                      .+.-..++||-+|=--|++...        +..+++.++..+.-+.||
T Consensus       114 ~p~~~r~kvyiidEvhmls~~a--------fnalLKtlEePp~hv~fi  153 (643)
T PRK07994        114 APARGRFKVYLIDEVHMLSRHS--------FNALLKTLEEPPAHVKFL  153 (643)
T ss_pred             CCCCCCEEEEEEECHHHCCHHH--------HHHHHHHHCCCCHHCEEE
T ss_conf             8877853699972210158999--------999998623786100899


No 200
>pfam05673 DUF815 Protein of unknown function (DUF815). This family consists of several bacterial proteins of unknown function.
Probab=98.57  E-value=1.7e-05  Score=58.66  Aligned_cols=159  Identities=23%  Similarity=0.352  Sum_probs=74.0

Q ss_pred             HHHHHHHHHHHHHH----HHHCCCCCCEEEECCCCCHHHHHHHHHHHHHHCCCCCHHHHEEEEEEEEHHHHHCCCCCCCH
Q ss_conf             22217899999999----86226778748966764116689999999985489883452014455404675306343123
Q gi|254780163|r  205 ILVGRHEEINRTIQ----ILCRRSKNNPLYVGDPGVGKTAIAEGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGD  280 (798)
Q Consensus       205 PVIGRd~EI~riiq----IL~RR~KNn~~lvG~~gvGktaive~la~~i~~~~vp~~l~~~~i~~ld~~~l~ag~~~rg~  280 (798)
                      -++|=|.+.+.+++    -+....-||++|-|+.|.||+++|.++......       ++.|+++++-..|         
T Consensus        29 ~L~Gie~Qk~~l~~NT~~F~~G~pAnnvLLwG~RGtGKSSlVKall~~~~~-------~gLrlIEv~k~~L---------   92 (248)
T pfam05673        29 DLVGIDRQKEALLRNTEQFLAGLPANNVLLWGARGTGKSSLVKALLNEYAD-------QGLRLIEVDKDDL---------   92 (248)
T ss_pred             HHCCHHHHHHHHHHHHHHHHCCCCCCCEEEECCCCCCHHHHHHHHHHHHHH-------CCCEEEEECHHHH---------
T ss_conf             934939999999999999980898613676768989888999999998631-------4956999878887---------


Q ss_pred             HHHHHHHHHHHHCCCC-CEEEEECCHHHHHCCCCCCCCCCCHHHHHHHHHCCCC-----EEEEEECCHH-----HH-H--
Q ss_conf             7899999998720389-8399973616630155444344777888876630266-----0388730489-----99-9--
Q gi|254780163|r  281 FEERIKKIVKEIESYA-NAILYIDEIHTLVGAGSASGISVDASNLLKPALSSGA-----VRCIGSTTYS-----EY-R--  346 (798)
Q Consensus       281 fe~r~~~~~~~~~~~~-~~ilfideih~ligag~~~g~~~d~an~lkP~L~rg~-----~~~IgatT~~-----ey-~--  346 (798)
                        .-|-.|++.++..+ +-|||||++-       =+.+ -+--..||..|.-|-     =-+|-||+.-     |+ .  
T Consensus        93 --~~Lp~i~~~l~~~~~kFIiF~DDLS-------Fe~~-d~~yk~LKs~LeG~l~~~p~NvliYaTSNRRHLi~e~~~d~  162 (248)
T pfam05673        93 --GDLPDIVDLLRGRPYRFILFCDDLS-------FEEG-ESSYKALKSVLEGGLEARPDNVLIYATSNRRHLIPEYMSDN  162 (248)
T ss_pred             --CCHHHHHHHHHCCCCCEEEEECCCC-------CCCC-CHHHHHHHHHHCCCCCCCCCEEEEEEECCCHHCCCHHHCCC
T ss_conf             --2199999999649975799963557-------6789-73699999996576446887389998427000363332347


Q ss_pred             ---------HHHHCCHHHHHHCE-EEEECCCCHHHHHHHHHHHHHHHHHHCCCEECC
Q ss_conf             ---------98520111432001-443068786899999986127665410351211
Q gi|254780163|r  347 ---------QFFEKDKALVRRFQ-KIDVSEPSIEDAIEIVKGIKPYFEEHHQLRYSK  393 (798)
Q Consensus       347 ---------~~~e~d~al~rrF~-~i~v~ep~~~~~~~iL~~~~~~ye~~h~v~~~~  393 (798)
                               ..+|---+|..||- .|.-.+|+.++=+.|.+.    |-+++++.+..
T Consensus       163 ~~~~ei~~~d~~eEklSLsDRFGL~l~F~~~~q~~YL~IV~~----~~~~~~~~~~~  215 (248)
T pfam05673       163 EGDGEIHPGDAVEEKLSLSDRFGLWLGFHPFDQDEYLAIVRG----YAARLGLPLDE  215 (248)
T ss_pred             CCCCCCCCCHHHHHHHHHHHHCCEEEEECCCCHHHHHHHHHH----HHHHCCCCCCH
T ss_conf             774436725577745348986771785079999999999999----99982999998


No 201
>PRK08903 hypothetical protein; Validated
Probab=98.56  E-value=5.3e-06  Score=62.28  Aligned_cols=45  Identities=22%  Similarity=0.182  Sum_probs=21.3

Q ss_pred             HHHHCE---EEEECCCCHHHHHHHHHHHHHHHHHHCCCEECCHHHHHHHHHH
Q ss_conf             432001---4430687868999999861276654103512111789999986
Q gi|254780163|r  355 LVRRFQ---KIDVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLS  403 (798)
Q Consensus       355 l~rrF~---~i~v~ep~~~~~~~iL~~~~~~ye~~h~v~~~~~al~~av~ls  403 (798)
                      |..||.   .+.+.+|+.+.-..||+..    -...|+.++++++.+.+.-.
T Consensus       142 L~SRl~~gl~~~i~~pdde~~~~iL~~~----a~~rgl~l~~~v~~yl~~r~  189 (227)
T PRK08903        142 LRTRLGWGLVYEVKPLSDEDKIAALKAA----AAERGLQLADEVPDYLLTHF  189 (227)
T ss_pred             HHHHHHCCCEEEEECCCHHHHHHHHHHH----HHHCCCCCCHHHHHHHHHHH
T ss_conf             9999938973899797999999999999----99629999889999999983


No 202
>PRK08116 hypothetical protein; Validated
Probab=98.56  E-value=1.5e-06  Score=66.27  Aligned_cols=165  Identities=21%  Similarity=0.288  Sum_probs=94.8

Q ss_pred             CHHHHHHHHHHHHHHHHCCCCCCCCCCCEEEEECCCCHHHHHHHHHHHHHC---CCCEEEEEHHHHHCCCCCCHHCCCCC
Q ss_conf             458999999999877520445657874068861432003889999987304---77337720688612465301104780
Q gi|254780163|r  481 GQEEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFAL---GVQLLRFDMSEYMERHAVSRLIGAPP  557 (798)
Q Consensus       481 GQ~~ai~~v~~~i~~~~~gl~~~~rP~g~flf~GptGvGKTelak~la~~~---~~~lir~dmsey~e~~~vs~LiGapp  557 (798)
                      ||..|.....+-+.... -...  .+. .++|.||+|+|||.||-++|..+   +...+-++.+++.+.-..+       
T Consensus        86 ~~~~a~~~a~~Y~~~f~-~~~~--~~~-GLll~G~~GtGKThLa~aIa~~l~~~g~~V~~~~~~~ll~~lk~~-------  154 (262)
T PRK08116         86 GSEKAYKVAVKYVKKFE-EMKK--ESV-GLLLWGSPGNGKTYLAAAIANELIEKGVPVVFVNVPELLNRIKST-------  154 (262)
T ss_pred             CHHHHHHHHHHHHHHHH-HHCC--CCC-EEEEECCCCCCHHHHHHHHHHHHHHCCCEEEEEEHHHHHHHHHHH-------
T ss_conf             25999999999999898-7364--686-189989899989999999999999879939998899999999999-------


Q ss_pred             HHCCCCCCC-----CCCHHHHHCCCEEEEECCH--HHCCHHHHHHHHHHHHHHHCCCCCCCEECCCCEEEEEECCCCHHH
Q ss_conf             002564443-----1003555158517774044--550289999999987775021779977612542999942421455
Q gi|254780163|r  558 GYVGFGQGG-----ILADSVDQNPYSVVLLDEI--EKSHPDVLNILLQIMDYGILTDQSGKKISFRNVILIMTTNAGALE  630 (798)
Q Consensus       558 GYvG~~egg-----~Lte~vr~~P~sVvl~DEi--EKAh~~v~~~llqild~G~ltd~~Gr~vdf~n~iii~TsN~G~~~  630 (798)
                          |..++     .+.+.+.  -.-|+++|++  |+..+-+.+.|++|++. |...+.         -+|.|||+.-++
T Consensus       155 ----~~~~~~~~~~e~l~~l~--~~dLLIiDDlG~e~~t~w~~e~lf~IIn~-Ry~~~k---------ptIiTTNl~~~e  218 (262)
T PRK08116        155 ----YNSEGKEDENEIIRALD--NADLLILDDLGAEKDTEWVREKLYNIIDS-RYRKGL---------PTIFTTNLSLEE  218 (262)
T ss_pred             ----HHCCCCHHHHHHHHHHH--CCCEEEEEHHCCCCCCHHHHHHHHHHHHH-HHHCCC---------CEEEECCCCHHH
T ss_conf             ----86356101999999861--29989983221456987899999999999-997699---------989987999999


Q ss_pred             HHHCCCCCCCCCCHHHHHHHHHHHCCHHHHCCCCEEEECCCCCHHHHHH-HHHHHHHHHHHHH
Q ss_conf             3303689882111488999998728878817768289628899999999-9999999999999
Q gi|254780163|r  631 MSKARIGFGSSRNDDADKEALRNFLSPEFLNRLDSIIPFFPLSSDIIRQ-VVHKFIMKLELQL  692 (798)
Q Consensus       631 ~~~~~~g~~~~~~~~~~~~~l~~~f~peflnRid~ii~F~~l~~~~~~~-i~~~~l~~l~~~l  692 (798)
                      +.+                    .|.+-.+.||-+....-.++.++.++ ++...+..+.+.|
T Consensus       219 L~~--------------------~~~~Ri~sRl~e~~~~v~~~G~d~R~~~a~~k~~~~~~~l  261 (262)
T PRK08116        219 LKN--------------------QYGKRTYSRILEMCTPVKNEGKSYRREIAKEKLERLKELL  261 (262)
T ss_pred             HHH--------------------HHHHHHHHHHHHCCEEEEEECCCHHHHHHHHHHHHHHHHH
T ss_conf             999--------------------8637999999867789985177887999999999999860


No 203
>PRK12323 DNA polymerase III subunits gamma and tau; Provisional
Probab=98.56  E-value=6.2e-05  Score=54.61  Aligned_cols=36  Identities=11%  Similarity=0.297  Sum_probs=16.0

Q ss_pred             HEEEEEEEEHHHHHCCCCCCCHHHHHHHHHHHHHCCCCCEEEEE
Q ss_conf             20144554046753063431237899999998720389839997
Q gi|254780163|r  259 LGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIESYANAILYI  302 (798)
Q Consensus       259 ~~~~i~~ld~~~l~ag~~~rg~fe~r~~~~~~~~~~~~~~ilfi  302 (798)
                      ..++||-+|=--|++...        +..+++.++.-+.-+.||
T Consensus       123 ~~~KvyiiDevhmls~~a--------fnalLKtlEePP~hv~Fi  158 (721)
T PRK12323        123 GRFKVYMIDEVHMLTNHA--------FNAMLKTLEEPPPHVKFI  158 (721)
T ss_pred             CCEEEEEEECCCCCCHHH--------HHHHHHHHCCCCCCEEEE
T ss_conf             644699985400058999--------999998401797553899


No 204
>PRK05642 DNA replication initiation factor; Validated
Probab=98.55  E-value=1.3e-05  Score=59.50  Aligned_cols=151  Identities=17%  Similarity=0.248  Sum_probs=68.0

Q ss_pred             CCEE-EECCCCCHHHHHHHHHHHHHHCCCCCHHHHEEEEEEEEHHHHHCCCCCCCHHHHHHHHHHHHHCCCCCEEEEECC
Q ss_conf             8748-966764116689999999985489883452014455404675306343123789999999872038983999736
Q gi|254780163|r  226 NNPL-YVGDPGVGKTAIAEGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIESYANAILYIDE  304 (798)
Q Consensus       226 Nn~~-lvG~~gvGktaive~la~~i~~~~vp~~l~~~~i~~ld~~~l~ag~~~rg~fe~r~~~~~~~~~~~~~~ilfide  304 (798)
                      +||+ |.|++|.|||.+.+..+..+.+.       +.+++.+++..+..          ..-.+++.++.. + ++.||+
T Consensus        45 ~~~l~i~G~~G~GKTHLL~A~~~~~~~~-------~~~~~yl~~~~~~~----------~~~~~~~~l~~~-d-~l~IDD  105 (234)
T PRK05642         45 ESLIYLWGKDGVGRSHLLQAACLRFEQR-------GEPAVYLPLAELLD----------RGPELLDNLEQY-E-LVCIDD  105 (234)
T ss_pred             CCEEEEECCCCCCHHHHHHHHHHHHHHC-------CCCEEEEEHHHHHH----------HHHHHHHHHHHC-C-EEEEEC
T ss_conf             8838998899998899999999999807-------99679978999875----------449998624227-9-898936


Q ss_pred             HHHHHCCCCCCCCCCCHHHHHHHHHCCCCEEEEEECC-HHHHHHHHHCCHHHHHHCE---EEEECCCCHHHHHHHHHHHH
Q ss_conf             1663015544434477788887663026603887304-8999998520111432001---44306878689999998612
Q gi|254780163|r  305 IHTLVGAGSASGISVDASNLLKPALSSGAVRCIGSTT-YSEYRQFFEKDKALVRRFQ---KIDVSEPSIEDAIEIVKGIK  380 (798)
Q Consensus       305 ih~ligag~~~g~~~d~an~lkP~L~rg~~~~IgatT-~~ey~~~~e~d~al~rrF~---~i~v~ep~~~~~~~iL~~~~  380 (798)
                      ||.|.|-...+.   -.-+++--...+|.-=++.++. |.+.. ...+  -|..||+   .+++.+|+.++-+.||+...
T Consensus       106 i~~i~g~~~~e~---~lF~l~N~~~~~~~~llits~~~P~~l~-~~l~--DL~SRl~~~~~~~i~~l~d~~~~~iL~~~a  179 (234)
T PRK05642        106 LDVIAGKADWEE---ALFHLFNRLRDSGRRLLLAASKSPRELP-VKLP--DLKSRLTLALVFQMRGLSDEDKLRALQLRA  179 (234)
T ss_pred             HHHHCCCHHHHH---HHHHHHHHHHHCCCEEEEECCCCHHHHC-CCHH--HHHHHHHCCCEEEECCCCHHHHHHHHHHHH
T ss_conf             455468859999---9999999999839959995787955523-0016--799999578127514899899999999997


Q ss_pred             HHHHHHCCCEECCHHHHHHHHHHHH
Q ss_conf             7665410351211178999998654
Q gi|254780163|r  381 PYFEEHHQLRYSKEAIRAAVQLSVR  405 (798)
Q Consensus       381 ~~ye~~h~v~~~~~al~~av~ls~r  405 (798)
                          ...|+.++++++.+.++-..|
T Consensus       180 ----~~rgi~l~~~v~~yl~~r~~R  200 (234)
T PRK05642        180 ----SRRGLHLTDEVGHFILTRGTR  200 (234)
T ss_pred             ----HHCCCCCCHHHHHHHHHHCCC
T ss_conf             ----754689998999999997358


No 205
>PRK13765 ATP-dependent protease Lon; Provisional
Probab=98.55  E-value=2.7e-06  Score=64.33  Aligned_cols=49  Identities=22%  Similarity=0.457  Sum_probs=39.7

Q ss_pred             CCCCHHHHHHHHHHHHHHHHHHCCCCCCEEEECCCCCHHHHHHHHHHHHHH
Q ss_conf             486112221789999999986226778748966764116689999999985
Q gi|254780163|r  200 KGKVDILVGRHEEINRTIQILCRRSKNNPLYVGDPGVGKTAIAEGFAKQIV  250 (798)
Q Consensus       200 eGKLDPVIGRd~EI~riiqIL~RR~KNn~~lvG~~gvGktaive~la~~i~  250 (798)
                      ..-+|-|||-|+-++-+.-..--|+  |.+|||+||+||+-++..+++.+-
T Consensus        27 ~~lidqVIGQe~Av~~i~~Aa~qrr--hvlliG~PGtGKSmlakam~elLp   75 (637)
T PRK13765         27 KLLIDQVIGQEHAVEVIKKAAKQRR--HVMLIGSPGTGKSMLAKAMAELLP   75 (637)
T ss_pred             CCCCCCCCCHHHHHHHHHHHHHHHC--CEEEECCCCCCHHHHHHHHHHHCC
T ss_conf             8523324571999999999998437--389868999879999999997579


No 206
>PRK05564 DNA polymerase III subunit delta'; Validated
Probab=98.55  E-value=1.3e-05  Score=59.46  Aligned_cols=184  Identities=19%  Similarity=0.257  Sum_probs=120.7

Q ss_pred             CHHHHHHHHHHHHHHHHHHCCCCCC-EEEECCCCCHHHHHHHHHHHHHHCCCCCHHHHEEEEEEEEHHHHHCCCCCCCHH
Q ss_conf             1122217899999999862267787-489667641166899999999854898834520144554046753063431237
Q gi|254780163|r  203 VDILVGRHEEINRTIQILCRRSKNN-PLYVGDPGVGKTAIAEGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGDF  281 (798)
Q Consensus       203 LDPVIGRd~EI~riiqIL~RR~KNn-~~lvG~~gvGktaive~la~~i~~~~vp~~l~~~~i~~ld~~~l~ag~~~rg~f  281 (798)
                      ++-|||-+.-++++..-+...+=.+ -++.|++|||||+.+..+|+.+....-...-  .-++.++..   .+... |  
T Consensus         3 f~~iiGq~~i~~~L~~~i~~~rl~HAyLF~Gp~G~GK~~~A~~~A~~ll~~~~~~~~--~D~~~~~~~---~~~~I-~--   74 (313)
T PRK05564          3 FRTIIGHENIKNRIDNSIIKGKFSHASLIVGEDGIGKSILAKEIANKILGKSEQREY--VDIIEYKPI---NKKSI-G--   74 (313)
T ss_pred             HHHCCCHHHHHHHHHHHHHCCCCCCEEEEECCCCCCHHHHHHHHHHHHHCCCCCCCC--CCEEEEECC---CCCCC-C--
T ss_conf             323268299999999999879987504327999850999999999998289977889--865886332---25699-9--


Q ss_pred             HHHHHHHHHHHCC----CCCEEEEECCHHHHHCCCCCCCCCCCHHHHHHHHHC--CCCEEEEEECCHHHHHHHHHCCHHH
Q ss_conf             8999999987203----898399973616630155444344777888876630--2660388730489999985201114
Q gi|254780163|r  282 EERIKKIVKEIES----YANAILYIDEIHTLVGAGSASGISVDASNLLKPALS--SGAVRCIGSTTYSEYRQFFEKDKAL  355 (798)
Q Consensus       282 e~r~~~~~~~~~~----~~~~ilfideih~ligag~~~g~~~d~an~lkP~L~--rg~~~~IgatT~~ey~~~~e~d~al  355 (798)
                      =+.++.+++.+..    .+.-|.+||+.|++         +..|+|-|-=.|.  -+..-+|=+||..+  +.   =+-.
T Consensus        75 vd~IR~l~~~~~~~p~~g~~KV~II~~ae~m---------~~~AaNALLKtLEEPP~~t~fIL~t~~~~--~l---LpTI  140 (313)
T PRK05564         75 VDDIRNIIEEVNKKPYEGDKKVIIIYKSEKM---------TEQAQNAFLKTIEEPPKGVFIILLCENLE--QI---LDTI  140 (313)
T ss_pred             HHHHHHHHHHHHHCCCCCCCEEEEECCHHHH---------CHHHHHHHHHCCCCCCCCEEEEEEECCHH--HC---CCHH
T ss_conf             8999999999840862589569998077775---------89999998455036899858998649835--47---5778


Q ss_pred             HHHCEEEEECCCCHHHHHHHHHHHHHHHHHHCCCEECCHHHHHHHHHHHHHCCCCCCHHHHHHHHHH
Q ss_conf             3200144306878689999998612766541035121117899999865420155564679889986
Q gi|254780163|r  356 VRRFQKIDVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLPDKAIDVIDE  422 (798)
Q Consensus       356 ~rrF~~i~v~ep~~~~~~~iL~~~~~~ye~~h~v~~~~~al~~av~ls~ryi~~r~lPdkAidllDe  422 (798)
                      -.|-|.+.+..++.++....|..      .+++  .+.+....++.+|.      -.|++|.+++..
T Consensus       141 ~SRCQ~~~f~~l~~~~i~~~L~~------~~~~--~~~~~~~~~~~~s~------G~~~~a~~~~~~  193 (313)
T PRK05564        141 KSRCQIYKLNRLSKEDIEKFISY------KYND--IDEENKNSAIAFSD------GIPGKVEKFIED  193 (313)
T ss_pred             HCCCEEEECCCCCHHHHHHHHHH------HCCC--CCHHHHHHHHHHCC------CCHHHHHHHHHH
T ss_conf             70653566899899999999998------6258--99999999999829------987999998405


No 207
>COG1241 MCM2 Predicted ATPase involved in replication control, Cdc46/Mcm family [DNA replication, recombination, and repair]
Probab=98.54  E-value=1e-05  Score=60.16  Aligned_cols=255  Identities=20%  Similarity=0.214  Sum_probs=150.6

Q ss_pred             HHHHCCHHHHHHHCHHHHHHHHHHHHHHHHCCCCCCCCCCC-------EEEEECCCCHHHHHHHHHHHHHCCCCEEEEEH
Q ss_conf             42100002466534589999999998775204456578740-------68861432003889999987304773377206
Q gi|254780163|r  468 LSNLEKNLGTVVYGQEEAIKKLSSSIKIARAGLSDPNKPIG-------CYVFSGPTGVGKTEISKQLAFALGVQLLRFDM  540 (798)
Q Consensus       468 l~~l~~~l~~~v~GQ~~ai~~v~~~i~~~~~gl~~~~rP~g-------~flf~GptGvGKTelak~la~~~~~~lir~dm  540 (798)
                      ...|-+.+.-.|+|.+..-++++-.+.    |=....-|-|       ..|++|-+|+||+.|-|.++.....+.-.-  
T Consensus       277 ~~~l~~SiaPsIyG~e~VKkAilLqLf----gGv~k~~~~g~~iRGDInILLvGDPgtaKSqlLk~v~~~aPr~vyts--  350 (682)
T COG1241         277 YDILIKSIAPSIYGHEDVKKAILLQLF----GGVKKNLPDGTRIRGDIHILLVGDPGTAKSQLLKYVAKLAPRGVYTS--  350 (682)
T ss_pred             HHHHHHHHCCCCCCCHHHHHHHHHHHC----CCCCCCCCCCCCCCCCEEEEECCCCCHHHHHHHHHHHHHCCCEEEEC--
T ss_conf             999999741510381999999999960----89766479986202422699817982519999999886488407972--


Q ss_pred             HHHHCCCCCCHHCCC---CCHHCC--CCCCCCCCHHHHHCCCEEEEECCHHHCCHHHHHHHHHHHHHHHCCCCCCCEECC
Q ss_conf             886124653011047---800025--644431003555158517774044550289999999987775021779977612
Q gi|254780163|r  541 SEYMERHAVSRLIGA---PPGYVG--FGQGGILADSVDQNPYSVVLLDEIEKSHPDVLNILLQIMDYGILTDQSGKKISF  615 (798)
Q Consensus       541 sey~e~~~vs~LiGa---ppGYvG--~~egg~Lte~vr~~P~sVvl~DEiEKAh~~v~~~llqild~G~ltd~~Gr~vdf  615 (798)
                         -...|...|..|   -|. .|  +=|+|-|.-|=    .+|+..||++|..-.-.+.+...|+..+++=+       
T Consensus       351 ---gkgss~~GLTAav~rd~~-tge~~LeaGALVlAD----~Gv~cIDEfdKm~~~dr~aihEaMEQQtIsIa-------  415 (682)
T COG1241         351 ---GKGSSAAGLTAAVVRDKV-TGEWVLEAGALVLAD----GGVCCIDEFDKMNEEDRVAIHEAMEQQTISIA-------  415 (682)
T ss_pred             ---CCCCCCCCCEEEEEECCC-CCEEEEECCEEEEEC----CCEEEEEECCCCCHHHHHHHHHHHHHCEEEEC-------
T ss_conf             ---641254573069997067-760788677799924----97799970567776789999999875275120-------


Q ss_pred             CCEEEEEECCCCHHHHHHCCCCCCCCCCHHHHHHHHHHHCCHHHHCCCCEEEECC-CCCHH----HHHHHHHHHH-----
Q ss_conf             5429999424214553303689882111488999998728878817768289628-89999----9999999999-----
Q gi|254780163|r  616 RNVILIMTTNAGALEMSKARIGFGSSRNDDADKEALRNFLSPEFLNRLDSIIPFF-PLSSD----IIRQVVHKFI-----  685 (798)
Q Consensus       616 ~n~iii~TsN~G~~~~~~~~~g~~~~~~~~~~~~~l~~~f~peflnRid~ii~F~-~l~~~----~~~~i~~~~l-----  685 (798)
                       ..=|+-|=|+-+..++..+..|+.-.......+-  -.|+|.||.|+|-|++.. ..+++    -...|++...     
T Consensus       416 -KAGI~atLnARcsvLAAaNP~~Gryd~~~~~~en--I~l~~~lLSRFDLifvl~D~~d~~~D~~ia~hil~~h~~~~~~  492 (682)
T COG1241         416 -KAGITATLNARCSVLAAANPKFGRYDPKKTVAEN--INLPAPLLSRFDLIFVLKDDPDEEKDEEIAEHILDKHRGEEPE  492 (682)
T ss_pred             -CCCEEEECCHHHHHHHHHCCCCCCCCCCCCHHHH--CCCCHHHHHHCCEEEEECCCCCCCCHHHHHHHHHHHHHCCCCC
T ss_conf             -5542541114444566518877767999997885--5898357751775477057888533599999999986345653


Q ss_pred             ---------------HHHHH---HHHHCCCEEEECHHHHHHHHHCCCCCC-------------CCCHHHHHHHHHHHHHH
Q ss_conf             ---------------99999---998669889998899999997189810-------------15326799999862359
Q gi|254780163|r  686 ---------------MKLEL---QLQEKGISFHFSEEVINWLVSHGYDVK-------------MGARPLERIIKEHVKVP  734 (798)
Q Consensus       686 ---------------~~l~~---~l~~~~i~l~~~~~~~~~l~~~~~~~~-------------~GAR~l~r~i~~~i~~~  734 (798)
                                     -++.+   ..+++.+.-.+++++.+.|.+.--+..             .-+|.|..+|+  +...
T Consensus       493 ~~~~~~~~~~~~~~~~~~lrkYI~YAR~~v~P~lt~ea~e~l~~~Yv~~Rk~~~~~~~~~~~piT~RqLEsiiR--LaeA  570 (682)
T COG1241         493 ETISLDGVDEVEERDFELLRKYISYARKNVTPVLTEEAREELEDYYVEMRKKSALVEEKRTIPITARQLESIIR--LAEA  570 (682)
T ss_pred             CCCCCCCCCCCCCCCHHHHHHHHHHHHCCCCCCCCHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCHHHHHHHHH--HHHH
T ss_conf             22333322222346589999999987505896128999999999998765201223456754561999999999--9999


Q ss_pred             HHHHHHCCCCCCCC
Q ss_conf             99999629676888
Q gi|254780163|r  735 LADEILFGKLKKGG  748 (798)
Q Consensus       735 la~~il~~~~~~g~  748 (798)
                      +|.+=|+..+.+.+
T Consensus       571 ~Ak~rLS~~V~~eD  584 (682)
T COG1241         571 HAKMRLSDVVEEED  584 (682)
T ss_pred             HHHHHCCCCCCHHH
T ss_conf             88654447778899


No 208
>TIGR02397 dnaX_nterm DNA polymerase III, subunits gamma and tau; InterPro: IPR012763    This entry represents the well-conserved first N-terminal domain of DnaX, approx. 365 aa. The full-length product of the dnaX gene in Escherichia coli encodes the DNA polymerase III tau subunit. A translational frameshift leads to early termination and a truncated protein subunit gamma, about 1/3 shorter than tau and present in roughly equal amounts. This frameshift mechanism is not necessarily universal for species with DNA polymerase III but appears conserved in the extreme thermophile Thermus thermophilis.; GO: 0003887 DNA-directed DNA polymerase activity, 0005524 ATP binding, 0006260 DNA replication, 0009360 DNA polymerase III complex.
Probab=98.53  E-value=1.3e-05  Score=59.38  Aligned_cols=207  Identities=24%  Similarity=0.304  Sum_probs=139.5

Q ss_pred             CCHHHHHHHHHHHHHHHHHHCCCCCCEE-EECCCCCHHHHHHHHHHHHHHCCCCCHH--HHEE------------EEEEE
Q ss_conf             6112221789999999986226778748-9667641166899999999854898834--5201------------44554
Q gi|254780163|r  202 KVDILVGRHEEINRTIQILCRRSKNNPL-YVGDPGVGKTAIAEGFAKQIVDGMVPDI--LLGA------------RIFSL  266 (798)
Q Consensus       202 KLDPVIGRd~EI~riiqIL~RR~KNn~~-lvG~~gvGktaive~la~~i~~~~vp~~--l~~~------------~i~~l  266 (798)
                      .++=|||=|-=++-+...|-..+=+..- +-|+=|||||+++-=||.-+--. -|..  =..+            -|+++
T Consensus        12 ~F~d~~GQ~~iv~tL~NAi~~~ri~HAYLF~GpRGtGKTS~ARIfAKaLNC~-~~~~~PCn~C~~C~~i~~g~~~DviEi   90 (363)
T TIGR02397        12 TFEDVIGQEHIVKTLKNAIKNGRIAHAYLFSGPRGTGKTSIARIFAKALNCQ-GPDGEPCNECESCKEINSGSSLDVIEI   90 (363)
T ss_pred             CCCCCCCCHHHHHHHHHHHHHCCCCCEEEECCCCCCCHHHHHHHHHHHHCCC-CCCCCCCCCCCHHHHHHCCCCCCEEEE
T ss_conf             6110235179999999999718966234502859976355899999986588-787787777502277652898666886


Q ss_pred             EHHHHHCCCCCCCHHHHHHHHHHHHHCCCC---C-EEEEECCHHHHHCCCCCCCCCCCHHH-HHHHHHCC--CCEEEEEE
Q ss_conf             046753063431237899999998720389---8-39997361663015544434477788-88766302--66038873
Q gi|254780163|r  267 DMGNLIAGTRYRGDFEERIKKIVKEIESYA---N-AILYIDEIHTLVGAGSASGISVDASN-LLKPALSS--GAVRCIGS  339 (798)
Q Consensus       267 d~~~l~ag~~~rg~fe~r~~~~~~~~~~~~---~-~ilfideih~ligag~~~g~~~d~an-~lkP~L~r--g~~~~Iga  339 (798)
                      |      ||+.+|=  +-++.|++.+.=.|   . =|--|||+|||         |..|=| +|| -|+.  --+.+|=|
T Consensus        91 D------AASN~gV--D~IR~l~e~v~y~P~~~kYKvYIIDEVHML---------S~~AFNALLK-TLEEPP~hV~FIlA  152 (363)
T TIGR02397        91 D------AASNNGV--DDIRELRENVKYAPSKGKYKVYIIDEVHML---------SKSAFNALLK-TLEEPPEHVVFILA  152 (363)
T ss_pred             C------CCCCCCH--HHHHHHHHHHCCCCCCCCCCEEEEECCCCC---------CHHHHHHHHH-HHCCCCCCEEEEEE
T ss_conf             4------8656878--899999873036875544335887323028---------6568999876-52279876288873


Q ss_pred             CCHHHHHHHHHCCHHHHHHCEEEEECCCCHHHHHHHHHHHHHHHHHHCCCEECCHHHHHHHHHHHHHCCCCCCHHHHHHH
Q ss_conf             04899999852011143200144306878689999998612766541035121117899999865420155564679889
Q gi|254780163|r  340 TTYSEYRQFFEKDKALVRRFQKIDVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLPDKAIDV  419 (798)
Q Consensus       340 tT~~ey~~~~e~d~al~rrF~~i~v~ep~~~~~~~iL~~~~~~ye~~h~v~~~~~al~~av~ls~ryi~~r~lPdkAidl  419 (798)
                      ||.  ++|.-  ..=|.| =|.-.-+--+.++-+.-|+.+...=    ++.|.++||...++.|+==+.|      |..|
T Consensus       153 TTE--~~KiP--~TIlSR-CQrF~Fk~i~~~~i~~~L~~I~~~E----~I~~e~~AL~~IA~~a~GS~RD------Alsl  217 (363)
T TIGR02397       153 TTE--PHKIP--ATILSR-CQRFDFKRIPLEDIVERLKKILDKE----GIKIEDEALELIARAADGSMRD------ALSL  217 (363)
T ss_pred             CCC--HHHCC--CCCEEE-CEEECCCCCCHHHHHHHHHHHHHHH----CCCCCHHHHHHHHHHCCCCCCH------HHHH
T ss_conf             487--11205--540210-0031267899899999999999870----8831778999999962896106------8899


Q ss_pred             HHHHHHHHHHHHHHHH-HCCCCHHHHHHHH
Q ss_conf             9865333321144322-1136578999866
Q gi|254780163|r  420 IDEAGASQILQPLSKR-RKFITEKDIKKTI  448 (798)
Q Consensus       420 lDea~a~~~~~~~~~~-~~~~~~~~i~~~~  448 (798)
                      ||.+-+..      .. ...|+.++|.+++
T Consensus       218 lDQ~~~~~------~~~DG~i~~~~v~~~l  241 (363)
T TIGR02397       218 LDQAISFG------NGSDGKITYEDVNEML  241 (363)
T ss_pred             HHHHHHHC------CCCCCCCCHHHHHHHH
T ss_conf             99999826------8878865789999983


No 209
>PRK09111 DNA polymerase III subunits gamma and tau; Validated
Probab=98.53  E-value=2.4e-05  Score=57.60  Aligned_cols=43  Identities=14%  Similarity=0.339  Sum_probs=28.6

Q ss_pred             HHHHEEEEEEEEHHHHHCCCCCCCHHHHHHHHHHHHHCCCCCEEEEE---CCHH
Q ss_conf             34520144554046753063431237899999998720389839997---3616
Q gi|254780163|r  256 DILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIESYANAILYI---DEIH  306 (798)
Q Consensus       256 ~~l~~~~i~~ld~~~l~ag~~~rg~fe~r~~~~~~~~~~~~~~ilfi---deih  306 (798)
                      +.-.-++||-+|=--|++-..        +.++++.++..+.-+.||   -|+|
T Consensus       127 p~~~~~kv~iidevhmls~~a--------fnallktleepp~~~~fi~att~~~  172 (600)
T PRK09111        127 PVSARYKVYIIDEVHMLSTAA--------FNALLKTLEEPPPHVKFIFATTEIR  172 (600)
T ss_pred             CCCCCEEEEEEECCCCCCHHH--------HHHHHHHHHCCCCCEEEEEECCCHH
T ss_conf             877754699960011057999--------9999987625986549999628534


No 210
>PRK06872 DNA polymerase III subunits gamma and tau; Provisional
Probab=98.53  E-value=9.4e-05  Score=53.31  Aligned_cols=36  Identities=8%  Similarity=0.281  Sum_probs=19.6

Q ss_pred             HEEEEEEEEHHHHHCCCCCCCHHHHHHHHHHHHHCCCCCEEEEE
Q ss_conf             20144554046753063431237899999998720389839997
Q gi|254780163|r  259 LGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIESYANAILYI  302 (798)
Q Consensus       259 ~~~~i~~ld~~~l~ag~~~rg~fe~r~~~~~~~~~~~~~~ilfi  302 (798)
                      ..++||-+|=--|++...        +..+++.++.-+.-+.||
T Consensus       118 ~~~kvy~idevhmls~~~--------fnallktleepp~~v~f~  153 (696)
T PRK06872        118 GRFKVYLIDEVHMLSRHS--------FNALLKTLEEPPEYVKFL  153 (696)
T ss_pred             CCEEEEEEEHHHHCCHHH--------HHHHHHHHCCCCCCEEEE
T ss_conf             754799970054438999--------999987502797544899


No 211
>TIGR02974 phageshock_pspF psp operon transcriptional activator PspF; InterPro: IPR014317   Members of this protein are PspF, the sigma-54-dependent transcriptional activator of the phage shock protein (psp) operon, found in Escherichia coli and numerous other species. The psp operon is induced by a number of stress conditions, including heat shock, ethanol and filamentous phage infection..
Probab=98.52  E-value=2.1e-06  Score=65.20  Aligned_cols=219  Identities=21%  Similarity=0.346  Sum_probs=167.1

Q ss_pred             HHCHHHHHHHHHHHHHHHHCCCCCCCCCCCEEEEECCCCHHHHHHHHHHHHHC---CCCEEEEEHHHHHCCCCCCHHCCC
Q ss_conf             53458999999999877520445657874068861432003889999987304---773377206886124653011047
Q gi|254780163|r  479 VYGQEEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFAL---GVQLLRFDMSEYMERHAVSRLIGA  555 (798)
Q Consensus       479 v~GQ~~ai~~v~~~i~~~~~gl~~~~rP~g~flf~GptGvGKTelak~la~~~---~~~lir~dmsey~e~~~vs~LiGa  555 (798)
                      +|||.+|--.|.+.+-+    |.+=+||+   |.+|==|+||=-.|..|.|-+   +.++|.+||+--.|.===|-|.|=
T Consensus         1 liG~S~aFL~vLeqvS~----lA~l~rPV---LiiGERGTGKELiA~RLHyLS~RW~~Plv~LNCAALse~LldSELFGH   73 (349)
T TIGR02974         1 LIGESNAFLEVLEQVSR----LAPLDRPV---LIIGERGTGKELIAARLHYLSKRWQQPLVKLNCAALSENLLDSELFGH   73 (349)
T ss_pred             CCCCCHHHHHHHHHHHH----CCCCCCCE---EEEECCCCCHHHHHHHHHHHHHHHCCCCEEEECCCCCCHHHHHHHHHH
T ss_conf             98872789999998751----04678866---886146746899998853324655488626610127825555665310


Q ss_pred             CCHHCCCCCCCCCCHHHHHCCC-------EEEEECCHHHCCHHHHHHHHHHHHHHHCCCCCCCEECCCCEEEEEECCCCH
Q ss_conf             8000256444310035551585-------177740445502899999999877750217799776125429999424214
Q gi|254780163|r  556 PPGYVGFGQGGILADSVDQNPY-------SVVLLDEIEKSHPDVLNILLQIMDYGILTDQSGKKISFRNVILIMTTNAGA  628 (798)
Q Consensus       556 ppGYvG~~egg~Lte~vr~~P~-------sVvl~DEiEKAh~~v~~~llqild~G~ltd~~Gr~vdf~n~iii~TsN~G~  628 (798)
                              |.|-.|-|-++|+=       .=++||||=.|...|+.=||-|.++|.+.==-|.+.==.|+=||+-||.-=
T Consensus        74 --------EaGAFTGA~~rh~GRFERAdGGTLFLDElAtas~~VQEKLLRViEYG~fERVGG~~~l~vDVRlvaATN~DL  145 (349)
T TIGR02974        74 --------EAGAFTGAKKRHEGRFERADGGTLFLDELATASLAVQEKLLRVIEYGEFERVGGSQTLKVDVRLVAATNADL  145 (349)
T ss_pred             --------CCCCHHHHCCCCCCCCEECCCCCCHHHHHHCCCHHHHHHHHHHHCCCCEEECCCCCEEEECCEEEECCCCCH
T ss_conf             --------010013030468898544368873888871421676786612010130330178604773513676214136


Q ss_pred             HHHHHCCCCCCCCCCHHHHHHHHHHHCCHHHHCCCC-EEEECCCC--CHHHHHHHHHHHHHHHHHHHHHCCCEEEECHHH
Q ss_conf             553303689882111488999998728878817768-28962889--999999999999999999998669889998899
Q gi|254780163|r  629 LEMSKARIGFGSSRNDDADKEALRNFLSPEFLNRLD-SIIPFFPL--SSDIIRQVVHKFIMKLELQLQEKGISFHFSEEV  705 (798)
Q Consensus       629 ~~~~~~~~g~~~~~~~~~~~~~l~~~f~peflnRid-~ii~F~~l--~~~~~~~i~~~~l~~l~~~l~~~~i~l~~~~~~  705 (798)
                      -.                  =+-+..||-.+|.|+- +||..=||  -.+|+.-++.-+=.....-|. .....-||+.|
T Consensus       146 P~------------------lA~~G~FRaDLLDRLAFDVi~LPPLR~R~~DI~lLAe~FA~~Ma~EL~-~~~F~GFt~~A  206 (349)
T TIGR02974       146 PA------------------LAAEGRFRADLLDRLAFDVITLPPLRERQEDIMLLAEHFAIRMARELG-LPLFPGFTPQA  206 (349)
T ss_pred             HH------------------HHHCCCCCCHHHHHHHHHHCCCCCCCCCCCCHHHHHHHHHHHHHHHHC-CCCCHHHHHHH
T ss_conf             98------------------986589840145544565507978888723278999999999999707-86551143899


Q ss_pred             HHHHHHCCCCCCCCCHHHHHHHHHHHHH
Q ss_conf             9999971898101532679999986235
Q gi|254780163|r  706 INWLVSHGYDVKMGARPLERIIKEHVKV  733 (798)
Q Consensus       706 ~~~l~~~~~~~~~GAR~l~r~i~~~i~~  733 (798)
                      ...|.+..+=-  --|.||.+||+-|-.
T Consensus       207 ~~~L~~Y~WPG--NvRELkNvvERsVyR  232 (349)
T TIGR02974       207 REQLLEYHWPG--NVRELKNVVERSVYR  232 (349)
T ss_pred             HHHHHCCCCCC--CCHHHHHHHHHHHHH
T ss_conf             99997068888--521244467666530


No 212
>KOG0728 consensus
Probab=98.52  E-value=8.3e-06  Score=60.88  Aligned_cols=141  Identities=27%  Similarity=0.525  Sum_probs=75.7

Q ss_pred             CCCCEEEEECCCCHHHHHHHHHHHHHCCCCEEEEEHHHHHCCCCCCHHCCCCCHHCCCCCCCCC----CHHHHHCCCEEE
Q ss_conf             8740688614320038899999873047733772068861246530110478000256444310----035551585177
Q gi|254780163|r  505 KPIGCYVFSGPTGVGKTEISKQLAFALGVQLLRFDMSEYMERHAVSRLIGAPPGYVGFGQGGIL----ADSVDQNPYSVV  580 (798)
Q Consensus       505 rP~g~flf~GptGvGKTelak~la~~~~~~lir~dmsey~e~~~vs~LiGappGYvG~~egg~L----te~vr~~P~sVv  580 (798)
                      +|-|++|+ ||+|+|||.||++.|...+-.|||.--||.-.+            |+|  ||..+    .-.-|.+.-|++
T Consensus       180 QPKGvlLy-gppgtGktLlaraVahht~c~firvsgselvqk------------~ig--egsrmvrelfvmarehapsii  244 (404)
T KOG0728         180 QPKGVLLY-GPPGTGKTLLARAVAHHTDCTFIRVSGSELVQK------------YIG--EGSRMVRELFVMAREHAPSII  244 (404)
T ss_pred             CCCCEEEE-CCCCCCHHHHHHHHHHHCCEEEEEECHHHHHHH------------HHH--HHHHHHHHHHHHHHHCCCCEE
T ss_conf             87604884-699975629999987541407999644999999------------850--138999999999875088267


Q ss_pred             EECCHHH-----------CCHHHHHHHHHHHHHHHCCCCCCCEECCCCEEEEEECCCCHHHHHHCCCCCCCCCCHHHHHH
Q ss_conf             7404455-----------02899999999877750217799776125429999424214553303689882111488999
Q gi|254780163|r  581 LLDEIEK-----------SHPDVLNILLQIMDYGILTDQSGKKISFRNVILIMTTNAGALEMSKARIGFGSSRNDDADKE  649 (798)
Q Consensus       581 l~DEiEK-----------Ah~~v~~~llqild~G~ltd~~Gr~vdf~n~iii~TsN~G~~~~~~~~~g~~~~~~~~~~~~  649 (798)
                      +.|||+-           .+.+|+...|.+|..  | |  | --.-+|.-+||.+|-    |             +...+
T Consensus       245 fmdeidsigs~r~e~~~ggdsevqrtmlellnq--l-d--g-featknikvimatnr----i-------------dild~  301 (404)
T KOG0728         245 FMDEIDSIGSSRVESGSGGDSEVQRTMLELLNQ--L-D--G-FEATKNIKVIMATNR----I-------------DILDP  301 (404)
T ss_pred             EEHHCCCCCCCCCCCCCCCCHHHHHHHHHHHHH--C-C--C-CCCCCCEEEEEECCC----C-------------CCCCH
T ss_conf             500001212343457898638999999999974--0-2--4-000366269984164----2-------------22468


Q ss_pred             HHHHHCCHHHHCCCCEEEECCCCCHHHHHHHHHHHHHHHH
Q ss_conf             9987288788177682896288999999999999999999
Q gi|254780163|r  650 ALRNFLSPEFLNRLDSIIPFFPLSSDIIRQVVHKFIMKLE  689 (798)
Q Consensus       650 ~l~~~f~peflnRid~ii~F~~l~~~~~~~i~~~~l~~l~  689 (798)
                         ..++|   +|||.-|-|-|-+.+.-..|+.+.-+..+
T Consensus       302 ---allrp---gridrkiefp~p~e~ar~~ilkihsrkmn  335 (404)
T KOG0728         302 ---ALLRP---GRIDRKIEFPPPNEEARLDILKIHSRKMN  335 (404)
T ss_pred             ---HHCCC---CCCCCCCCCCCCCHHHHHHHHHHHHHHHH
T ss_conf             ---66387---75455564899877888789988555301


No 213
>PRK05642 DNA replication initiation factor; Validated
Probab=98.52  E-value=7.3e-06  Score=61.27  Aligned_cols=185  Identities=18%  Similarity=0.331  Sum_probs=107.6

Q ss_pred             HHHHHHHCHHHHHHHHHHHHHHHHCCCCCCCCCCCEEEEECCCCHHHHHHHHHHH---HHCCCCEEEEEHHHHHCCCCCC
Q ss_conf             0246653458999999999877520445657874068861432003889999987---3047733772068861246530
Q gi|254780163|r  474 NLGTVVYGQEEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLA---FALGVQLLRFDMSEYMERHAVS  550 (798)
Q Consensus       474 ~l~~~v~GQ~~ai~~v~~~i~~~~~gl~~~~rP~g~flf~GptGvGKTelak~la---~~~~~~lir~dmsey~e~~~vs  550 (798)
                      .+..-|.|...+.-..+..+...     +++.+--.+.+.||+|+|||.|..+.+   ...+...+-++|+++.+..   
T Consensus        17 tfdnFi~g~N~~a~~~~~~l~~~-----~~~~~~~~l~i~G~~G~GKTHLL~A~~~~~~~~~~~~~yl~~~~~~~~~---   88 (234)
T PRK05642         17 TFANYYPGANAAALGYVERLCEA-----DAGWTESLIYLWGKDGVGRSHLLQAACLRFEQRGEPAVYLPLAELLDRG---   88 (234)
T ss_pred             CHHCCCCCCCHHHHHHHHHHHHC-----CCCCCCCEEEEECCCCCCHHHHHHHHHHHHHHCCCCEEEEEHHHHHHHH---
T ss_conf             73035718759999999998760-----6787788389988999988999999999998079967997899987544---


Q ss_pred             HHCCCCCHHCCCCCCCCCCHHHHHCCCEEEEECCHHHC--CHH----HHHHHHHHHHHHHCCCCCCCEECCCCEEEEEEC
Q ss_conf             11047800025644431003555158517774044550--289----999999987775021779977612542999942
Q gi|254780163|r  551 RLIGAPPGYVGFGQGGILADSVDQNPYSVVLLDEIEKS--HPD----VLNILLQIMDYGILTDQSGKKISFRNVILIMTT  624 (798)
Q Consensus       551 ~LiGappGYvG~~egg~Lte~vr~~P~sVvl~DEiEKA--h~~----v~~~llqild~G~ltd~~Gr~vdf~n~iii~Ts  624 (798)
                            |.         ..+.+  ..+.+|++|.|+.-  .++    +|+++=++.+.|              +-++|||
T Consensus        89 ------~~---------~~~~l--~~~d~l~IDDi~~i~g~~~~e~~lF~l~N~~~~~~--------------~~llits  137 (234)
T PRK05642         89 ------PE---------LLDNL--EQYELVCIDDLDVIAGKADWEEALFHLFNRLRDSG--------------RRLLLAA  137 (234)
T ss_pred             ------HH---------HHHHH--HHCCEEEEECHHHHCCCHHHHHHHHHHHHHHHHCC--------------CEEEEEC
T ss_conf             ------99---------98624--22798989364554688599999999999999839--------------9599957


Q ss_pred             CCCHHHHHHCCCCCCCCCCHHHHHHHHHHHCCHHHHCCCC--EEEECCCCCHHHHHHHHHHHHHHHHHHHHHCCCEEEEC
Q ss_conf             4214553303689882111488999998728878817768--28962889999999999999999999998669889998
Q gi|254780163|r  625 NAGALEMSKARIGFGSSRNDDADKEALRNFLSPEFLNRLD--SIIPFFPLSSDIIRQVVHKFIMKLELQLQEKGISFHFS  702 (798)
Q Consensus       625 N~G~~~~~~~~~g~~~~~~~~~~~~~l~~~f~peflnRid--~ii~F~~l~~~~~~~i~~~~l~~l~~~l~~~~i~l~~~  702 (798)
                      +.-..++                     ...-|.+..|+-  .++.-.|++.++..+|+...       ..++|+  .++
T Consensus       138 ~~~P~~l---------------------~~~l~DL~SRl~~~~~~~i~~l~d~~~~~iL~~~-------a~~rgi--~l~  187 (234)
T PRK05642        138 SKSPREL---------------------PVKLPDLKSRLTLALVFQMRGLSDEDKLRALQLR-------ASRRGL--HLT  187 (234)
T ss_pred             CCCHHHH---------------------CCCHHHHHHHHHCCCEEEECCCCHHHHHHHHHHH-------HHHCCC--CCC
T ss_conf             8795552---------------------3001679999957812751489989999999999-------775468--999


Q ss_pred             HHHHHHHHHCCCCCCCCCHHHHHHHHHH
Q ss_conf             8999999971898101532679999986
Q gi|254780163|r  703 EEVINWLVSHGYDVKMGARPLERIIKEH  730 (798)
Q Consensus       703 ~~~~~~l~~~~~~~~~GAR~l~r~i~~~  730 (798)
                      +++.+||+++.... +  |.|..++.+.
T Consensus       188 ~~v~~yl~~r~~R~-~--~~L~~~l~~L  212 (234)
T PRK05642        188 DEVGHFILTRGTRS-M--SALFDLLERL  212 (234)
T ss_pred             HHHHHHHHHHCCCC-H--HHHHHHHHHH
T ss_conf             89999999973588-9--9999999999


No 214
>TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily; InterPro: IPR005938    The ATPase Cdc48 is required for membrane fusion and protein degradation. It possesses chaperone-like activities and can functionally interact with Hsc70. Yeast CDC48 plays a role in cell division control whereas eukaryotic homologues are involved in the budding and transfer of membrane from the transitional endoplasmic reticulum to the Golgi apparatus.; GO: 0016787 hydrolase activity.
Probab=98.52  E-value=1.1e-05  Score=59.92  Aligned_cols=304  Identities=20%  Similarity=0.265  Sum_probs=166.6

Q ss_pred             HHHHHHHHHHHCCCCCCCHHHHHHHHHH---CHHHHHHHHHCCCCHHHHHHHHHHH-HHHCCCCCCCCCCCCCCCCCHHH
Q ss_conf             9999999999828995119999999820---7468999998599989999999999-64136545778886776469899
Q gi|254780163|r   11 VLHQALVLANERNHEYATLEHLLLALID---DSDAAIVMLSCNVDLKVLKNNLLNY-IDNDSSNKLKNGFRVECKPTSSF   86 (798)
Q Consensus        11 vL~~A~~lAk~~~H~~Vt~EHLLLaLL~---d~~~~~iL~~~giD~~~Lk~~Le~~-L~~~~~~~~~~~~~~ei~~S~~l   86 (798)
                      ++..-..+.+..+...-..+.++-.+-+   +.....++..-+--+-.++..+... |+...  ....+.     ...++
T Consensus       401 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~la--~~thG~-----~Gadl  473 (980)
T TIGR01243       401 VIKVLKDLEKDERFEKEKIEKIIEKVSKANSEDEIKEILKEDGNVYVEVRNRLIDKLLDKLA--EVTHGF-----VGADL  473 (980)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHH--HHHCCC-----HHHHH
T ss_conf             99999876665566788999999988631026789999750121246789999999999886--542362-----03559


Q ss_pred             HHHHHHHHHHHH--HCCCCCCCHHHHHHHHHHCCCCHHHHHHHHCCCCHHHHHHHHHHHCCCCHHHHHHHHHCCCCCCCC
Q ss_conf             999999999999--809981259998787873774299999998499989999999830000000111211024432100
Q gi|254780163|r   87 QRVVQRAVLHVQ--STGRGIVTGANILVALFSEPDSHATYFLQEQEMTLYDAVNFISHGISKRKEFANFQSKLNVDGSSA  164 (798)
Q Consensus        87 ~rVL~~A~~~A~--~~G~~~I~~eHLLLALL~e~ds~a~~iL~~~gis~~~v~~~i~~~~~~~~~~~~~~~~~~~~~~~~  164 (798)
                      ..+-..|...+.  ......|+.         +.+.....+|..+-++..++.+.+..........--..-....|.   
T Consensus       474 aal~~eaam~~lrr~~~eg~i~~---------ea~~iP~~vl~~lkvt~~df~ealk~~~P~~~re~~~evP~v~W~---  541 (980)
T TIGR01243       474 AALAKEAAMAALRRLIREGKINL---------EAEEIPKEVLEELKVTMKDFKEALKMVEPSALREVLVEVPNVKWE---  541 (980)
T ss_pred             HHHHHHHHHHHHHHHHCCCCCCH---------HHHHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHEEEEECCCCCCC---
T ss_conf             99989999999998740277450---------267757999987322289999998510623411000233751100---


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHCCCCCCEEEECCCCCHHHHHHHH
Q ss_conf             00012444444455554455303565442588775486112221789999999986226778748966764116689999
Q gi|254780163|r  165 GSDGEGFVNDYQAKTDLNLFPALSAYCVDLTEKVKKGKVDILVGRHEEINRTIQILCRRSKNNPLYVGDPGVGKTAIAEG  244 (798)
Q Consensus       165 ~~~~~~~~~~~~~~~~~~~~~~LdkFg~DLTe~AreGKLDPVIGRd~EI~riiqIL~RR~KNn~~lvG~~gvGktaive~  244 (798)
                        +                -.-|+..-..|-+...-    |+  ...   .+.+-|.=+--..++|.|+||.|||-++..
T Consensus       542 --d----------------iGGlee~kq~lreaveW----Pl--k~~---~~f~k~G~~PP~Gvll~GPPGtGktllaka  594 (980)
T TIGR01243       542 --D----------------IGGLEEVKQELREAVEW----PL--KAP---EVFEKLGIRPPKGVLLFGPPGTGKTLLAKA  594 (980)
T ss_pred             --C----------------CCCHHHHHHHHHHHHHC----CC--CHH---HHHHHCCCCCCCCEEEECCCCCCHHHHHHH
T ss_conf             --1----------------46678999999877523----44--405---899860788997348746898616888887


Q ss_pred             HHHHHHCCCCCHHHHEEEEEEEEHHHHHCCCCCCCHHHHHHHHHHHHHCCCCCEEEEECCHHHHHCCCC-CCCCC--CC-
Q ss_conf             999985489883452014455404675306343123789999999872038983999736166301554-44344--77-
Q gi|254780163|r  245 FAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIESYANAILYIDEIHTLVGAGS-ASGIS--VD-  320 (798)
Q Consensus       245 la~~i~~~~vp~~l~~~~i~~ld~~~l~ag~~~rg~fe~r~~~~~~~~~~~~~~ilfideih~ligag~-~~g~~--~d-  320 (798)
                      +|..--.          .++++-...++  +|+.||-|.+++.++..+++..+.|+|+|||..|--+-+ ..+..  .| 
T Consensus       595 va~es~a----------nfi~v~GPe~l--skWvGese~~ir~if~~arq~aP~~~f~deidaiaP~rG~~~~~~~vtd~  662 (980)
T TIGR01243       595 VATESGA----------NFIAVRGPEIL--SKWVGESEKAIREIFRKARQAAPAIIFFDEIDAIAPARGASLDEKGVTDR  662 (980)
T ss_pred             HHHCCCC----------CEEEECCCHHH--HHHHCHHHHHHHHHHHHHHHCCCEEEEEECHHHHCCCCCCCCCCCCHHHH
T ss_conf             7401456----------46774073122--34403247999999998641287378730211105412442100102689


Q ss_pred             HHHHHHHH----HCCCCEEEEEECCHHHHHHHHHCCHHHHH--HCEE-EEECCCCHHHHHHHHH
Q ss_conf             78888766----30266038873048999998520111432--0014-4306878689999998
Q gi|254780163|r  321 ASNLLKPA----LSSGAVRCIGSTTYSEYRQFFEKDKALVR--RFQK-IDVSEPSIEDAIEIVK  377 (798)
Q Consensus       321 ~an~lkP~----L~rg~~~~IgatT~~ey~~~~e~d~al~r--rF~~-i~v~ep~~~~~~~iL~  377 (798)
                      +-|-|-.-    -...++-+|+||.-..     =-||||-|  ||.. |.|+.|+.+.-..|.+
T Consensus       663 ~~nqll~e~dG~~~~~~vvvi~atnrPd-----i~dPallrPGr~dr~i~vP~Pd~~ar~~ifk  721 (980)
T TIGR01243       663 IVNQLLTELDGLEELSDVVVIAATNRPD-----ILDPALLRPGRLDRLILVPAPDEEARLEIFK  721 (980)
T ss_pred             HHHHHHHHHHCCCCCCCEEEEEECCCCC-----CCCCCCCCCCCCCEEEEECCCCHHHHHHHHH
T ss_conf             9999998640443436658986158874-----2361004887412168605985567676765


No 215
>PRK13531 regulatory ATPase RavA; Provisional
Probab=98.51  E-value=1.7e-07  Score=72.93  Aligned_cols=257  Identities=20%  Similarity=0.281  Sum_probs=131.7

Q ss_pred             CHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHH-HHCCCCCCEEEECCCCCHHHHHHHHHHHHHHCCC----------C
Q ss_conf             0356544258877548611222178999999998-6226778748966764116689999999985489----------8
Q gi|254780163|r  186 ALSAYCVDLTEKVKKGKVDILVGRHEEINRTIQI-LCRRSKNNPLYVGDPGVGKTAIAEGFAKQIVDGM----------V  254 (798)
Q Consensus       186 ~LdkFg~DLTe~AreGKLDPVIGRd~EI~riiqI-L~RR~KNn~~lvG~~gvGktaive~la~~i~~~~----------v  254 (798)
                      .|.+=-..|+..-.+|    ++.|+++|+-++-- ||+.   +.+|+|+||++|++|+..++..+..+.          .
T Consensus         6 ~l~eri~~l~~~L~~g----l~ERe~~i~l~lLaalage---hvlllGPPGtAKS~larrl~~~~~~a~~FeyLltRFst   78 (498)
T PRK13531          6 LLAERISRLSSALEKG----LYERSHAIRLCLLAALSGE---SVFLLGPPGIAKSLIARRLKFAFQHARAFEYLMTRFST   78 (498)
T ss_pred             HHHHHHHHHHHHHHHH----HHHHHHHHHHHHHHHHCCC---CEEEECCCCHHHHHHHHHHHHHHCCCHHHHHHHHCCCC
T ss_conf             7899999999999701----1446999999999997289---46988899513889999999985574089999874698


Q ss_pred             CHHHHEEEEEEEEHHHHHCCCCCCCHHHHHHHHHHHHHCCCCCEEEEECCHHHHHCCCCCCCCCCCHHHHHHHHHCCCC-
Q ss_conf             8345201445540467530634312378999999987203898399973616630155444344777888876630266-
Q gi|254780163|r  255 PDILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIESYANAILYIDEIHTLVGAGSASGISVDASNLLKPALSSGA-  333 (798)
Q Consensus       255 p~~l~~~~i~~ld~~~l~ag~~~rg~fe~r~~~~~~~~~~~~~~ilfideih~ligag~~~g~~~d~an~lkP~L~rg~-  333 (798)
                      |+.+.|-    +|+.+|--.    |.++....+.+     ..--|.|+|||-.      + ++  -+-|-|-..|--.. 
T Consensus        79 PeElFGP----~si~~Lk~~----g~y~R~t~G~L-----P~A~iaFLDEIfK------a-ns--AILNtLLtilNEr~f  136 (498)
T PRK13531         79 PEEVFGP----LSIQALKDE----GRYERLTSGYL-----PEAEIVFLDEIWK------A-GP--AILNTLLTAINERRF  136 (498)
T ss_pred             HHHHCCC----CCHHHHHHC----CEEEEECCCCC-----CCCEEEHHHHHHH------C-CH--HHHHHHHHHHHHHEE
T ss_conf             8885383----329987117----84897226758-----8661315787861------4-88--999999998646403


Q ss_pred             -----------EEEEEECCHHHHHHHHHCC---HHHHHHC-EEEEECCCCHHHHHH-HHHH------------HH---HH
Q ss_conf             -----------0388730489999985201---1143200-144306878689999-9986------------12---76
Q gi|254780163|r  334 -----------VRCIGSTTYSEYRQFFEKD---KALVRRF-QKIDVSEPSIEDAIE-IVKG------------IK---PY  382 (798)
Q Consensus       334 -----------~~~IgatT~~ey~~~~e~d---~al~rrF-~~i~v~ep~~~~~~~-iL~~------------~~---~~  382 (798)
                                 +.+|||+.  |+   =+.|   .||-.|| -++.|..-....... +|.+            ++   ..
T Consensus       137 ~nG~~~~~vPL~~li~ASN--El---P~~~~~L~AlyDRfL~R~~v~~v~~~~nF~~lL~s~~~~~~~~i~~~l~is~eE  211 (498)
T PRK13531        137 RNGAHEEKIPMRLLVAASN--EL---PEADSSLEALYDRMLIRLWLDKVQDKANFRSMLVSQQDENDNPVPASLQVTDEE  211 (498)
T ss_pred             CCCCCEECCCHHHHHHCCC--CC---CCCCCCHHHHHHHHHHHEECCCCCCHHHHHHHHCCCCCCCCCCCCCCCEECHHH
T ss_conf             4798313044688643046--79---999840788887644102231316766799986178864445788557117999


Q ss_pred             HH----HHCCCEECCHHHHHHHHHH--------HHHCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHH
Q ss_conf             65----4103512111789999986--------54201555646798899865333321144322113657899986631
Q gi|254780163|r  383 FE----EHHQLRYSKEAIRAAVQLS--------VRHFTSRKLPDKAIDVIDEAGASQILQPLSKRRKFITEKDIKKTIAS  450 (798)
Q Consensus       383 ye----~~h~v~~~~~al~~av~ls--------~ryi~~r~lPdkAidllDea~a~~~~~~~~~~~~~~~~~~i~~~~~~  450 (798)
                      |+    .-+.|.+++++++.+..+-        .-|++||.. -||+.||- |||      .-..|..|..-|+.-..--
T Consensus       212 ~~~wq~~i~~V~lpd~v~e~I~~lR~~l~~~e~~~YVSDRRW-kKav~LLk-asA------f~~GR~eV~~~DllLL~hC  283 (498)
T PRK13531        212 YEQWQKEIGKITLPDHVFELIFQLRQQLDALPDAPYVSDRRW-KKAIRLLQ-ASA------FFSGRDAVAPIDLILLKDC  283 (498)
T ss_pred             HHHHHHHHHHCCCCHHHHHHHHHHHHHHHCCCCCCEEECHHH-HHHHHHHH-HHH------HCCCCCCCCHHHHHHHHCC
T ss_conf             999998620213879999999999999851567875576689-99999999-987------5169553779888998635


Q ss_pred             CCCCCCHHHHHCCHHHHHHHHCCHHHHHHHCHHHHHHHHH
Q ss_conf             0245310111001123342100002466534589999999
Q gi|254780163|r  451 MNRSIHTTSFSRDDDSVLSNLEKNLGTVVYGQEEAIKKLS  490 (798)
Q Consensus       451 ~~~gip~~~~~~~~~~~l~~l~~~l~~~v~GQ~~ai~~v~  490 (798)
                      .|. -|.+.-     ....-++..+.+.-++|......+-
T Consensus       284 LW~-d~~s~~-----~l~~~l~~~~~~~a~~Q~~~l~~~~  317 (498)
T PRK13531        284 LWH-DAQSLN-----LLQQQLEVLMTGHAWQQQGMLTRLG  317 (498)
T ss_pred             CCC-CHHHHH-----HHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             879-856789-----9999999999998888999999999


No 216
>PRK08181 transposase; Validated
Probab=98.50  E-value=1.1e-06  Score=67.15  Aligned_cols=70  Identities=24%  Similarity=0.416  Sum_probs=36.3

Q ss_pred             CCCCCEEEECCCCCHHHHHHHHHHHHHHCCCCCHHHHEEEEEEEEHHHHHC---CCCCCCHHHHHHHHHHHHHCCCCCEE
Q ss_conf             677874896676411668999999998548988345201445540467530---63431237899999998720389839
Q gi|254780163|r  223 RSKNNPLYVGDPGVGKTAIAEGFAKQIVDGMVPDILLGARIFSLDMGNLIA---GTRYRGDFEERIKKIVKEIESYANAI  299 (798)
Q Consensus       223 R~KNn~~lvG~~gvGktaive~la~~i~~~~vp~~l~~~~i~~ld~~~l~a---g~~~rg~fe~r~~~~~~~~~~~~~~i  299 (798)
                      +++.|.|++|+||||||-++-+|+..-+.       +|++++-..+..|+.   .++-.|.++..++.+    .  +--+
T Consensus       104 ~~~~Nvil~Gp~GtGKThLA~Alg~~A~~-------~G~~V~f~~~~~L~~~L~~a~~~~~~~~~~~~l----~--~~dL  170 (269)
T PRK08181        104 AKGANLLLFGPPGGGKSHLAAAIGLALIE-------NGWRVLFTRTTDLVQKLQVARRELQLESAIAKL----D--KFDL  170 (269)
T ss_pred             HCCCEEEEECCCCCCHHHHHHHHHHHHHH-------CCCEEEEEEHHHHHHHHHHHHHCCCHHHHHHHH----H--CCCE
T ss_conf             64870899899998788999999999998-------799399978999999999977558399999997----4--4460


Q ss_pred             EEECCH
Q ss_conf             997361
Q gi|254780163|r  300 LYIDEI  305 (798)
Q Consensus       300 lfidei  305 (798)
                      |.|||+
T Consensus       171 LIiDe~  176 (269)
T PRK08181        171 LILDDL  176 (269)
T ss_pred             EEEHHC
T ss_conf             122010


No 217
>PRK04132 replication factor C small subunit; Provisional
Probab=98.50  E-value=1.1e-07  Score=74.27  Aligned_cols=55  Identities=31%  Similarity=0.513  Sum_probs=39.3

Q ss_pred             HHHHCCCCHHHHHHHHHHHHHHHHHHCCCCCCEEEECCCCCHHHHHHHHHHHHHH
Q ss_conf             8775486112221789999999986226778748966764116689999999985
Q gi|254780163|r  196 EKVKKGKVDILVGRHEEINRTIQILCRRSKNNPLYVGDPGVGKTAIAEGFAKQIV  250 (798)
Q Consensus       196 e~AreGKLDPVIGRd~EI~riiqIL~RR~KNn~~lvG~~gvGktaive~la~~i~  250 (798)
                      ++-|-.+||-++|-|.-++|+---.-+..=.+-+.-||||||||+-+-.||+..-
T Consensus        17 EKYRPk~LddIVgQehIVkRLK~YVk~~smPHLLFaGPPGvGKt~~al~lar~l~   71 (863)
T PRK04132         17 EKYRPQRLDEIVGQDHIVKRLKHYVKTGSMPHLLFAGPPGVGKTTAALALARELF   71 (863)
T ss_pred             HHCCCCCHHHHCCHHHHHHHHHHHHCCCCCCCEEECCCCCCCCHHHHHHHHHHHH
T ss_conf             5318761655227499999999886238885443048998771447888888761


No 218
>COG1224 TIP49 DNA helicase TIP49, TBP-interacting protein [Transcription]
Probab=98.48  E-value=2.2e-05  Score=57.90  Aligned_cols=115  Identities=20%  Similarity=0.365  Sum_probs=82.5

Q ss_pred             EEEEECCHHHCCHHHHHHHHHHHHHHHCCCCCCCEECCCCEEEEEECCCCHHHHHHCCCCCCCCCCHHHHHHHHHHHCCH
Q ss_conf             17774044550289999999987775021779977612542999942421455330368988211148899999872887
Q gi|254780163|r  578 SVVLLDEIEKSHPDVLNILLQIMDYGILTDQSGKKISFRNVILIMTTNAGALEMSKARIGFGSSRNDDADKEALRNFLSP  657 (798)
Q Consensus       578 sVvl~DEiEKAh~~v~~~llqild~G~ltd~~Gr~vdf~n~iii~TsN~G~~~~~~~~~g~~~~~~~~~~~~~l~~~f~p  657 (798)
                      .|++.||+.--+=+.|..|-+.|++-           |. -||||.||-|-..+.    |-+-..+         .--+.
T Consensus       293 GVLFIDEvHmLDIE~FsFlnrAlEse-----------~a-PIii~AtNRG~~kiR----GTd~~sP---------hGIP~  347 (450)
T COG1224         293 GVLFIDEVHMLDIECFSFLNRALESE-----------LA-PIIILATNRGMTKIR----GTDIESP---------HGIPL  347 (450)
T ss_pred             CEEEEECHHHHHHHHHHHHHHHHHCC-----------CC-CEEEEECCCCEEEEC----CCCCCCC---------CCCCH
T ss_conf             42897321345578999999876314-----------67-579997177500121----6677688---------88987


Q ss_pred             HHHCCCCEEEECCCCCHHHHHHHHHHHHHHHHHHHHHCCCEEEECHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHH
Q ss_conf             8817768289628899999999999999999999986698899988999999971898101532679999986235
Q gi|254780163|r  658 EFLNRLDSIIPFFPLSSDIIRQVVHKFIMKLELQLQEKGISFHFSEEVINWLVSHGYDVKMGARPLERIIKEHVKV  733 (798)
Q Consensus       658 eflnRid~ii~F~~l~~~~~~~i~~~~l~~l~~~l~~~~i~l~~~~~~~~~l~~~~~~~~~GAR~l~r~i~~~i~~  733 (798)
                      .||.|+ -||.-+|.+.++++.|+....++         -.+.++++|+++|++-|-.     ++||-.+ +.+.+
T Consensus       348 DlLDRl-lII~t~py~~~EireIi~iRa~e---------e~i~l~~~Ale~L~~ig~e-----tSLRYa~-qLL~p  407 (450)
T COG1224         348 DLLDRL-LIISTRPYSREEIREIIRIRAKE---------EDIELSDDALEYLTDIGEE-----TSLRYAV-QLLTP  407 (450)
T ss_pred             HHHHHE-EEEECCCCCHHHHHHHHHHHHHH---------HCCCCCHHHHHHHHHHCHH-----HHHHHHH-HHCCH
T ss_conf             666225-67744779889999999976435---------4030488899999751503-----4489999-86168


No 219
>PRK08769 DNA polymerase III subunit delta'; Validated
Probab=98.47  E-value=3.6e-06  Score=63.50  Aligned_cols=180  Identities=19%  Similarity=0.259  Sum_probs=104.9

Q ss_pred             HHHHHHHHHCCCCCCE-EEECCCCCHHHHHHHHHHHHHHCCCCCHHHH-------------EEEEEEEEHHHHHCCCCCC
Q ss_conf             9999998622677874-8966764116689999999985489883452-------------0144554046753063431
Q gi|254780163|r  213 INRTIQILCRRSKNNP-LYVGDPGVGKTAIAEGFAKQIVDGMVPDILL-------------GARIFSLDMGNLIAGTRYR  278 (798)
Q Consensus       213 I~riiqIL~RR~KNn~-~lvG~~gvGktaive~la~~i~~~~vp~~l~-------------~~~i~~ld~~~l~ag~~~r  278 (798)
                      .++++..+.+-+=.+. ++.|++|+||++++..+|+.+......+.-.             +..+++.  ..--.|.+.+
T Consensus        13 ~~~L~~~i~~~rl~HA~Lf~Gp~G~GK~~~A~~~A~~llc~~~~~~~~~~~~~~i~~g~HPD~~~i~~--~~~~~~~k~k   90 (319)
T PRK08769         13 FDQTVAALDAGRLGHGLLICGPEGLGKRAVALALAEHVLASGPDPALAQRTRQLIAAGTHPDLQLVSF--IPNRTGDKLR   90 (319)
T ss_pred             HHHHHHHHHCCCCCCEEEEECCCCCCHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHCCCCCCEEEEEC--CCCCCCCCCC
T ss_conf             99999999769942068758999878999999999998379979765433889996689989687753--4444543112


Q ss_pred             CHH-HHHHHHHHHHHCCC----CCEEEEECCHHHHHCCCCCCCCCCCHHHHHHHHHC--CCCEEEEEECCHHHHHHHHHC
Q ss_conf             237-89999999872038----98399973616630155444344777888876630--266038873048999998520
Q gi|254780163|r  279 GDF-EERIKKIVKEIESY----ANAILYIDEIHTLVGAGSASGISVDASNLLKPALS--SGAVRCIGSTTYSEYRQFFEK  351 (798)
Q Consensus       279 g~f-e~r~~~~~~~~~~~----~~~ilfideih~ligag~~~g~~~d~an~lkP~L~--rg~~~~IgatT~~ey~~~~e~  351 (798)
                      -+. =+.++.+++.+...    +.-|..||+.|++         +..++|-|.-.|.  ....-+|=.|+..+  +   -
T Consensus        91 ~~I~IdqiR~l~~~~~~~p~~g~~KV~IId~Ad~m---------n~~AaNalLK~LEEPp~~~~~iL~~~~~~--~---l  156 (319)
T PRK08769         91 TEIVIEQVREISQKLALTPQYGIAQVVIVDPADAI---------NRSACNALLKTLEEPSPGRYLWLISAQPA--R---L  156 (319)
T ss_pred             CCCCHHHHHHHHHHHHHCCCCCCCEEEEECCHHHC---------CHHHHHHHHHHHCCCCCCEEEEEEECCHH--H---C
T ss_conf             34869999999999613720279569998066752---------89999999998227998848999869936--5---8


Q ss_pred             CHHHHHHCEEEEECCCCHHHHHHHHHHHHHHHHHHCCCEECCHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHH
Q ss_conf             1114320014430687868999999861276654103512111789999986542015556467988998653
Q gi|254780163|r  352 DKALVRRFQKIDVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLPDKAIDVIDEAG  424 (798)
Q Consensus       352 d~al~rrF~~i~v~ep~~~~~~~iL~~~~~~ye~~h~v~~~~~al~~av~ls~ryi~~r~lPdkAidllDea~  424 (798)
                      =+.+-.|-|.|....|+.+++..-|.+-        |  +.+.....+..++      +--|..|..++.+..
T Consensus       157 l~TI~SRCq~~~~~~p~~~~~~~~L~~~--------g--~~~~~a~~~l~~a------~g~p~~A~~~~~~~~  213 (319)
T PRK08769        157 PATIRSRCQRLEFKLPPAHEALAWLLSQ--------G--VSERAAQEALDAA------RGHPGLAAQWLREDG  213 (319)
T ss_pred             CHHHHHCCEEECCCCCCHHHHHHHHHHC--------C--CCHHHHHHHHHHH------CCCHHHHHHHHCCCC
T ss_conf             2477648501118996999999999975--------9--9918999999982------799689999843672


No 220
>TIGR00368 TIGR00368 Mg chelatase homolog; InterPro: IPR004482   This family of bacterial proteins are variously described as 'hypothetical protein yifB', 'competence protein', 'hypothetical protein' or 'Mg chelatase-related protein'. These proteins are a subset of the magnesium chelatase, ChlI subunit family and either belong to or show significant homology to the non-peptidase homologs of the MEROPS peptidase family S16 (lon protease family, clan SF), IPR001984 from INTERPRO. .
Probab=98.46  E-value=7.4e-08  Score=75.60  Aligned_cols=224  Identities=25%  Similarity=0.343  Sum_probs=121.0

Q ss_pred             HHHCHHHHHHHHHHHHHHHHCCCCCCCCCCCEEEEECCCCHHHHHHHHHHHHHCCCCEEEEEHHHHHCCCCCCHHCC---
Q ss_conf             65345899999999987752044565787406886143200388999998730477337720688612465301104---
Q gi|254780163|r  478 VVYGQEEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFALGVQLLRFDMSEYMERHAVSRLIG---  554 (798)
Q Consensus       478 ~v~GQ~~ai~~v~~~i~~~~~gl~~~~rP~g~flf~GptGvGKTelak~la~~~~~~lir~dmsey~e~~~vs~LiG---  554 (798)
                      -|+||.+|-+++--|    -||=+       .+||+||+|+|||.+|+.+.=-+..    +---|--|..+|..|.|   
T Consensus       195 dv~GQ~~akRAleIA----aAGGH-------Nlll~GPPGsGKTmla~r~~giLP~----L~~~EalE~~~v~S~~~~l~  259 (505)
T TIGR00368       195 DVKGQQHAKRALEIA----AAGGH-------NLLLLGPPGSGKTMLASRLQGILPP----LTNEEALETARVLSLVGKLI  259 (505)
T ss_pred             CCCCHHHCCHHHHHH----HHCCC-------CEEEECCCCCCHHHHHHHHHCCCCC----CCCHHHHHHHHHHHHHHHHH
T ss_conf             254510110267775----31356-------4376782496268999875105786----45126666788888887576


Q ss_pred             ------------------CCCHHCCCC---CCCCCCHHHHHCCCEEEEECCHHHCCHHHHHHHHHHHHHHHCCCCCC-CE
Q ss_conf             ------------------780002564---44310035551585177740445502899999999877750217799-77
Q gi|254780163|r  555 ------------------APPGYVGFG---QGGILADSVDQNPYSVVLLDEIEKSHPDVLNILLQIMDYGILTDQSG-KK  612 (798)
Q Consensus       555 ------------------appGYvG~~---egg~Lte~vr~~P~sVvl~DEiEKAh~~v~~~llqild~G~ltd~~G-r~  612 (798)
                                        |-||-||=+   ..|...=|-    ..|++|||.-==-..|++.|=|-+++|.++=+.- .+
T Consensus       260 ~~~~~~rQRPFR~PHHsAS~~~lvGGG~~P~PGEiSLAh----nGvLFLDEl~EF~r~vL~~LR~PlEdg~i~iSRa~~k  335 (505)
T TIGR00368       260 DRKQWKRQRPFRSPHHSASKPALVGGGSIPKPGEISLAH----NGVLFLDELPEFKRKVLDALREPLEDGSISISRAKAK  335 (505)
T ss_pred             HCCCHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCEEHHC----CCCHHHHCCHHHHHHHHHHHCCCCCCCCEEEEECCCH
T ss_conf             523011068677865002566640587522285120200----5410432220446789987178742670688632201


Q ss_pred             EC-CCCEE-EEEECCCCHHHHHHCCCCCCCCCCHH---HHHH--HHHHHCCHHHHCCCCEEEECCCCC-HHHHHHHH---
Q ss_conf             61-25429-99942421455330368988211148---8999--998728878817768289628899-99999999---
Q gi|254780163|r  613 IS-FRNVI-LIMTTNAGALEMSKARIGFGSSRNDD---ADKE--ALRNFLSPEFLNRLDSIIPFFPLS-SDIIRQVV---  681 (798)
Q Consensus       613 vd-f~n~i-ii~TsN~G~~~~~~~~~g~~~~~~~~---~~~~--~l~~~f~peflnRid~ii~F~~l~-~~~~~~i~---  681 (798)
                      +- |==-. .|...|.       ...|+-.....+   ...+  .--+.++-.||.|||=-|.-+-+. +..|..=.   
T Consensus       336 i~kyPA~FqL~aAmNp-------cPcG~~~~~~~~c~cSp~q~~~Yl~kLsgp~LDRiDl~v~v~~~~n~~~L~~t~~~G  408 (505)
T TIGR00368       336 IFKYPARFQLVAAMNP-------CPCGHYGGKITHCRCSPQQISRYLNKLSGPFLDRIDLSVEVPLLPNPGLLSETGVRG  408 (505)
T ss_pred             HHCCCHHHHHHHHHCC-------CCCCCCCCCCCCCCCCHHHHHHHHHHCCCHHHCHHCCEECCCCCCCCCHHHHCCCCC
T ss_conf             0008724556756178-------877677787444658978999998742711200011400137888741344247899


Q ss_pred             ------HHHHHHHHHH-HH--HC--CCEE-------------EECHHHHHHHHHCCCCCCCCCHHHHHHH
Q ss_conf             ------9999999999-98--66--9889-------------9988999999971898101532679999
Q gi|254780163|r  682 ------HKFIMKLELQ-LQ--EK--GISF-------------HFSEEVINWLVSHGYDVKMGARPLERII  727 (798)
Q Consensus       682 ------~~~l~~l~~~-l~--~~--~i~l-------------~~~~~~~~~l~~~~~~~~~GAR~l~r~i  727 (798)
                            +-.+-+...+ ..  ++  +|.+             ++++....||-..=---..-+|.+.|++
T Consensus       409 ESS~~vkqrv~kaR~~q~~R~~k~A~I~~Na~L~s~~i~~FC~L~~~~~~~Le~~L~kLglS~RA~~riL  478 (505)
T TIGR00368       409 ESSAEVKQRVLKAREIQIKRYEKFAKINLNAELNSDEIEQFCKLDEKDANLLEGALNKLGLSVRATHRIL  478 (505)
T ss_pred             CCCHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCHHHHHHCCCCHHHHHHHHHHHHHCCCCHHHHHHHH
T ss_conf             5267899999999999997303545503373358245654057156889999999987085166887688


No 221
>KOG0728 consensus
Probab=98.46  E-value=2e-06  Score=65.29  Aligned_cols=196  Identities=22%  Similarity=0.356  Sum_probs=128.8

Q ss_pred             CCCCEEEECCCCCHHHHHHHHHHHHHHCCCCCHHHHEEEEEEEEHHHHHCCCCCCCHHHHHHHHHHHHHCCCCCEEEEEC
Q ss_conf             77874896676411668999999998548988345201445540467530634312378999999987203898399973
Q gi|254780163|r  224 SKNNPLYVGDPGVGKTAIAEGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIESYANAILYID  303 (798)
Q Consensus       224 ~KNn~~lvG~~gvGktaive~la~~i~~~~vp~~l~~~~i~~ld~~~l~ag~~~rg~fe~r~~~~~~~~~~~~~~ilfid  303 (798)
                      .-..++|-|+||.|||-++...|.-          -++.++.++.+.|+  .||-||--.-++.++--++.+.+.|+|.|
T Consensus       180 QPKGvlLygppgtGktLlaraVahh----------t~c~firvsgselv--qk~igegsrmvrelfvmarehapsiifmd  247 (404)
T KOG0728         180 QPKGVLLYGPPGTGKTLLARAVAHH----------TDCTFIRVSGSELV--QKYIGEGSRMVRELFVMAREHAPSIIFMD  247 (404)
T ss_pred             CCCCEEEECCCCCCHHHHHHHHHHH----------CCEEEEEECHHHHH--HHHHHHHHHHHHHHHHHHHHCCCCEEEEH
T ss_conf             8760488469997562999998754----------14079996449999--99850138999999999875088267500


Q ss_pred             CHHHHHCCCCCCCCC----------CCHHHHHHHHHCCCCEEEEEECCHHHHHHHHHCCHHHHH--HC-EEEEECCCCHH
Q ss_conf             616630155444344----------777888876630266038873048999998520111432--00-14430687868
Q gi|254780163|r  304 EIHTLVGAGSASGIS----------VDASNLLKPALSSGAVRCIGSTTYSEYRQFFEKDKALVR--RF-QKIDVSEPSIE  370 (798)
Q Consensus       304 eih~ligag~~~g~~----------~d~an~lkP~L~rg~~~~IgatT~~ey~~~~e~d~al~r--rF-~~i~v~ep~~~  370 (798)
                      ||..| |....++++          +..-|-|...=+...|++|.||.--.     --|+||-|  |. .+|..++|+.+
T Consensus       248 eidsi-gs~r~e~~~ggdsevqrtmlellnqldgfeatknikvimatnrid-----ild~allrpgridrkiefp~p~e~  321 (404)
T KOG0728         248 EIDSI-GSSRVESGSGGDSEVQRTMLELLNQLDGFEATKNIKVIMATNRID-----ILDPALLRPGRIDRKIEFPPPNEE  321 (404)
T ss_pred             HCCCC-CCCCCCCCCCCCHHHHHHHHHHHHHCCCCCCCCCEEEEEECCCCC-----CCCHHHCCCCCCCCCCCCCCCCHH
T ss_conf             00121-234345789863899999999997402400036626998416422-----246866387754555648998778


Q ss_pred             HHHHHHHHHHHHHHHHCCCEECCHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHH
Q ss_conf             99999986127665410351211178999998654201555646798899865333321144322113657899986631
Q gi|254780163|r  371 DAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLPDKAIDVIDEAGASQILQPLSKRRKFITEKDIKKTIAS  450 (798)
Q Consensus       371 ~~~~iL~~~~~~ye~~h~v~~~~~al~~av~ls~ryi~~r~lPdkAidllDea~a~~~~~~~~~~~~~~~~~~i~~~~~~  450 (798)
                      .-..||+--..+..-..|+....             |.. .+|+-.=-=+...|.-+.+-++.++|-.|+.+|..-.|.+
T Consensus       322 ar~~ilkihsrkmnl~rgi~l~k-------------iae-km~gasgaevk~vcteagm~alrerrvhvtqedfemav~k  387 (404)
T KOG0728         322 ARLDILKIHSRKMNLTRGINLRK-------------IAE-KMPGASGAEVKGVCTEAGMYALRERRVHVTQEDFEMAVAK  387 (404)
T ss_pred             HHHHHHHHHHHHHHHHCCCCHHH-------------HHH-HCCCCCCCHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHH
T ss_conf             88789988555301330667899-------------998-6789863025434335457888765200238889999999


Q ss_pred             C
Q ss_conf             0
Q gi|254780163|r  451 M  451 (798)
Q Consensus       451 ~  451 (798)
                      .
T Consensus       388 v  388 (404)
T KOG0728         388 V  388 (404)
T ss_pred             H
T ss_conf             9


No 222
>COG0466 Lon ATP-dependent Lon protease, bacterial type [Posttranslational modification, protein turnover, chaperones]
Probab=98.45  E-value=1e-05  Score=60.21  Aligned_cols=177  Identities=29%  Similarity=0.453  Sum_probs=113.7

Q ss_pred             HHHHHHHHHHHHHHH---CCCCCC---EEEECCCCCHHHHHHHHHHHHHHCCCCCHHHHEEEEEEEEHHHH-----HCCC
Q ss_conf             217899999999862---267787---48966764116689999999985489883452014455404675-----3063
Q gi|254780163|r  207 VGRHEEINRTIQILC---RRSKNN---PLYVGDPGVGKTAIAEGFAKQIVDGMVPDILLGARIFSLDMGNL-----IAGT  275 (798)
Q Consensus       207 IGRd~EI~riiqIL~---RR~KNn---~~lvG~~gvGktaive~la~~i~~~~vp~~l~~~~i~~ld~~~l-----~ag~  275 (798)
                      .|=++-=+|+++-|+   |+.|-.   -||||+||||||+++...|.-+          |+..+.+.+|.+     |-|-
T Consensus       326 YGLekVKeRIlEyLAV~~l~~~~kGpILcLVGPPGVGKTSLgkSIA~al----------~RkfvR~sLGGvrDEAEIRGH  395 (782)
T COG0466         326 YGLEKVKERILEYLAVQKLTKKLKGPILCLVGPPGVGKTSLGKSIAKAL----------GRKFVRISLGGVRDEAEIRGH  395 (782)
T ss_pred             CCCHHHHHHHHHHHHHHHHHCCCCCCEEEEECCCCCCCHHHHHHHHHHH----------CCCEEEEECCCCCCHHHHCCC
T ss_conf             6711689999999999986146788579997899887011899999995----------897799954765427775355


Q ss_pred             --CCCCHHHHHHHHHHHHHCCCCCEEEEECCHHHHHCCCCCCCCCCC-HHHH---HHHHHCC-------------CCEEE
Q ss_conf             --431237899999998720389839997361663015544434477-7888---8766302-------------66038
Q gi|254780163|r  276 --RYRGDFEERIKKIVKEIESYANAILYIDEIHTLVGAGSASGISVD-ASNL---LKPALSS-------------GAVRC  336 (798)
Q Consensus       276 --~~rg~fe~r~~~~~~~~~~~~~~ilfideih~ligag~~~g~~~d-~an~---lkP~L~r-------------g~~~~  336 (798)
                        .|-|-.-.|+-.-|+.+... |.+..+|||.-+   |++-.  .| ||-+   |-|---.             .++=+
T Consensus       396 RRTYIGaMPGrIiQ~mkka~~~-NPv~LLDEIDKm---~ss~r--GDPaSALLEVLDPEQN~~F~DhYLev~yDLS~VmF  469 (782)
T COG0466         396 RRTYIGAMPGKIIQGMKKAGVK-NPVFLLDEIDKM---GSSFR--GDPASALLEVLDPEQNNTFSDHYLEVPYDLSKVMF  469 (782)
T ss_pred             CCCCCCCCCHHHHHHHHHHCCC-CCEEEEECHHHC---CCCCC--CCHHHHHHHHCCHHHCCCHHHCCCCCCCCHHHEEE
T ss_conf             3123356872899999986776-874786403331---67777--88688888626976567612220167664432588


Q ss_pred             EEECCHHHHHHHHH-CCHHHHHHCEEEEECCCCHHHHHHHHHH-HHHHHHHHC-----CCEECCHHHHHHHHHHHH
Q ss_conf             87304899999852-0111432001443068786899999986-127665410-----351211178999998654
Q gi|254780163|r  337 IGSTTYSEYRQFFE-KDKALVRRFQKIDVSEPSIEDAIEIVKG-IKPYFEEHH-----QLRYSKEAIRAAVQLSVR  405 (798)
Q Consensus       337 IgatT~~ey~~~~e-~d~al~rrF~~i~v~ep~~~~~~~iL~~-~~~~ye~~h-----~v~~~~~al~~av~ls~r  405 (798)
                      |+  |-.    +++ --++|-.|-+.|.+.--+.++-+.|-+. +-++--.-|     .+.|+|+||...++.-.|
T Consensus       470 ia--TAN----sl~tIP~PLlDRMEiI~lsgYt~~EKl~IAk~~LiPk~~~~~gL~~~el~i~d~ai~~iI~~YTR  539 (782)
T COG0466         470 IA--TAN----SLDTIPAPLLDRMEVIRLSGYTEDEKLEIAKRHLIPKQLKEHGLKKGELTITDEAIKDIIRYYTR  539 (782)
T ss_pred             EE--ECC----CCCCCCHHHHCCEEEEEECCCCHHHHHHHHHHHCCHHHHHHCCCCCCCEEECHHHHHHHHHHHHH
T ss_conf             86--037----51329867843030564268886999999998445689997599823355658999999998767


No 223
>COG3284 AcoR Transcriptional activator of acetoin/glycerol metabolism [Secondary metabolites biosynthesis, transport, and catabolism / Transcription]
Probab=98.44  E-value=7.4e-06  Score=61.24  Aligned_cols=215  Identities=18%  Similarity=0.289  Sum_probs=136.5

Q ss_pred             HCHHHHHHHHHHHHHHHHCCCCCCCCCCCEEEEECCCCHHHHHHHHHHHHH--CCCCEEEEEHHHHHCCCCCCHHCCCCC
Q ss_conf             345899999999987752044565787406886143200388999998730--477337720688612465301104780
Q gi|254780163|r  480 YGQEEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFA--LGVQLLRFDMSEYMERHAVSRLIGAPP  557 (798)
Q Consensus       480 ~GQ~~ai~~v~~~i~~~~~gl~~~~rP~g~flf~GptGvGKTelak~la~~--~~~~lir~dmsey~e~~~vs~LiGapp  557 (798)
                      ++++..+.....-+.+.    ...+-|   .|..|-||+||-.+|+++-+.  .+.+++-+||.-+-+.+.-|-|+|--|
T Consensus       316 ~~~d~s~a~l~rk~~rv----~~~~~p---vll~GEtGtGKe~laraiH~~s~~~gpfvAvNCaAip~~liesELFGy~~  388 (606)
T COG3284         316 PLLDPSRATLLRKAERV----AATDLP---VLLQGETGTGKEVLARAIHQNSEAAGPFVAVNCAAIPEALIESELFGYVA  388 (606)
T ss_pred             CCCCHHHHHHHHHHHHH----HHCCCC---EEECCCCCHHHHHHHHHHHHCCCCCCCEEEEEECCCHHHHHHHHHHCCCC
T ss_conf             45578899999999887----624787---68538765568999999985365569837998503447764677744576


Q ss_pred             HH-CCCCCCCCCCHHHHHCCCEEEEECCHHHCCHHHHHHHHHHHHHHHCC--CCCCCEECCCCEEEEEECCCCHHHHHHC
Q ss_conf             00-25644431003555158517774044550289999999987775021--7799776125429999424214553303
Q gi|254780163|r  558 GY-VGFGQGGILADSVDQNPYSVVLLDEIEKSHPDVLNILLQIMDYGILT--DQSGKKISFRNVILIMTTNAGALEMSKA  634 (798)
Q Consensus       558 GY-vG~~egg~Lte~vr~~P~sVvl~DEiEKAh~~v~~~llqild~G~lt--d~~Gr~vdf~n~iii~TsN~G~~~~~~~  634 (798)
                      |= -|.---|. .-++.+-+-.-+++|||.----+.+.-||+||.+|..|  ++.-.+||++   ||.+|+---+.+.  
T Consensus       389 GafTga~~kG~-~g~~~~A~gGtlFldeIgd~p~~~Qs~LLrVl~e~~v~p~g~~~~~vdir---vi~ath~dl~~lv--  462 (606)
T COG3284         389 GAFTGARRKGY-KGKLEQADGGTLFLDEIGDMPLALQSRLLRVLQEGVVTPLGGTRIKVDIR---VIAATHRDLAQLV--  462 (606)
T ss_pred             CCCCCCHHCCC-CCCCEECCCCCCHHHHHHHCHHHHHHHHHHHHHHCCEECCCCCCEEEEEE---EEECCCCCHHHHH--
T ss_conf             56433001066-55410157876089876114189999999998618252358852157799---9834675799998--


Q ss_pred             CCCCCCCCCHHHHHHHHHHHCCHHHHCCCCE-EEECCCCCHHHHHHHHHHHHHHHHHHHHHCCCEEEECHHHHHHHHHCC
Q ss_conf             6898821114889999987288788177682-896288999999999999999999999866988999889999999718
Q gi|254780163|r  635 RIGFGSSRNDDADKEALRNFLSPEFLNRLDS-IIPFFPLSSDIIRQVVHKFIMKLELQLQEKGISFHFSEEVINWLVSHG  713 (798)
Q Consensus       635 ~~g~~~~~~~~~~~~~l~~~f~peflnRid~-ii~F~~l~~~~~~~i~~~~l~~l~~~l~~~~i~l~~~~~~~~~l~~~~  713 (798)
                                      -...|+-.+.-|+.. +|..-||.+..=. |.  .|.++..+  +..-.+.++++++..|....
T Consensus       463 ----------------~~g~fredLyyrL~~~~i~lP~lr~R~d~-~~--~l~~~~~~--~~~~~~~l~~~~~~~l~~~~  521 (606)
T COG3284         463 ----------------EQGRFREDLYYRLNAFVITLPPLRERSDR-IP--LLDRILKR--ENDWRLQLDDDALARLLAYR  521 (606)
T ss_pred             ----------------HCCCCHHHHHHHHCCEEECCCCHHCCCCC-HH--HHHHHHHH--CCCCCCCCCHHHHHHHHHCC
T ss_conf             ----------------75971487888744715506861104665-78--99999987--26877568999999998578


Q ss_pred             CCCCCCCHHHHHHHHHH
Q ss_conf             98101532679999986
Q gi|254780163|r  714 YDVKMGARPLERIIKEH  730 (798)
Q Consensus       714 ~~~~~GAR~l~r~i~~~  730 (798)
                      +--  --|.|..+|+..
T Consensus       522 WPG--Nirel~~v~~~~  536 (606)
T COG3284         522 WPG--NIRELDNVIERL  536 (606)
T ss_pred             CCC--CHHHHHHHHHHH
T ss_conf             998--289999999999


No 224
>PRK13531 regulatory ATPase RavA; Provisional
Probab=98.43  E-value=2.7e-05  Score=57.21  Aligned_cols=142  Identities=23%  Similarity=0.400  Sum_probs=91.8

Q ss_pred             HHHHHHHCCHHHHHHHCHHHHHHHHHHHHHHHHCCCCCCCCCCCEEEEECCCCHHHHHHHHHHHHHC-CCCEEEEEHHHH
Q ss_conf             2334210000246653458999999999877520445657874068861432003889999987304-773377206886
Q gi|254780163|r  465 DSVLSNLEKNLGTVVYGQEEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFAL-GVQLLRFDMSEY  543 (798)
Q Consensus       465 ~~~l~~l~~~l~~~v~GQ~~ai~~v~~~i~~~~~gl~~~~rP~g~flf~GptGvGKTelak~la~~~-~~~lir~dmsey  543 (798)
                      .+++..|-..|.+-++.-+++|+-+.-+..-   |     .   +.+++||+|++|+.+|+.+++.. +.+..-.=|+-|
T Consensus         8 ~eri~~l~~~L~~gl~ERe~~i~l~lLaala---g-----e---hvlllGPPGtAKS~larrl~~~~~~a~~FeyLltRF   76 (498)
T PRK13531          8 AERISRLSSALEKGLYERSHAIRLCLLAALS---G-----E---SVFLLGPPGIAKSLIARRLKFAFQHARAFEYLMTRF   76 (498)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHC---C-----C---CEEEECCCCHHHHHHHHHHHHHHCCCHHHHHHHHCC
T ss_conf             9999999999970114469999999999972---8-----9---469888995138899999999855740899998746


Q ss_pred             HCCC------CCCHHCCCCCHHCCCCCCCCCCHHHHHCCCEEEEECCHHHCCHHHHHHHHHHHHHHHCCCCCCCEECCCC
Q ss_conf             1246------5301104780002564443100355515851777404455028999999998777502177997761254
Q gi|254780163|r  544 MERH------AVSRLIGAPPGYVGFGQGGILADSVDQNPYSVVLLDEIEKSHPDVLNILLQIMDYGILTDQSGKKISFRN  617 (798)
Q Consensus       544 ~e~~------~vs~LiGappGYvG~~egg~Lte~vr~~P~sVvl~DEiEKAh~~v~~~llqild~G~ltd~~Gr~vdf~n  617 (798)
                      +++.      ++..|-.- --|+--. .|.|.+|      .|+++|||=||.|.++|.||.++-|-...++. ..+..-=
T Consensus        77 stPeElFGP~si~~Lk~~-g~y~R~t-~G~LP~A------~iaFLDEIfKansAILNtLLtilNEr~f~nG~-~~~~vPL  147 (498)
T PRK13531         77 STPEEVFGPLSIQALKDE-GRYERLT-SGYLPEA------EIVFLDEIWKAGPAILNTLLTAINERRFRNGA-HEEKIPM  147 (498)
T ss_pred             CCHHHHCCCCCHHHHHHC-CEEEEEC-CCCCCCC------EEEHHHHHHHCCHHHHHHHHHHHHHHEECCCC-CEECCCH
T ss_conf             988885383329987117-8489722-6758866------13157878614889999999986464034798-3130446


Q ss_pred             EEEEEECCC
Q ss_conf             299994242
Q gi|254780163|r  618 VILIMTTNA  626 (798)
Q Consensus       618 ~iii~TsN~  626 (798)
                      -.+|-.||-
T Consensus       148 ~~li~ASNE  156 (498)
T PRK13531        148 RLLVAASNE  156 (498)
T ss_pred             HHHHHCCCC
T ss_conf             886430467


No 225
>PRK08727 hypothetical protein; Validated
Probab=98.42  E-value=2.8e-05  Score=57.05  Aligned_cols=141  Identities=22%  Similarity=0.343  Sum_probs=64.0

Q ss_pred             EEEECCCCHHHHHHHHHHH---HHCCCCEEEEEHHHHHCCCCCCHHCCCCCHHCCCCCCCCCCHHHHHCCCEEEEECCHH
Q ss_conf             8861432003889999987---3047733772068861246530110478000256444310035551585177740445
Q gi|254780163|r  510 YVFSGPTGVGKTEISKQLA---FALGVQLLRFDMSEYMERHAVSRLIGAPPGYVGFGQGGILADSVDQNPYSVVLLDEIE  586 (798)
Q Consensus       510 flf~GptGvGKTelak~la---~~~~~~lir~dmsey~e~~~vs~LiGappGYvG~~egg~Lte~vr~~P~sVvl~DEiE  586 (798)
                      +.+.||+|+|||.|+.+.+   ...+....-+++.++... ...-                 .+.+  ....+|.+|.||
T Consensus        44 lyl~G~~GsGKTHLl~a~~~~~~~~~~~~~yl~l~~~~~~-~~~~-----------------l~~l--e~~~ll~iDDid  103 (233)
T PRK08727         44 LYLSGPAGTGKTHLALSLCAAAEQAGRSSAYLPLQAAAGR-LRDA-----------------LEAL--EGRSLVALDGVD  103 (233)
T ss_pred             EEEECCCCCCHHHHHHHHHHHHHHCCCCEEEEEHHHHHHH-HHHH-----------------HHHH--CCCCEEEEECCH
T ss_conf             9998999998899999999999827997288447885320-2567-----------------7531--038978985501


Q ss_pred             HCC--H----HHHHHHHHHHHHHHCCCCCCCEECCCCEEEEEECCCCHHHHHHCCCCCCCCCCHHHHHHHHHHHCCHHHH
Q ss_conf             502--8----9999999987775021779977612542999942421455330368988211148899999872887881
Q gi|254780163|r  587 KSH--P----DVLNILLQIMDYGILTDQSGKKISFRNVILIMTTNAGALEMSKARIGFGSSRNDDADKEALRNFLSPEFL  660 (798)
Q Consensus       587 KAh--~----~v~~~llqild~G~ltd~~Gr~vdf~n~iii~TsN~G~~~~~~~~~g~~~~~~~~~~~~~l~~~f~pefl  660 (798)
                      .-.  +    .+|+++=++.+.|              +-++|||+.-...+                     .+..|.+.
T Consensus       104 ~i~g~~~~e~aLFhL~N~~~~~~--------------~~ll~ts~~~P~~l---------------------~~~l~DL~  148 (233)
T PRK08727        104 SIAGQREDEVALFDFHNRARAAG--------------ITLLYTARQMPDGL---------------------ALVLPDLR  148 (233)
T ss_pred             HCCCCHHHHHHHHHHHHHHHHCC--------------CEEEEECCCCHHHH---------------------CCCHHHHH
T ss_conf             12698279999999999998619--------------83899779895662---------------------31002199


Q ss_pred             CCCC--EEEECCCCCHHHHHHHHHHHHHHHHHHHHHCCCEEEECHHHHHHHHHCCC
Q ss_conf             7768--28962889999999999999999999998669889998899999997189
Q gi|254780163|r  661 NRLD--SIIPFFPLSSDIIRQVVHKFIMKLELQLQEKGISFHFSEEVINWLVSHGY  714 (798)
Q Consensus       661 nRid--~ii~F~~l~~~~~~~i~~~~l~~l~~~l~~~~i~l~~~~~~~~~l~~~~~  714 (798)
                      .|+-  .++...|++.+....++.+..       .++|  +.+++++.+||+.+.-
T Consensus       149 SRL~~~~~~~l~~~dD~~~~~iL~~~a-------~~rg--l~l~~~V~~Yll~r~~  195 (233)
T PRK08727        149 SRLSQCIRIGLPVLDDVARAAVLRDRA-------QRRG--LALDEAAIDWLLTHGE  195 (233)
T ss_pred             HHHHCCCEEEECCCCHHHHHHHHHHHH-------HHCC--CCCCHHHHHHHHHHCC
T ss_conf             999669228857889799999999999-------9869--9999899999998568


No 226
>PRK09183 transposase/IS protein; Provisional
Probab=98.42  E-value=1.2e-06  Score=66.98  Aligned_cols=99  Identities=20%  Similarity=0.346  Sum_probs=51.5

Q ss_pred             EEEEECCCCHHHHHHHHHHHH---HCCCCEEEEEHHHHHCCCCCCHHCCCCCHHCCCCCCCCCCHHHHH--CCCEEEEEC
Q ss_conf             688614320038899999873---047733772068861246530110478000256444310035551--585177740
Q gi|254780163|r  509 CYVFSGPTGVGKTEISKQLAF---ALGVQLLRFDMSEYMERHAVSRLIGAPPGYVGFGQGGILADSVDQ--NPYSVVLLD  583 (798)
Q Consensus       509 ~flf~GptGvGKTelak~la~---~~~~~lir~dmsey~e~~~vs~LiGappGYvG~~egg~Lte~vr~--~P~sVvl~D  583 (798)
                      +.+|+||||||||.||-+|+.   -.+.+..-+.|++..+.-..++--            |.+...+.+  ..+.++++|
T Consensus       103 Nvil~G~~GtGKThLA~Alg~~A~~~G~~v~f~~~~~L~~~L~~a~~~------------~~~~~~l~r~l~~~dLLIiD  170 (258)
T PRK09183        103 NIVLLGPSGVGKTHLAIALGYEAVRAGIKVRFTTAADLLLQLSTAQRQ------------GRYKTTLQRGVMAPRLLIID  170 (258)
T ss_pred             CEEEECCCCCCHHHHHHHHHHHHHHCCCEEEEEEHHHHHHHHHHHHHC------------CCHHHHHHHHHCCCCEEEEH
T ss_conf             679989999868999999999999879939997899999999999876------------85999999874346514431


Q ss_pred             CH--HHCCHHHHHHHHHHHHHHHCCCCCCCEECCCCEEEEEECCCCHHH
Q ss_conf             44--550289999999987775021779977612542999942421455
Q gi|254780163|r  584 EI--EKSHPDVLNILLQIMDYGILTDQSGKKISFRNVILIMTTNAGALE  630 (798)
Q Consensus       584 Ei--EKAh~~v~~~llqild~G~ltd~~Gr~vdf~n~iii~TsN~G~~~  630 (798)
                      |+  ..-.+..-++|+|++++=.     ++     .+ +|+|||..-.+
T Consensus       171 dlG~~~~~~~~~~~lfeli~~Ry-----e~-----~S-~IiTSn~~~~~  208 (258)
T PRK09183        171 EIGYLPFSQEEANLFFQVIAKRY-----EK-----GA-MILTSNLPFGQ  208 (258)
T ss_pred             HHHCCCCCHHHHHHHHHHHHHHH-----CC-----CC-EEEECCCCHHH
T ss_conf             33154688889999999999985-----76-----77-89988999789


No 227
>COG1484 DnaC DNA replication protein [DNA replication, recombination, and repair]
Probab=98.41  E-value=2.9e-06  Score=64.19  Aligned_cols=121  Identities=21%  Similarity=0.352  Sum_probs=68.7

Q ss_pred             CEEEEECCCCHHHHHHHHHHHHHC---CCCEEEEEHHHHHCCCCCCHHCCCCCHHCCCCCCCCCCHHHH-HCCCEEEEEC
Q ss_conf             068861432003889999987304---773377206886124653011047800025644431003555-1585177740
Q gi|254780163|r  508 GCYVFSGPTGVGKTEISKQLAFAL---GVQLLRFDMSEYMERHAVSRLIGAPPGYVGFGQGGILADSVD-QNPYSVVLLD  583 (798)
Q Consensus       508 g~flf~GptGvGKTelak~la~~~---~~~lir~dmsey~e~~~vs~LiGappGYvG~~egg~Lte~vr-~~P~sVvl~D  583 (798)
                      .+++|.||+|||||.||-+++..+   +.+.+-+..+|++.     +|..+      +++|..-.+-.+ -..+-|+.+|
T Consensus       106 ~nl~l~G~~G~GKthLa~Ai~~~l~~~g~sv~f~~~~el~~-----~Lk~~------~~~~~~~~~l~~~l~~~dlLIiD  174 (254)
T COG1484         106 ENLVLLGPPGVGKTHLAIAIGNELLKAGISVLFITAPDLLS-----KLKAA------FDEGRLEEKLLRELKKVDLLIID  174 (254)
T ss_pred             CCEEEECCCCCCHHHHHHHHHHHHHHCCCEEEEEEHHHHHH-----HHHHH------HHCCCHHHHHHHHHHHCCEEEEE
T ss_conf             82899899998799999999999998398499988599999-----99998------74552689999887528989982


Q ss_pred             CHH--HCCHHHHHHHHHHHHHHHCCCCCCCEECCCCEEEEEECCCCHHHHHHCCCCCCCCCCHHHHHHHHHH
Q ss_conf             445--5028999999998777502177997761254299994242145533036898821114889999987
Q gi|254780163|r  584 EIE--KSHPDVLNILLQIMDYGILTDQSGKKISFRNVILIMTTNAGALEMSKARIGFGSSRNDDADKEALRN  653 (798)
Q Consensus       584 EiE--KAh~~v~~~llqild~G~ltd~~Gr~vdf~n~iii~TsN~G~~~~~~~~~g~~~~~~~~~~~~~l~~  653 (798)
                      ||=  ...+..-+.|+|+++.=+..          ... |+|||.--.+.... .+.  ....+...+.+.-
T Consensus       175 DlG~~~~~~~~~~~~~q~I~~r~~~----------~~~-~~tsN~~~~~~~~~-~~~--~~~~e~~~dRi~~  232 (254)
T COG1484         175 DIGYEPFSQEEADLLFQLISRRYES----------RSL-IITSNLSFGEWDEL-FGD--DALTEALLDRILH  232 (254)
T ss_pred             CCCCCCCCCHHHHHHHHHHHHHHHH----------CCC-CEEECCCHHHHHHH-CCC--CCHHHHHHHHHHH
T ss_conf             3677668815587999999999973----------054-20205882788866-067--5116899999986


No 228
>PRK06526 transposase; Provisional
Probab=98.41  E-value=1.2e-06  Score=66.90  Aligned_cols=69  Identities=26%  Similarity=0.541  Sum_probs=32.5

Q ss_pred             CCCCEEEECCCCCHHHHHHHHHHHHHHCCCCCHHHHEEEEEEEEHHHHHC---CCCCCCHHHHHHHHHHHHHCCCCCEEE
Q ss_conf             77874896676411668999999998548988345201445540467530---634312378999999987203898399
Q gi|254780163|r  224 SKNNPLYVGDPGVGKTAIAEGFAKQIVDGMVPDILLGARIFSLDMGNLIA---GTRYRGDFEERIKKIVKEIESYANAIL  300 (798)
Q Consensus       224 ~KNn~~lvG~~gvGktaive~la~~i~~~~vp~~l~~~~i~~ld~~~l~a---g~~~rg~fe~r~~~~~~~~~~~~~~il  300 (798)
                      .+.|.+++|+||+|||-++-+|+...+.       +|++++-..+..|+.   -++-.|.++..++.    +.+.  -+|
T Consensus        97 ~~~Nvil~G~~GtGKThLA~Alg~~A~~-------~G~~v~f~~~~~L~~~L~~a~~~g~~~~~~~~----l~~~--dLL  163 (254)
T PRK06526         97 GKENVVFLGPPGTGKTHLAIGLGIRACQ-------AGHRVLFATAAQWVARLAAAHHAGRLQDELVK----LGRI--PLL  163 (254)
T ss_pred             CCCCEEEECCCCCCHHHHHHHHHHHHHH-------CCCCEEEEEHHHHHHHHHHHHHCCCHHHHHHH----HHCC--CEE
T ss_conf             5887899899998689999999999998-------69967998779999999998855809999998----5136--877


Q ss_pred             EECCH
Q ss_conf             97361
Q gi|254780163|r  301 YIDEI  305 (798)
Q Consensus       301 fidei  305 (798)
                      .|||+
T Consensus       164 IiDe~  168 (254)
T PRK06526        164 IVDEV  168 (254)
T ss_pred             EEECC
T ss_conf             65021


No 229
>PRK08727 hypothetical protein; Validated
Probab=98.41  E-value=7e-05  Score=54.22  Aligned_cols=204  Identities=14%  Similarity=0.195  Sum_probs=115.8

Q ss_pred             HHHHHHHHHHHHHHHCCCCCCEE-EECCCCCHHHHHHHHHHHHHHCCCCCHHHHEEEEEEEEHHHHHCCCCCCCHHHHHH
Q ss_conf             21789999999986226778748-96676411668999999998548988345201445540467530634312378999
Q gi|254780163|r  207 VGRHEEINRTIQILCRRSKNNPL-YVGDPGVGKTAIAEGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGDFEERI  285 (798)
Q Consensus       207 IGRd~EI~riiqIL~RR~KNn~~-lvG~~gvGktaive~la~~i~~~~vp~~l~~~~i~~ld~~~l~ag~~~rg~fe~r~  285 (798)
                      .|.+..+.++.+.. .-...|++ |.|++|+|||.++++++......       ++...-+++..          +....
T Consensus        23 ~~~n~~~a~l~~~~-~~~~~~~lyl~G~~GsGKTHLl~a~~~~~~~~-------~~~~~yl~l~~----------~~~~~   84 (233)
T PRK08727         23 AAPDGLLAQLQALA-AGQSSDWLYLSGPAGTGKTHLALSLCAAAEQA-------GRSSAYLPLQA----------AAGRL   84 (233)
T ss_pred             CCCHHHHHHHHHHH-CCCCCCEEEEECCCCCCHHHHHHHHHHHHHHC-------CCCEEEEEHHH----------HHHHH
T ss_conf             78559999999874-38888989998999998899999999999827-------99728844788----------53202


Q ss_pred             HHHHHHHCCCCCEEEEECCHHHHHCCCCCCCCCCCHHHHHHHHHCCCCEEEEEECCHHHHHHHHHCCHHHHHHC---EEE
Q ss_conf             99998720389839997361663015544434477788887663026603887304899999852011143200---144
Q gi|254780163|r  286 KKIVKEIESYANAILYIDEIHTLVGAGSASGISVDASNLLKPALSSGAVRCIGSTTYSEYRQFFEKDKALVRRF---QKI  362 (798)
Q Consensus       286 ~~~~~~~~~~~~~ilfideih~ligag~~~g~~~d~an~lkP~L~rg~~~~IgatT~~ey~~~~e~d~al~rrF---~~i  362 (798)
                      ..+++.++.  .-.+.||+||.+.|-...+..   .=|++--...+|.--++.+..+--.-.+..+|  |..|+   ..+
T Consensus        85 ~~~l~~le~--~~ll~iDDid~i~g~~~~e~a---LFhL~N~~~~~~~~ll~ts~~~P~~l~~~l~D--L~SRL~~~~~~  157 (233)
T PRK08727         85 RDALEALEG--RSLVALDGVDSIAGQREDEVA---LFDFHNRARAAGITLLYTARQMPDGLALVLPD--LRSRLSQCIRI  157 (233)
T ss_pred             HHHHHHHCC--CCEEEEECCHHCCCCHHHHHH---HHHHHHHHHHCCCEEEEECCCCHHHHCCCHHH--HHHHHHCCCEE
T ss_conf             567753103--897898550112698279999---99999999861983899779895662310021--99999669228


Q ss_pred             EECCCCHHHHHHHHHHHHHHHHHHCCCEECCHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHCCCCHH
Q ss_conf             30687868999999861276654103512111789999986542015556467988998653333211443221136578
Q gi|254780163|r  363 DVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLPDKAIDVIDEAGASQILQPLSKRRKFITEK  442 (798)
Q Consensus       363 ~v~ep~~~~~~~iL~~~~~~ye~~h~v~~~~~al~~av~ls~ryi~~r~lPdkAidllDea~a~~~~~~~~~~~~~~~~~  442 (798)
                      .+.+|+.++-..+|...    -...|+.++++++.+.+.-..|=+..   =-+.++-||.+.       .. .++.||-.
T Consensus       158 ~l~~~dD~~~~~iL~~~----a~~rgl~l~~~V~~Yll~r~~R~~~~---l~~~l~~LD~~S-------L~-~kr~iTip  222 (233)
T PRK08727        158 GLPVLDDVARAAVLRDR----AQRRGLALDEAAIDWLLTHGERELAG---LVALLDRLDRES-------LA-AKRRITVP  222 (233)
T ss_pred             EECCCCHHHHHHHHHHH----HHHCCCCCCHHHHHHHHHHCCCCHHH---HHHHHHHHHHHH-------HH-CCCCCCHH
T ss_conf             85788979999999999----99869999989999999856889999---999999999999-------98-08988899


Q ss_pred             HHHHHHHH
Q ss_conf             99986631
Q gi|254780163|r  443 DIKKTIAS  450 (798)
Q Consensus       443 ~i~~~~~~  450 (798)
                      =+.+++.+
T Consensus       223 ~vk~vL~e  230 (233)
T PRK08727        223 FLRRVLEE  230 (233)
T ss_pred             HHHHHHHH
T ss_conf             99999972


No 230
>PRK05201 hslU ATP-dependent protease ATP-binding subunit; Provisional
Probab=98.40  E-value=7.3e-06  Score=61.30  Aligned_cols=55  Identities=33%  Similarity=0.534  Sum_probs=33.6

Q ss_pred             CCCCEEEECCCCCHHHHHHHHHHHHHHCCCCCHHHHEEEEEEEEHHHHHCCCCCCCH-HHHHHHHHH
Q ss_conf             778748966764116689999999985489883452014455404675306343123-789999999
Q gi|254780163|r  224 SKNNPLYVGDPGVGKTAIAEGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGD-FEERIKKIV  289 (798)
Q Consensus       224 ~KNn~~lvG~~gvGktaive~la~~i~~~~vp~~l~~~~i~~ld~~~l~ag~~~rg~-fe~r~~~~~  289 (798)
                      .++|.+|||+.|||||-|+..||+.+   ++|       ++-.|.+.+ .-+.|.|. -|.=++.++
T Consensus        49 ~pkNILmIGPTGvGKTeIARrLAkl~---~aP-------FvkveATk~-TEvGYvGrDVEsiIrdLv  104 (442)
T PRK05201         49 TPKNILMIGPTGVGKTEIARRLAKLA---NAP-------FIKVEATKF-TEVGYVGRDVESIIRDLV  104 (442)
T ss_pred             CCCCEEEECCCCCCHHHHHHHHHHHH---CCC-------EEEEECCCC-CCCCCCCCCHHHHHHHHH
T ss_conf             64316887888866789999999984---898-------587521310-003435643788999999


No 231
>PRK07952 DNA replication protein DnaC; Validated
Probab=98.40  E-value=1.8e-06  Score=65.67  Aligned_cols=124  Identities=24%  Similarity=0.351  Sum_probs=78.5

Q ss_pred             CHHHHHHHHHHHHHHHHCCCCCCCCCCCEEEEECCCCHHHHHHHHHHHHH---CCCCEEEEEHHHHHCCCCCCHHCCCCC
Q ss_conf             45899999999987752044565787406886143200388999998730---477337720688612465301104780
Q gi|254780163|r  481 GQEEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFA---LGVQLLRFDMSEYMERHAVSRLIGAPP  557 (798)
Q Consensus       481 GQ~~ai~~v~~~i~~~~~gl~~~~rP~g~flf~GptGvGKTelak~la~~---~~~~lir~dmsey~e~~~vs~LiGapp  557 (798)
                      ||..|...-..-+...    . .+  .++|+|.||.|+|||.||-++|..   -+.+.+-+.+++++..     |-.+  
T Consensus        77 ~q~~al~~a~~y~enf----~-~~--~~gLlF~G~~GTGKThLA~aIan~Li~~G~sVlf~t~~dLl~~-----lr~t--  142 (242)
T PRK07952         77 GQMNALSKARQYVEEF----D-GN--IASFIFSGKPGTGKNHLAAAICNELLLRGKSVLIITVADIMSA-----MKDT--  142 (242)
T ss_pred             HHHHHHHHHHHHHHHH----C-CC--CCEEEEECCCCCCHHHHHHHHHHHHHHCCCEEEEEEHHHHHHH-----HHHH--
T ss_conf             7899999999999865----4-38--8717997899997899999999999987994999779999999-----9999--


Q ss_pred             HHCCCCCCCCCCHH--HH-HCCCEEEEECCH--HHCCHHHHHHHHHHHHHHHCCCCCCCEECCCCEEEEEECCCCHHHHH
Q ss_conf             00256444310035--55-158517774044--55028999999998777502177997761254299994242145533
Q gi|254780163|r  558 GYVGFGQGGILADS--VD-QNPYSVVLLDEI--EKSHPDVLNILLQIMDYGILTDQSGKKISFRNVILIMTTNAGALEMS  632 (798)
Q Consensus       558 GYvG~~egg~Lte~--vr-~~P~sVvl~DEi--EKAh~~v~~~llqild~G~ltd~~Gr~vdf~n~iii~TsN~G~~~~~  632 (798)
                       |   +++ ..+|.  ++ -.-+.++.+||+  |+........|.||+|. |..       +-+.  .|+|||+..+++.
T Consensus       143 -~---~~~-~~~e~~~l~~l~~~dLLIiDdlG~e~~t~~~~~~lf~iId~-Ry~-------~~kp--~IitTNl~~~eL~  207 (242)
T PRK07952        143 -F---RNS-ETSEEQLLNDLSNVDLLVIDEIGVQTESRYEKVIINQIVDR-RSS-------SKRP--TGMLTNSNMEEMT  207 (242)
T ss_pred             -H---HCC-CCCHHHHHHHHHCCCEEEEECCCCCCCCHHHHHHHHHHHHH-HHH-------CCCC--EEEEECCCHHHHH
T ss_conf             -8---068-75699999986318989873014665888899999999999-997-------1698--8998179999999


Q ss_pred             H
Q ss_conf             0
Q gi|254780163|r  633 K  633 (798)
Q Consensus       633 ~  633 (798)
                      +
T Consensus       208 ~  208 (242)
T PRK07952        208 K  208 (242)
T ss_pred             H
T ss_conf             9


No 232
>KOG0651 consensus
Probab=98.40  E-value=1.9e-06  Score=65.42  Aligned_cols=157  Identities=23%  Similarity=0.353  Sum_probs=69.2

Q ss_pred             CHHHHHHHHHHHHHHHHHHCCCCCC-------------EEEECCCCCHHHHHHHHHHHHHHCCCCCHHHHEEEEEEEEHH
Q ss_conf             1122217899999999862267787-------------489667641166899999999854898834520144554046
Q gi|254780163|r  203 VDILVGRHEEINRTIQILCRRSKNN-------------PLYVGDPGVGKTAIAEGFAKQIVDGMVPDILLGARIFSLDMG  269 (798)
Q Consensus       203 LDPVIGRd~EI~riiqIL~RR~KNn-------------~~lvG~~gvGktaive~la~~i~~~~vp~~l~~~~i~~ld~~  269 (798)
                      ++-+-|=-.-|+.+.+++.=--+||             .+|-|+||.|||-+++..|..+          +.-.+-...+
T Consensus       131 ~~~~ggl~~qirelre~ielpl~np~lf~rvgIk~Pkg~ll~GppGtGKTlla~~Vaa~m----------g~nfl~v~ss  200 (388)
T KOG0651         131 FENVGGLFYQIRELREVIELPLTNPELFLRVGIKPPKGLLLYGPPGTGKTLLARAVAATM----------GVNFLKVVSS  200 (388)
T ss_pred             HHHHCCHHHHHHHHHHHEEEECCCCHHCCCCCCCCCCEEEEECCCCCCHHHHHHHHHHHC----------CCCEEEEEHH
T ss_conf             877178388889988655740248100234577788256876799986459999999865----------9854774476


Q ss_pred             HHHCCCCCCCHHHHHHHHHHHHHCCCCCEEEEECCHHHHHCCCCCCCCCC---------CHHHHHHHHHCCCCEEEEEEC
Q ss_conf             75306343123789999999872038983999736166301554443447---------778888766302660388730
Q gi|254780163|r  270 NLIAGTRYRGDFEERIKKIVKEIESYANAILYIDEIHTLVGAGSASGISV---------DASNLLKPALSSGAVRCIGST  340 (798)
Q Consensus       270 ~l~ag~~~rg~fe~r~~~~~~~~~~~~~~ilfideih~ligag~~~g~~~---------d~an~lkP~L~rg~~~~Igat  340 (798)
                      +++.  +|-||--.-++....+++..-+.|+|||||+.+-|---++|++-         ..+|-+.-.=.-|.+.+|.||
T Consensus       201 ~lv~--kyiGEsaRlIRemf~yA~~~~pciifmdeiDAigGRr~se~Ts~dreiqrTLMeLlnqmdgfd~l~rVk~Imat  278 (388)
T KOG0651         201 ALVD--KYIGESARLIRDMFRYAREVIPCIIFMDEIDAIGGRRFSEGTSSDREIQRTLMELLNQMDGFDTLHRVKTIMAT  278 (388)
T ss_pred             HHHH--HHCCCHHHHHHHHHHHHHHHCCEEEEEHHHHHHCCEEECCCCCHHHHHHHHHHHHHHHHCCCHHCCCCCEEEEC
T ss_conf             6633--00265788999999778652755775101231145773355520599999999998742140120663179853


Q ss_pred             CHHHHHHHHHCCHHHHH--HCE-EEEECCCCHHHHHHHH
Q ss_conf             48999998520111432--001-4430687868999999
Q gi|254780163|r  341 TYSEYRQFFEKDKALVR--RFQ-KIDVSEPSIEDAIEIV  376 (798)
Q Consensus       341 T~~ey~~~~e~d~al~r--rF~-~i~v~ep~~~~~~~iL  376 (798)
                      .--     =--||||-|  |.+ .++++=|+...-+.|+
T Consensus       279 Nrp-----dtLdpaLlRpGRldrk~~iPlpne~~r~~I~  312 (388)
T KOG0651         279 NRP-----DTLDPALLRPGRLDRKVEIPLPNEQARLGIL  312 (388)
T ss_pred             CCC-----CCCCHHHCCCCCCCCEECCCCCCHHHCEEEE
T ss_conf             886-----6566554287521110026885544240267


No 233
>COG0465 HflB ATP-dependent Zn proteases [Posttranslational modification, protein turnover, chaperones]
Probab=98.40  E-value=1.8e-05  Score=58.50  Aligned_cols=97  Identities=30%  Similarity=0.512  Sum_probs=71.1

Q ss_pred             HHHHHHCHHHHHHHHHHHHHHHHCCCCCCC--------CCCCEEEEECCCCHHHHHHHHHHHHHCCCCEEEEEHHHHHCC
Q ss_conf             246653458999999999877520445657--------874068861432003889999987304773377206886124
Q gi|254780163|r  475 LGTVVYGQEEAIKKLSSSIKIARAGLSDPN--------KPIGCYVFSGPTGVGKTEISKQLAFALGVQLLRFDMSEYMER  546 (798)
Q Consensus       475 l~~~v~GQ~~ai~~v~~~i~~~~~gl~~~~--------rP~g~flf~GptGvGKTelak~la~~~~~~lir~dmsey~e~  546 (798)
                      --.-|.|.|+|.+.+.+-+--    |++|+        =|-|+ |++||+|+|||-|||+.|-.-+.++..+--|+|-|-
T Consensus       148 ~F~DVAG~dEakeel~EiVdf----Lk~p~ky~~lGakiPkGv-lLvGpPGTGKTLLAkAvAgEA~VPFf~iSGS~FVem  222 (596)
T COG0465         148 TFADVAGVDEAKEELSELVDF----LKNPKKYQALGAKIPKGV-LLVGPPGTGKTLLAKAVAGEAGVPFFSISGSDFVEM  222 (596)
T ss_pred             CHHHHCCCHHHHHHHHHHHHH----HHCCHHHHHCCCCCCCCE-EEECCCCCCCHHHHHHHHCCCCCCCEECCCHHHHHH
T ss_conf             756641867999999999998----638556675235345652-685599987278999984546898353034446443


Q ss_pred             CCCCHHCCCCCHHCCCCCCCCCCH-HHHHCCCEEEEECCHHH
Q ss_conf             653011047800025644431003-55515851777404455
Q gi|254780163|r  547 HAVSRLIGAPPGYVGFGQGGILAD-SVDQNPYSVVLLDEIEK  587 (798)
Q Consensus       547 ~~vs~LiGappGYvG~~egg~Lte-~vr~~P~sVvl~DEiEK  587 (798)
                           .+|-|.-+|     -.|.+ +-+..| |+|.+|||+.
T Consensus       223 -----fVGvGAsRV-----RdLF~qAkk~aP-~IIFIDEiDA  253 (596)
T COG0465         223 -----FVGVGASRV-----RDLFEQAKKNAP-CIIFIDEIDA  253 (596)
T ss_pred             -----HCCCCCHHH-----HHHHHHHHCCCC-CEEEEEHHHH
T ss_conf             -----147883888-----999998551599-6698763433


No 234
>PRK07132 DNA polymerase III subunit delta'; Validated
Probab=98.39  E-value=8.2e-06  Score=60.93  Aligned_cols=66  Identities=23%  Similarity=0.246  Sum_probs=29.8

Q ss_pred             EEEEECCHHHHHCCCCCCCCCCCHHHHHHHHHCC--CCEEEEEECCHHHHHHHHHCCHHHHHHCEEEEECCCCHHHHHHH
Q ss_conf             3999736166301554443447778888766302--66038873048999998520111432001443068786899999
Q gi|254780163|r  298 AILYIDEIHTLVGAGSASGISVDASNLLKPALSS--GAVRCIGSTTYSEYRQFFEKDKALVRRFQKIDVSEPSIEDAIEI  375 (798)
Q Consensus       298 ~ilfideih~ligag~~~g~~~d~an~lkP~L~r--g~~~~IgatT~~ey~~~~e~d~al~rrF~~i~v~ep~~~~~~~i  375 (798)
                      -|..|||+|++         +..|+|-|.-.|.-  .....|=+||.-  .+.   =+..-.|-|.+....++.++-...
T Consensus        94 Kv~IIdea~~l---------t~~A~NaLLKtLEEPp~~~~fil~t~~~--~~i---l~TI~SRCq~~~f~~~~~~~i~~~  159 (303)
T PRK07132         94 KILIIKNIEKT---------SNSSLNALLKTIEEPSKNTYFLLTTKNI--NKV---IPTIVSRCQVINVKEPDQQKILAK  159 (303)
T ss_pred             EEEEEECHHHC---------CHHHHHHHHHHCCCCCCCEEEEEEECCH--HHC---CHHHHHCCEEEECCCCCHHHHHHH
T ss_conf             69998165533---------9999999998703898684899972882--438---377863665663788999999999


Q ss_pred             HH
Q ss_conf             98
Q gi|254780163|r  376 VK  377 (798)
Q Consensus       376 L~  377 (798)
                      |.
T Consensus       160 l~  161 (303)
T PRK07132        160 LL  161 (303)
T ss_pred             HH
T ss_conf             98


No 235
>pfam07726 AAA_3 ATPase family associated with various cellular activities (AAA). This Pfam entry includes some of the AAA proteins not detected by the pfam00004 model.
Probab=98.39  E-value=3.3e-07  Score=70.94  Aligned_cols=107  Identities=25%  Similarity=0.326  Sum_probs=62.5

Q ss_pred             CEEEECCCCCHHHHHHHHHHHHHHCCCCCHHHHEEEE-E--EEEHHHHHCCCC-C---CCHHHHHHHHHHHHHCCCC---
Q ss_conf             7489667641166899999999854898834520144-5--540467530634-3---1237899999998720389---
Q gi|254780163|r  227 NPLYVGDPGVGKTAIAEGFAKQIVDGMVPDILLGARI-F--SLDMGNLIAGTR-Y---RGDFEERIKKIVKEIESYA---  296 (798)
Q Consensus       227 n~~lvG~~gvGktaive~la~~i~~~~vp~~l~~~~i-~--~ld~~~l~ag~~-~---rg~fe~r~~~~~~~~~~~~---  296 (798)
                      |++|.|+||||||++++.+|...-..       -.+| +  .++...|+ |+. |   .|+|+=          ..|   
T Consensus         1 hVLL~GppG~GKT~l~~~lA~~~~~~-------~~~i~~~~~~~~~Dl~-G~~~~~~~~~~~~~----------~~G~l~   62 (131)
T pfam07726         1 HVLLEGVPGLAKTLLARTLARSLGLD-------FRRIQFTPDLLPSDIT-GTEVYDQKTREFEF----------RPGPIF   62 (131)
T ss_pred             CEEEECCCCCHHHHHHHHHHHHHCCC-------CEEEEECCCCCCCCCC-CCEEECCCCCEEEE----------ECCCCC
T ss_conf             98789899876999999999995998-------1688833776700036-84542378740898----------457310


Q ss_pred             CEEEEECCHHHHHCCCCCCCCCCCHHHHHHHHHCCCC-------------EEEEEECCHHHHHHHHHCCHHHHHHCE
Q ss_conf             8399973616630155444344777888876630266-------------038873048999998520111432001
Q gi|254780163|r  297 NAILYIDEIHTLVGAGSASGISVDASNLLKPALSSGA-------------VRCIGSTTYSEYRQFFEKDKALVRRFQ  360 (798)
Q Consensus       297 ~~ilfideih~ligag~~~g~~~d~an~lkP~L~rg~-------------~~~IgatT~~ey~~~~e~d~al~rrF~  360 (798)
                      .-|+|+|||+..         +-++-|.|-++|..+.             .++|++.-|.||.-..+-++||..||=
T Consensus        63 ~~vl~lDEin~a---------~~~v~~~Ll~~l~er~v~~~g~~~~~p~~f~viAt~NP~e~~G~~~L~~al~dRF~  130 (131)
T pfam07726        63 ANVLLADEINRA---------PPKTQSALLEAMQERQVTIGGETHPLPEPFFVLATQNPIEQEGTYPLPEAQLDRFL  130 (131)
T ss_pred             CCCEEEEHHHCC---------CHHHHHHHHHHHHCEEEEECCEEEECCCCEEEEECCCCCCCCCCEECCHHHHCCCC
T ss_conf             370564012039---------98999999976326499779988527998499971698755576449988965615


No 236
>TIGR00382 clpX ATP-dependent Clp protease, ATP-binding subunit ClpX; InterPro: IPR004487   ClpX is a member of the HSP (heat-shock protein) 100 family. Gel filtration and electron microscopy showed that ClpX subunits associate to form a six-membered ring that is stabilized by binding of ATP or nonhydrolyzable analogs of ATP . It functions as an ATP-depedent  molecular chaperone and is the regulatory subunit of the ClpXP protease .   ClpXP is involved in DNA damage repair, stationary-phase gene expression, and ssrA-mediated protein quality control. To date more than 50 proteins include transcription factors, metabolic enzymes, and proteins involved in the starvation and oxidative stress responses have been identified as substrates .    The N-terminal domain of ClpX is a C4-type zinc binding domain (ZBD) involved in substrate recognition. ZBD forms a very stable dimer that is essential for promoting the degradation of some typical ClpXP substrates such as lO and MuA .  ; GO: 0005515 protein binding, 0005524 ATP binding, 0016887 ATPase activity, 0015031 protein transport.
Probab=98.38  E-value=6.5e-07  Score=68.83  Aligned_cols=74  Identities=34%  Similarity=0.561  Sum_probs=59.8

Q ss_pred             CCCCEEEECCCCCHHHHHHHHHHHHHHCCCCCHHHHEEEEEEEEHHHHHCCCCCCCH-HHHHHHHHHHHH----CCCCCE
Q ss_conf             778748966764116689999999985489883452014455404675306343123-789999999872----038983
Q gi|254780163|r  224 SKNNPLYVGDPGVGKTAIAEGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGD-FEERIKKIVKEI----ESYANA  298 (798)
Q Consensus       224 ~KNn~~lvG~~gvGktaive~la~~i~~~~vp~~l~~~~i~~ld~~~l~ag~~~rg~-fe~r~~~~~~~~----~~~~~~  298 (798)
                      .|+|.+||||.|-|||=+++-||+.+   +||-...|.+       + +.=|.|.|| -|.=|..+|...    .++.+=
T Consensus       151 ~KSNILLiGPTGSGKTLLAqTLA~~L---~VPfAiADAT-------t-LTEAGYVGEDVENIL~~Llq~ad~DV~kA~kG  219 (452)
T TIGR00382       151 SKSNILLIGPTGSGKTLLAQTLARIL---NVPFAIADAT-------T-LTEAGYVGEDVENILLKLLQAADYDVEKAQKG  219 (452)
T ss_pred             HCCCEEEECCCCCCHHHHHHHHHHHC---CCCEEECCHH-------H-HHCCCCCCCCHHHHHHHHHHHCCCCHHHHCCC
T ss_conf             00662454688852689999999873---8874211111-------0-20066424228899999987414552452785


Q ss_pred             EEEECCHHHH
Q ss_conf             9997361663
Q gi|254780163|r  299 ILYIDEIHTL  308 (798)
Q Consensus       299 ilfideih~l  308 (798)
                      |.|||||-=|
T Consensus       220 IiYIDEIDKI  229 (452)
T TIGR00382       220 IIYIDEIDKI  229 (452)
T ss_pred             EEEEECCCCH
T ss_conf             0898422310


No 237
>COG0470 HolB ATPase involved in DNA replication [DNA replication, recombination, and repair]
Probab=98.38  E-value=1.7e-06  Score=65.82  Aligned_cols=169  Identities=24%  Similarity=0.310  Sum_probs=93.3

Q ss_pred             HHHHHHHHHHHHHHHH-CCCCCC-EEEECCCCCHHHHHHHHHHHHHHCCCCCHHHH---------------EEEEEEEEH
Q ss_conf             2217899999999862-267787-48966764116689999999985489883452---------------014455404
Q gi|254780163|r  206 LVGRHEEINRTIQILC-RRSKNN-PLYVGDPGVGKTAIAEGFAKQIVDGMVPDILL---------------GARIFSLDM  268 (798)
Q Consensus       206 VIGRd~EI~riiqIL~-RR~KNn-~~lvG~~gvGktaive~la~~i~~~~vp~~l~---------------~~~i~~ld~  268 (798)
                      ++|-+..+.++..-.. ..+-.+ -++.|+||+|||+.+..||..+...... ...               ...+++++.
T Consensus         3 ~~~~~~~~~~l~~~~~~~~~~~halL~~Gp~G~Gktt~a~~lA~~l~~~~~~-~~~~~~~~~~~~~~~~~~~~d~lel~~   81 (325)
T COG0470           3 LVPWQEAVKRLLVQALESGRLPHALLFYGPPGVGKTTAALALAKELLCENPT-GLLPCGHCRSCKLIPAGNHPDFLELNP   81 (325)
T ss_pred             CCCCHHHHHHHHHHHHHCCCCCCCEEEECCCCCCHHHHHHHHHHHHCCCCCC-CCCCCCHHHHHHHHCCCCCCCEEEECC
T ss_conf             4332358999999998658887610037999997899999999996586643-345520022444320256886599773


Q ss_pred             HHHHCCCCCCCHHHHHHHHHHHHHCCC----CCEEEEECCHHHHHCCCCCCCCCCCHHHHHHHHHC--CCCEEEEEECCH
Q ss_conf             675306343123789999999872038----98399973616630155444344777888876630--266038873048
Q gi|254780163|r  269 GNLIAGTRYRGDFEERIKKIVKEIESY----ANAILYIDEIHTLVGAGSASGISVDASNLLKPALS--SGAVRCIGSTTY  342 (798)
Q Consensus       269 ~~l~ag~~~rg~fe~r~~~~~~~~~~~----~~~ilfideih~ligag~~~g~~~d~an~lkP~L~--rg~~~~IgatT~  342 (798)
                      ...    +...-..+.++.+.+.....    +.-|.+|||+..|         +.||+|.|...+.  ....++|-.|. 
T Consensus        82 s~~----~~~~i~~~~vr~~~~~~~~~~~~~~~kviiidead~m---------t~~A~nallk~lEep~~~~~~il~~n-  147 (325)
T COG0470          82 SDL----RKIDIIVEQVRELAEFLSESPLEGGYKVVIIDEADKL---------TEDAANALLKTLEEPPKNTRFILITN-  147 (325)
T ss_pred             CCC----CCCCCHHHHHHHHHHHCCCCCCCCCCEEEEEECCCCC---------CHHHHHHHHHHCCCCCCCEEEEEEEC-
T ss_conf             213----3330069999999986044656677269997320326---------98888767543324888716999749-


Q ss_pred             HHHHHHHHCCHHHHHHCEEEEECCCCHHHHHHHHHHHHHHHHHHCCCEECCHHHHHHHHHHHHHCC
Q ss_conf             999998520111432001443068786899999986127665410351211178999998654201
Q gi|254780163|r  343 SEYRQFFEKDKALVRRFQKIDVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFT  408 (798)
Q Consensus       343 ~ey~~~~e~d~al~rrF~~i~v~ep~~~~~~~iL~~~~~~ye~~h~v~~~~~al~~av~ls~ryi~  408 (798)
                       .+.+.+.   -+..|-+.+.+..|+....+..+.               ++++...+..+...+.
T Consensus       148 -~~~~il~---tI~SRc~~i~f~~~~~~~~i~~~e---------------~~~l~~i~~~~~gd~r  194 (325)
T COG0470         148 -DPSKILP---TIRSRCQRIRFKPPSRLEAIAWLE---------------DQGLEEIAAVAEGDAR  194 (325)
T ss_pred             -CHHHCHH---HHHHHEEEEECCCCCHHHHHHHHH---------------HHHHHHHHHHHCCHHH
T ss_conf             -8555647---877560788767741889999850---------------7579999987040688


No 238
>smart00382 AAA ATPases associated with a variety of cellular activities. AAA - ATPases associated with a variety of cellular activities. This profile/alignment only detects a fraction of this vast family. The poorly conserved N-terminal helix is missing from the alignment.
Probab=98.37  E-value=3.6e-06  Score=63.46  Aligned_cols=126  Identities=23%  Similarity=0.266  Sum_probs=76.0

Q ss_pred             CCCEEEECCCCCHHHHHHHHHHHHHHCCCCCHHHHEEEEEEEEHHHHHCCCCC------------CCHHHHHHHHHHHHH
Q ss_conf             78748966764116689999999985489883452014455404675306343------------123789999999872
Q gi|254780163|r  225 KNNPLYVGDPGVGKTAIAEGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRY------------RGDFEERIKKIVKEI  292 (798)
Q Consensus       225 KNn~~lvG~~gvGktaive~la~~i~~~~vp~~l~~~~i~~ld~~~l~ag~~~------------rg~fe~r~~~~~~~~  292 (798)
                      .++.+++|+||+|||+++..+|..+....       ..++.++..........            -..-+..+..++..+
T Consensus         2 ~~~ill~G~~GsGKTtl~~~la~~~~~~~-------~~v~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~   74 (148)
T smart00382        2 GEVILIVGPPGSGKTTLARALARELGPPG-------GGVIYIDGEDILEEVLDQLLLIIVGGKKASGSGELRLRLALALA   74 (148)
T ss_pred             CCEEEEECCCCHHHHHHHHHHHHHHCCCC-------CCEEEEEHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHHHHHHHH
T ss_conf             97899999997029999999998726689-------96899875998988898765300011221051999999999999


Q ss_pred             CCCCCEEEEECCHHHHHCCCCCCCCC-CCHHHHHHHHHCCCCEEEEEECCHHHHHHHHHCCHHHHHHCEE
Q ss_conf             03898399973616630155444344-7778888766302660388730489999985201114320014
Q gi|254780163|r  293 ESYANAILYIDEIHTLVGAGSASGIS-VDASNLLKPALSSGAVRCIGSTTYSEYRQFFEKDKALVRRFQK  361 (798)
Q Consensus       293 ~~~~~~ilfideih~ligag~~~g~~-~d~an~lkP~L~rg~~~~IgatT~~ey~~~~e~d~al~rrF~~  361 (798)
                      +.....|+||||++.+.......... ........+......+.+|+++.+    ........+.+||+.
T Consensus        75 ~~~~~~viiiDei~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~vi~~~n~----~~~~~~~~~~~~~~~  140 (148)
T smart00382       75 RKLKPDVLILDEITSLLDAEQEALLLLLEELRLLLLLKSEKNLTVILTTND----EKDLGPALLRRRFDR  140 (148)
T ss_pred             HHCCCCEEEEECCHHHCCCCCHHHHHHHHHHHHHCCCCCCCCEEEEEEECC----CCCCCHHHHCCCCCE
T ss_conf             844998999827502147620799999999998517657899899995699----522498770744787


No 239
>PRK11331 5-methylcytosine-specific restriction enzyme subunit McrB; Provisional
Probab=98.35  E-value=2.4e-06  Score=64.71  Aligned_cols=213  Identities=21%  Similarity=0.335  Sum_probs=113.9

Q ss_pred             CCCCCEEEEECCCCHHHHHHHHHHHHHC--CCCEEEEEHHHHHCCCCCCHHC-CCCCHHCCCC-CCCCC---CHHHHHCC
Q ss_conf             7874068861432003889999987304--7733772068861246530110-4780002564-44310---03555158
Q gi|254780163|r  504 NKPIGCYVFSGPTGVGKTEISKQLAFAL--GVQLLRFDMSEYMERHAVSRLI-GAPPGYVGFG-QGGIL---ADSVDQNP  576 (798)
Q Consensus       504 ~rP~g~flf~GptGvGKTelak~la~~~--~~~lir~dmsey~e~~~vs~Li-GappGYvG~~-egg~L---te~vr~~P  576 (798)
                      .||-  ..+.||+|||||.+||.||+.+  ++.--|+.|-.|-...|-.-.+ |=-|.=.||. ..|.+   +++-+++|
T Consensus       193 tKkn--vIL~G~pGtGKT~lAk~lA~~l~g~~~~~rv~~VqfhpsysYEDfi~Gyrp~~~gf~~~~G~f~~~~~~A~~~p  270 (459)
T PRK11331        193 IKKN--IILQGPPGVGKTFVARRLAYLLTGEKAPQRVNMVQFHQSYSYEDFIQGYRPNGVGFRRKDGIFYNFCQQAKEQP  270 (459)
T ss_pred             CCCC--EEEECCCCCCHHHHHHHHHHHHHCCCCCCCEEEEEECCCCCHHHHHCCCCCCCCCCEECCCHHHHHHHHHHHCC
T ss_conf             5882--79658999887899999999970788778468998358866178764605688861326836999999998498


Q ss_pred             --CEEEEECCHHHCCHH-HHHHHHHHHHHHHCCC--------CC--CCEEC-CCCEEEEEECCCCHHHHHHCCCCCCCCC
Q ss_conf             --517774044550289-9999999877750217--------79--97761-2542999942421455330368988211
Q gi|254780163|r  577 --YSVVLLDEIEKSHPD-VLNILLQIMDYGILTD--------QS--GKKIS-FRNVILIMTTNAGALEMSKARIGFGSSR  642 (798)
Q Consensus       577 --~sVvl~DEiEKAh~~-v~~~llqild~G~ltd--------~~--Gr~vd-f~n~iii~TsN~G~~~~~~~~~g~~~~~  642 (798)
                        ..|+++|||-.|+.. +|-=||-+++.-.=.+        +.  |.... =.|..||-|-|..-+-+           
T Consensus       271 ~~~y~~iideinr~~~~~~fgel~~liE~dkR~~~~~~~l~ys~~~~~~f~vP~Nl~iigtmNtadrs~-----------  339 (459)
T PRK11331        271 EKKYVFIIDEINRANLSKVFGEVMMLMEHDKRGENWSVPLTYSENDEERFYVPENVYIIGLMNTADRSL-----------  339 (459)
T ss_pred             CCCEEEEEEHHHCCCHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCCEECCCCCEEEEEECCCCCHHH-----------
T ss_conf             987699984320338899999999996412567652256300368885334688659998503341068-----------


Q ss_pred             CHHHHHHHHHHHCCHHHHCCCCE--EEECCC------CCHHHHHHHHHHHHHHHHHHHHH------CCCEEEECHHHHHH
Q ss_conf             14889999987288788177682--896288------99999999999999999999986------69889998899999
Q gi|254780163|r  643 NDDADKEALRNFLSPEFLNRLDS--IIPFFP------LSSDIIRQVVHKFIMKLELQLQE------KGISFHFSEEVINW  708 (798)
Q Consensus       643 ~~~~~~~~l~~~f~peflnRid~--ii~F~~------l~~~~~~~i~~~~l~~l~~~l~~------~~i~l~~~~~~~~~  708 (798)
                        ..+.-+|++.|.  |+.-..+  +.-|..      .... +..-+...+..|++++.+      ++..+  --+   |
T Consensus       340 --~~~d~alrRrf~--f~~~~pd~d~~~~~~~l~~~~~~~~-~~~~l~~~l~~LN~rI~~de~lLgrd~~I--GHS---Y  409 (459)
T PRK11331        340 --AVVDYALRRRFS--FIDIEPGFDTPQFRNFLLNKKAEPS-FVESLCQKMNELNQEISKEATILGKGFRI--GHS---Y  409 (459)
T ss_pred             --HHHHHHHHHHHC--CEECCCCCCHHHHHHHHHHCCCCHH-HHHHHHHHHHHHHHHHHHCCCCCCCCCEE--CHH---H
T ss_conf             --878999986502--1215898660555433320343314-79999999999999986321137998772--103---2


Q ss_pred             HHHCCCC-CCCCCHHHHHHHHHHHHHHHHHHH
Q ss_conf             9971898-101532679999986235999999
Q gi|254780163|r  709 LVSHGYD-VKMGARPLERIIKEHVKVPLADEI  739 (798)
Q Consensus       709 l~~~~~~-~~~GAR~l~r~i~~~i~~~la~~i  739 (798)
                      +....-. ..-...-++++++..|.+.|-+..
T Consensus       410 F~~~~~~~~~~~~~~L~~I~~~eIiPLLqEYf  441 (459)
T PRK11331        410 FCCGLEDGTSPDTQWLREIVMTDIAPLLEEYF  441 (459)
T ss_pred             HCCCCCCCCCHHHHHHHHHHHHCHHHHHHHHC
T ss_conf             06665556643689999999853278778870


No 240
>COG3283 TyrR Transcriptional regulator of aromatic amino acids metabolism [Transcription / Amino acid transport and metabolism]
Probab=98.35  E-value=6.1e-05  Score=54.68  Aligned_cols=217  Identities=21%  Similarity=0.319  Sum_probs=147.2

Q ss_pred             HHHHCHHHHHHHHHHHHHHHHCCCCCCCCCCCEEEEECCCCHHHHHHHHHHHH---HCCCCEEEEEHHHHHCCCCCCHHC
Q ss_conf             66534589999999998775204456578740688614320038899999873---047733772068861246530110
Q gi|254780163|r  477 TVVYGQEEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAF---ALGVQLLRFDMSEYMERHAVSRLI  553 (798)
Q Consensus       477 ~~v~GQ~~ai~~v~~~i~~~~~gl~~~~rP~g~flf~GptGvGKTelak~la~---~~~~~lir~dmsey~e~~~vs~Li  553 (798)
                      +.++++...+..+...-++. | .-  +.|   +|..|-||+||--+||+--.   -..++++-+||.-.-|..+-|.|.
T Consensus       204 ~~~v~~S~~mk~~v~qA~k~-A-ml--DAP---LLI~GeTGTGKdLlAkaCH~~S~R~~~pFlalNCA~lPe~~aEsElF  276 (511)
T COG3283         204 EQIVAVSPKMKHVVEQAQKL-A-ML--DAP---LLITGETGTGKDLLAKACHLASPRHSKPFLALNCASLPEDAAESELF  276 (511)
T ss_pred             HHHHHCCHHHHHHHHHHHHH-H-CC--CCC---EEEECCCCCHHHHHHHHHHHCCCCCCCCEEEEECCCCCHHHHHHHHH
T ss_conf             77873039999999999865-4-03--787---68744888618899998744384558973676447796667677773


Q ss_pred             CCCCH---HCCCCCCCCCCHHHHHCCCEEEEECCHHHCCHHHHHHHHHHHHHHHCCCCCCCEECCCCEEEEEECCCCHHH
Q ss_conf             47800---025644431003555158517774044550289999999987775021779977612542999942421455
Q gi|254780163|r  554 GAPPG---YVGFGQGGILADSVDQNPYSVVLLDEIEKSHPDVLNILLQIMDYGILTDQSGKKISFRNVILIMTTNAGALE  630 (798)
Q Consensus       554 GappG---YvG~~egg~Lte~vr~~P~sVvl~DEiEKAh~~v~~~llqild~G~ltd~~Gr~vdf~n~iii~TsN~G~~~  630 (798)
                      |--||   |+|+=|         +..-.-||+|||---.|..+--||.-|.||+..---+.+--.-|.=+|+||-.--.+
T Consensus       277 G~apg~~gk~GffE---------~AngGTVlLDeIgEmSp~lQaKLLRFL~DGtFRRVGee~Ev~vdVRVIcatq~nL~~  347 (511)
T COG3283         277 GHAPGDEGKKGFFE---------QANGGTVLLDEIGEMSPRLQAKLLRFLNDGTFRRVGEDHEVHVDVRVICATQVNLVE  347 (511)
T ss_pred             CCCCCCCCCCCHHH---------HCCCCEEEEEHHHHCCHHHHHHHHHHHCCCCCCCCCCCCEEEEEEEEEECCCCCHHH
T ss_conf             56888777634634---------026974885003324998999999986277600037754578778999616666999


Q ss_pred             HHHCCCCCCCCCCHHHHHHHHHHHCCHHHHCCCCEE-EECCCC--CHHHHHHHHHHHHHHHHHHHHHCCCEEEECHHHHH
Q ss_conf             330368988211148899999872887881776828-962889--99999999999999999999866988999889999
Q gi|254780163|r  631 MSKARIGFGSSRNDDADKEALRNFLSPEFLNRLDSI-IPFFPL--SSDIIRQVVHKFIMKLELQLQEKGISFHFSEEVIN  707 (798)
Q Consensus       631 ~~~~~~g~~~~~~~~~~~~~l~~~f~peflnRid~i-i~F~~l--~~~~~~~i~~~~l~~l~~~l~~~~i~l~~~~~~~~  707 (798)
                      +                  .-+..|+-.++-|+... +-.-||  ...++.-++..++.+....+.-  -.-.+++....
T Consensus       348 l------------------v~~g~fReDLfyRLNVLtl~~PpLRer~~di~pL~e~Fv~q~s~elg~--p~pkl~~~~~~  407 (511)
T COG3283         348 L------------------VQKGKFREDLFYRLNVLTLNLPPLRERPQDIMPLAELFVQQFSDELGV--PRPKLAADLLT  407 (511)
T ss_pred             H------------------HHCCCHHHHHHHHHHEEEECCCCCCCCCCCCHHHHHHHHHHHHHHHCC--CCCCCCHHHHH
T ss_conf             9------------------863725887887750134238850006521068999999999997589--98766878999


Q ss_pred             HHHHCCCCCCCCCHHHHHHHHHHH
Q ss_conf             999718981015326799999862
Q gi|254780163|r  708 WLVSHGYDVKMGARPLERIIKEHV  731 (798)
Q Consensus       708 ~l~~~~~~~~~GAR~l~r~i~~~i  731 (798)
                      +|.+.++--  .-|.|+.+|-+-+
T Consensus       408 ~L~~y~WpG--NVRqL~N~iyRA~  429 (511)
T COG3283         408 VLTRYAWPG--NVRQLKNAIYRAL  429 (511)
T ss_pred             HHHHCCCCC--CHHHHHHHHHHHH
T ss_conf             998779996--0999999999999


No 241
>pfam08298 AAA_PrkA PrkA AAA domain. This is a family of PrkA bacterial and archaeal serine kinases approximately 630 residues long. This is the N-terminal AAA domain.
Probab=98.35  E-value=1.6e-05  Score=58.88  Aligned_cols=109  Identities=21%  Similarity=0.192  Sum_probs=67.4

Q ss_pred             EEEEECCHHHCCHHHHHHHHHHHHHHHCC-CCCCCEECCCCEEEEEECCCCHHHHHHCCCCCCCCCCHHHHHHHHHHHCC
Q ss_conf             17774044550289999999987775021-77997761254299994242145533036898821114889999987288
Q gi|254780163|r  578 SVVLLDEIEKSHPDVLNILLQIMDYGILT-DQSGKKISFRNVILIMTTNAGALEMSKARIGFGSSRNDDADKEALRNFLS  656 (798)
Q Consensus       578 sVvl~DEiEKAh~~v~~~llqild~G~lt-d~~Gr~vdf~n~iii~TsN~G~~~~~~~~~g~~~~~~~~~~~~~l~~~f~  656 (798)
                      .++=|-|+=|++.+++.-||.+-++|... ++..-.++|- .+||-+|| -++.-.     |            ....+-
T Consensus       235 Gl~efvE~~K~~~~~L~~lL~atQE~~i~~~~~~~~i~~D-~vIiahsN-e~E~~~-----f------------~~~~~~  295 (358)
T pfam08298       235 GLMEFVEMFKAPIKVLHPLLTATQEGNYNSTEKFSAIPFD-GIILAHSN-ESEWNS-----F------------KSNKNN  295 (358)
T ss_pred             CCEEEHHHHCCCHHHHHHHHCCCCCCCCCCCCCCCCEECC-EEEECCCC-HHHHHH-----H------------HCCCCC
T ss_conf             7554098761829999998522124622477875603314-26876898-499998-----7------------448643


Q ss_pred             HHHHCCCCEEEECCCCCHHHHHHHHHHHHHHHHHHHHHCCCEEEECHHHHHHHHH
Q ss_conf             7881776828962889999999999999999999998669889998899999997
Q gi|254780163|r  657 PEFLNRLDSIIPFFPLSSDIIRQVVHKFIMKLELQLQEKGISFHFSEEVINWLVS  711 (798)
Q Consensus       657 peflnRid~ii~F~~l~~~~~~~i~~~~l~~l~~~l~~~~i~l~~~~~~~~~l~~  711 (798)
                      ..|+.|+..|=+=.-|.-.+=.+|.++.+.+-.  +    ....+.|.+++..+.
T Consensus       296 eA~~dR~~~v~vPY~lr~~eE~kIY~k~l~~s~--~----~~~h~APhtl~~aa~  344 (358)
T pfam08298       296 EAFLDRIVVIKVPYCLRVSEEIKIYEKLLKESE--L----ADAHCAPHTLEVAAM  344 (358)
T ss_pred             HHHHCCEEEEECCCCCCHHHHHHHHHHHHHHCC--C----CCCCCCCCHHHHHHH
T ss_conf             466563799967632671789999999863044--6----677829648999999


No 242
>KOG0734 consensus
Probab=98.35  E-value=9.8e-07  Score=67.56  Aligned_cols=95  Identities=29%  Similarity=0.467  Sum_probs=65.8

Q ss_pred             HHHHCHHHHHHHHHHHHH-------HHHCCCCCCCCCCCEEEEECCCCHHHHHHHHHHHHHCCCCEEEEEHHHHHCCCCC
Q ss_conf             665345899999999987-------7520445657874068861432003889999987304773377206886124653
Q gi|254780163|r  477 TVVYGQEEAIKKLSSSIK-------IARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFALGVQLLRFDMSEYMERHAV  549 (798)
Q Consensus       477 ~~v~GQ~~ai~~v~~~i~-------~~~~gl~~~~rP~g~flf~GptGvGKTelak~la~~~~~~lir~dmsey~e~~~v  549 (798)
                      +-|-|-|+|-..+-+.+-       -.+.|=+   =|-|+ |++||+|+|||.||++.|-.-+.+|..---|||-|-   
T Consensus       304 ~dVkG~DEAK~ELeEiVefLkdP~kftrLGGK---LPKGV-LLvGPPGTGKTlLARAvAGEA~VPFF~~sGSEFdEm---  376 (752)
T KOG0734         304 EDVKGVDEAKQELEEIVEFLKDPTKFTRLGGK---LPKGV-LLVGPPGTGKTLLARAVAGEAGVPFFYASGSEFDEM---  376 (752)
T ss_pred             CCCCCHHHHHHHHHHHHHHHCCCHHHHHCCCC---CCCCE-EEECCCCCCHHHHHHHHHCCCCCCEEECCCCCHHHH---
T ss_conf             02147278999999999986090876431475---88853-876899975569999860556897474166204454---


Q ss_pred             CHHCCCCCHHCCCCCC--CCCCHHHHHCCCEEEEECCHHH
Q ss_conf             0110478000256444--3100355515851777404455
Q gi|254780163|r  550 SRLIGAPPGYVGFGQG--GILADSVDQNPYSVVLLDEIEK  587 (798)
Q Consensus       550 s~LiGappGYvG~~eg--g~Lte~vr~~P~sVvl~DEiEK  587 (798)
                               |||-+.-  --|..+-+.+--|||+.|||+-
T Consensus       377 ---------~VGvGArRVRdLF~aAk~~APcIIFIDEiDa  407 (752)
T KOG0734         377 ---------FVGVGARRVRDLFAAAKARAPCIIFIDEIDA  407 (752)
T ss_pred             ---------HHCCCHHHHHHHHHHHHHCCCEEEEEECHHH
T ss_conf             ---------2201489999999998734985999720022


No 243
>COG1219 ClpX ATP-dependent protease Clp, ATPase subunit [Posttranslational modification, protein turnover, chaperones]
Probab=98.33  E-value=1.7e-05  Score=58.65  Aligned_cols=167  Identities=26%  Similarity=0.406  Sum_probs=100.9

Q ss_pred             CCCCEEEECCCCCHHHHHHHHHHHHHHCCCCCHHHHEEEEEEEEHHHHHCCCCCCCH-HHHHHHHHHHHH----CCCCCE
Q ss_conf             778748966764116689999999985489883452014455404675306343123-789999999872----038983
Q gi|254780163|r  224 SKNNPLYVGDPGVGKTAIAEGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGD-FEERIKKIVKEI----ESYANA  298 (798)
Q Consensus       224 ~KNn~~lvG~~gvGktaive~la~~i~~~~vp~~l~~~~i~~ld~~~l~ag~~~rg~-fe~r~~~~~~~~----~~~~~~  298 (798)
                      .|+|.+|||+.|.|||-+++-||+.+   +||-...+..-        +.-+.|.|| -|.-+..++..+    .++..=
T Consensus        96 ~KSNILLiGPTGsGKTlLAqTLAk~L---nVPFaiADATt--------LTEAGYVGEDVENillkLlqaadydV~rAerG  164 (408)
T COG1219          96 SKSNILLIGPTGSGKTLLAQTLAKIL---NVPFAIADATT--------LTEAGYVGEDVENILLKLLQAADYDVERAERG  164 (408)
T ss_pred             EECCEEEECCCCCCHHHHHHHHHHHH---CCCEEECCCCC--------HHHCCCCCHHHHHHHHHHHHHCCCCHHHHHCC
T ss_conf             20317998889975779999999984---89847514441--------21066355008999999998764588888288


Q ss_pred             EEEECCHHHHHCCCCCCCCC----------------------------------------CCHHHHH-----------HH
Q ss_conf             99973616630155444344----------------------------------------7778888-----------76
Q gi|254780163|r  299 ILYIDEIHTLVGAGSASGIS----------------------------------------VDASNLL-----------KP  327 (798)
Q Consensus       299 ilfideih~ligag~~~g~~----------------------------------------~d~an~l-----------kP  327 (798)
                      |.|||||.-|-  -.+++.|                                        +|-+|+|           |=
T Consensus       165 IIyIDEIDKIa--rkSen~SITRDVSGEGVQQALLKiiEGTvasVPPqGGRKHP~Qe~iqvDT~NILFIcgGAF~Gleki  242 (408)
T COG1219         165 IIYIDEIDKIA--RKSENPSITRDVSGEGVQQALLKIIEGTVASVPPQGGRKHPQQEFIQVDTSNILFICGGAFAGLEKI  242 (408)
T ss_pred             EEEEECHHHHH--CCCCCCCCCCCCCCHHHHHHHHHHHCCCEECCCCCCCCCCCCCCEEEECCCCEEEEECCCCCCHHHH
T ss_conf             59985102542--0578987234367358999999997075102399988879842048873763467824401039999


Q ss_pred             HHCCCCEEEEEEC----------CHHHHHHHHHCCH--------HHHHHCEE-EEECCCCHHHHHHHHH----HHHHHHH
Q ss_conf             6302660388730----------4899999852011--------14320014-4306878689999998----6127665
Q gi|254780163|r  328 ALSSGAVRCIGST----------TYSEYRQFFEKDK--------ALVRRFQK-IDVSEPSIEDAIEIVK----GIKPYFE  384 (798)
Q Consensus       328 ~L~rg~~~~Igat----------T~~ey~~~~e~d~--------al~rrF~~-i~v~ep~~~~~~~iL~----~~~~~ye  384 (798)
                      .-.|..-+.||-.          +..++-+.+|.|-        -|--|+-. ..+++.+.++-++||.    .+-..|+
T Consensus       243 I~~R~~~~~iGF~a~~~~~~~~~~~~~~l~~vepeDLvkFGLIPEfIGRlPvia~L~~Lde~aLv~ILtePkNAlvKQYq  322 (408)
T COG1219         243 IKKRLGKKGIGFGAEVKSKSKKKEEGELLKQVEPEDLVKFGLIPEFIGRLPVIATLEELDEDALVQILTEPKNALVKQYQ  322 (408)
T ss_pred             HHHHCCCCCCCCCCCCCCHHHHHHHHHHHHHCCHHHHHHCCCCHHHHCCCCEEEEHHHCCHHHHHHHHHCCCHHHHHHHH
T ss_conf             99862687424566445344441288998754868788708838872666326461015999999997265178999999


Q ss_pred             HHC-----CCEECCHHHHHHHHHH
Q ss_conf             410-----3512111789999986
Q gi|254780163|r  385 EHH-----QLRYSKEAIRAAVQLS  403 (798)
Q Consensus       385 ~~h-----~v~~~~~al~~av~ls  403 (798)
                      .-.     ...|+++||.+.++.+
T Consensus       323 ~Lf~~d~V~L~F~~~AL~~IA~~A  346 (408)
T COG1219         323 KLFEMDGVELEFTEEALKAIAKKA  346 (408)
T ss_pred             HHHCCCCCEEEECHHHHHHHHHHH
T ss_conf             996446916997489999999999


No 244
>pfam01695 IstB IstB-like ATP binding protein. This protein contains an ATP/GTP binding P-loop motif. It is found associated with IS21 family insertion sequences. The function of this protein is unknown, but it may perform a transposase function.
Probab=98.32  E-value=3.3e-06  Score=63.77  Aligned_cols=101  Identities=23%  Similarity=0.351  Sum_probs=55.3

Q ss_pred             EEEEECCCCHHHHHHHHHHHH---HCCCCEEEEEHHHHHCCCCCCHHCCCCCHHCCCCCCCCCCHHHH-HCCCEEEEECC
Q ss_conf             688614320038899999873---04773377206886124653011047800025644431003555-15851777404
Q gi|254780163|r  509 CYVFSGPTGVGKTEISKQLAF---ALGVQLLRFDMSEYMERHAVSRLIGAPPGYVGFGQGGILADSVD-QNPYSVVLLDE  584 (798)
Q Consensus       509 ~flf~GptGvGKTelak~la~---~~~~~lir~dmsey~e~~~vs~LiGappGYvG~~egg~Lte~vr-~~P~sVvl~DE  584 (798)
                      +++|.||+|+|||.||.+++.   ..+.+..-+.++++.+.-..++-           ++ .+.+.++ -.-.-|+++||
T Consensus        49 Nlll~G~~GtGKThLA~Ai~~~~~~~g~~v~f~~~~~L~~~l~~~~~-----------~~-~~~~~l~~~~~~dlLIiDD  116 (178)
T pfam01695        49 NLLLLGPPGVGKTHLACALGHQACRAGYSVLFTRTPDLVEQLKRARG-----------DG-RLARTLQRLAKADLLILDD  116 (178)
T ss_pred             CEEEECCCCCCHHHHHHHHHHHHHHCCCEEEEEECHHHHHHHHHHHH-----------CC-CHHHHHHHHHCCCEEEEEH
T ss_conf             68998999987899999999999986985999961679999998752-----------67-4999999962589788720


Q ss_pred             HH--HCCHHHHHHHHHHHHHHHCCCCCCCEECCCCEEEEEECCCCHHHHH
Q ss_conf             45--5028999999998777502177997761254299994242145533
Q gi|254780163|r  585 IE--KSHPDVLNILLQIMDYGILTDQSGKKISFRNVILIMTTNAGALEMS  632 (798)
Q Consensus       585 iE--KAh~~v~~~llqild~G~ltd~~Gr~vdf~n~iii~TsN~G~~~~~  632 (798)
                      +=  +..+.-.++|++++++-.     +++     . +|.|||....+..
T Consensus       117 lG~~~~s~~~~~~lf~li~~Ry-----e~~-----s-tIiTSN~~~~~W~  155 (178)
T pfam01695       117 IGYLPLSQEAAHLLFELISDRY-----ERR-----S-TILTSNLPFGEWH  155 (178)
T ss_pred             HCCCCCCHHHHHHHHHHHHHHH-----CCC-----C-EEEECCCCHHHHH
T ss_conf             0165689899999999999997-----568-----8-6877689978998


No 245
>KOG0744 consensus
Probab=98.32  E-value=1.2e-05  Score=59.68  Aligned_cols=139  Identities=29%  Similarity=0.463  Sum_probs=86.4

Q ss_pred             CCCCCCCCCEEEEECCCCHHHHHHHHHHHHHC---------CCCEEEEEH-HHHHCCCCCCHHCCCCCHHCCCCCCCCCC
Q ss_conf             45657874068861432003889999987304---------773377206-88612465301104780002564443100
Q gi|254780163|r  500 LSDPNKPIGCYVFSGPTGVGKTEISKQLAFAL---------GVQLLRFDM-SEYMERHAVSRLIGAPPGYVGFGQGGILA  569 (798)
Q Consensus       500 l~~~~rP~g~flf~GptGvGKTelak~la~~~---------~~~lir~dm-sey~e~~~vs~LiGappGYvG~~egg~Lt  569 (798)
                      |-.-||   ..|+-||+|+|||-|+|+||.-+         ..-||-++. |=|      ||-         |.|.|.|.
T Consensus       173 lIt~NR---liLlhGPPGTGKTSLCKaLaQkLSIR~~~~y~~~~liEinshsLF------SKW---------FsESgKlV  234 (423)
T KOG0744         173 LITWNR---LILLHGPPGTGKTSLCKALAQKLSIRTNDRYYKGQLIEINSHSLF------SKW---------FSESGKLV  234 (423)
T ss_pred             EEEEEE---EEEEECCCCCCHHHHHHHHHHHHEEEECCCCCCCEEEEEEHHHHH------HHH---------HHHHHHHH
T ss_conf             466414---899857999882279999987514652376444069997046788------988---------71211389


Q ss_pred             HHH--------HH-CCCEEEEECCHHHC---C--------H----HHHHHHHHHHHHHHCCCCCCCEECCCCEEEEEECC
Q ss_conf             355--------51-58517774044550---2--------8----99999999877750217799776125429999424
Q gi|254780163|r  570 DSV--------DQ-NPYSVVLLDEIEKS---H--------P----DVLNILLQIMDYGILTDQSGKKISFRNVILIMTTN  625 (798)
Q Consensus       570 e~v--------r~-~P~sVvl~DEiEKA---h--------~----~v~~~llqild~G~ltd~~Gr~vdf~n~iii~TsN  625 (798)
                      .++        .- .-.--||.||+|--   .        |    .|.|.+|.-+|  +       --...|.+|+.|||
T Consensus       235 ~kmF~kI~ELv~d~~~lVfvLIDEVESLa~aR~s~~S~~EpsDaIRvVNalLTQlD--r-------lK~~~NvliL~TSN  305 (423)
T KOG0744         235 AKMFQKIQELVEDRGNLVFVLIDEVESLAAARTSASSRNEPSDAIRVVNALLTQLD--R-------LKRYPNVLILATSN  305 (423)
T ss_pred             HHHHHHHHHHHHCCCCEEEEEEHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHH--H-------HCCCCCEEEEECCC
T ss_conf             99999999997178968999807878889998754137998218999999999899--8-------60479779996262


Q ss_pred             CCHHHHHHCCCCCCCCCCHHHHHHHHHHHCCHHHHCCCCEEEECCCCCHHHHHHHHHHHHHHHHH
Q ss_conf             21455330368988211148899999872887881776828962889999999999999999999
Q gi|254780163|r  626 AGALEMSKARIGFGSSRNDDADKEALRNFLSPEFLNRLDSIIPFFPLSSDIIRQVVHKFIMKLEL  690 (798)
Q Consensus       626 ~G~~~~~~~~~g~~~~~~~~~~~~~l~~~f~peflnRid~ii~F~~l~~~~~~~i~~~~l~~l~~  690 (798)
                      +-..                     +.    -.|+.|-|-+..-.|-+...+..|..-.+.++..
T Consensus       306 l~~s---------------------iD----~AfVDRADi~~yVG~Pt~~ai~~IlkscieEL~~  345 (423)
T KOG0744         306 LTDS---------------------ID----VAFVDRADIVFYVGPPTAEAIYEILKSCIEELIS  345 (423)
T ss_pred             HHHH---------------------HH----HHHHHHHHHEEECCCCCHHHHHHHHHHHHHHHHH
T ss_conf             6777---------------------78----8861175421103896399999999999999986


No 246
>KOG2004 consensus
Probab=98.32  E-value=2.3e-05  Score=57.67  Aligned_cols=180  Identities=26%  Similarity=0.462  Sum_probs=119.6

Q ss_pred             HHHHHHHHHHHHHHHH-CCCCCC-----EEEECCCCCHHHHHHHHHHHHHHCCCCCHHHHEEEEEEEEHHHHH--C---C
Q ss_conf             2217899999999862-267787-----489667641166899999999854898834520144554046753--0---6
Q gi|254780163|r  206 LVGRHEEINRTIQILC-RRSKNN-----PLYVGDPGVGKTAIAEGFAKQIVDGMVPDILLGARIFSLDMGNLI--A---G  274 (798)
Q Consensus       206 VIGRd~EI~riiqIL~-RR~KNn-----~~lvG~~gvGktaive~la~~i~~~~vp~~l~~~~i~~ld~~~l~--a---g  274 (798)
                      =.|-++-=+|+++-++ ++-||+     .|++|+||||||+|....|.-+          |...+.+++|.|-  |   |
T Consensus       413 HYgm~dVKeRILEfiAV~kLrgs~qGkIlCf~GPPGVGKTSI~kSIA~AL----------nRkFfRfSvGG~tDvAeIkG  482 (906)
T KOG2004         413 HYGMEDVKERILEFIAVGKLRGSVQGKILCFVGPPGVGKTSIAKSIARAL----------NRKFFRFSVGGMTDVAEIKG  482 (906)
T ss_pred             CCCHHHHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCCCCHHHHHHHHH----------CCCEEEEECCCCCCHHHHCC
T ss_conf             30168899999999998751466788379986899877321899999984----------87469985366342776425


Q ss_pred             --CCCCCHHHHHHHHHHHHHCCCCCEEEEECCHHHHHCCCCCCCCC------CC---HHHHHHHHHC----CCCEEEEEE
Q ss_conf             --34312378999999987203898399973616630155444344------77---7888876630----266038873
Q gi|254780163|r  275 --TRYRGDFEERIKKIVKEIESYANAILYIDEIHTLVGAGSASGIS------VD---ASNLLKPALS----SGAVRCIGS  339 (798)
Q Consensus       275 --~~~rg~fe~r~~~~~~~~~~~~~~ilfideih~ligag~~~g~~------~d---~an~lkP~L~----rg~~~~Iga  339 (798)
                        -.|-|-.-.|+-..++.+... |.+..||||.-| |.|-.+.-+      +|   -+|+|--||-    -..+-+|+ 
T Consensus       483 HRRTYVGAMPGkiIq~LK~v~t~-NPliLiDEvDKl-G~g~qGDPasALLElLDPEQNanFlDHYLdVp~DLSkVLFic-  559 (906)
T KOG2004         483 HRRTYVGAMPGKIIQCLKKVKTE-NPLILIDEVDKL-GSGHQGDPASALLELLDPEQNANFLDHYLDVPVDLSKVLFIC-  559 (906)
T ss_pred             CCEEEECCCCHHHHHHHHHHCCC-CCEEEEEHHHHH-CCCCCCCHHHHHHHHCCHHHCCCHHHHCCCCCCCHHHEEEEE-
T ss_conf             42110014884899999861778-865885322341-788779868999874396535534542026642111068898-


Q ss_pred             CCHHHHHHHHHC-CHHHHHHCEEEEECCCCHHHHHHHHHH-HHHHHHHHC-----CCEECCHHHHHHHHHH
Q ss_conf             048999998520-111432001443068786899999986-127665410-----3512111789999986
Q gi|254780163|r  340 TTYSEYRQFFEK-DKALVRRFQKIDVSEPSIEDAIEIVKG-IKPYFEEHH-----QLRYSKEAIRAAVQLS  403 (798)
Q Consensus       340 tT~~ey~~~~e~-d~al~rrF~~i~v~ep~~~~~~~iL~~-~~~~ye~~h-----~v~~~~~al~~av~ls  403 (798)
                       |-..    |+. -++|-.|.+.|.+.--..++-+.|-+. +.++--.-|     .|.++++|+...++.-
T Consensus       560 -TAN~----idtIP~pLlDRMEvIelsGYv~eEKv~IA~~yLip~a~~~~gl~~e~v~is~~al~~lI~~Y  625 (906)
T KOG2004         560 -TANV----IDTIPPPLLDRMEVIELSGYVAEEKVKIAERYLIPQALKDCGLKPEQVKISDDALLALIERY  625 (906)
T ss_pred             -ECCC----CCCCCHHHHHHHHEEECCCCCHHHHHHHHHHHHHHHHHHHCCCCHHHCCCCHHHHHHHHHHH
T ss_conf             -5364----45698566412232203672279899999984125789874998786586299999999999


No 247
>PRK06893 DNA replication initiation factor; Validated
Probab=98.31  E-value=7.6e-05  Score=53.98  Aligned_cols=39  Identities=13%  Similarity=0.142  Sum_probs=15.8

Q ss_pred             EEEECCCCHHHHHHHHHHHHHHHHHHCCCEECCHHHHHHHHHH
Q ss_conf             4430687868999999861276654103512111789999986
Q gi|254780163|r  361 KIDVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLS  403 (798)
Q Consensus       361 ~i~v~ep~~~~~~~iL~~~~~~ye~~h~v~~~~~al~~av~ls  403 (798)
                      .+.+.+|+.++-..||+..    -.-.|+.++++++.+.++-.
T Consensus       155 ~~~i~~~dd~~~~~iL~~~----a~~rgl~l~~~v~~yl~~r~  193 (229)
T PRK06893        155 IYQLNDLTDEQKIEVLQRN----AYQRGIELSDETANFLLKRL  193 (229)
T ss_pred             EEEECCCCHHHHHHHHHHH----HHHCCCCCCHHHHHHHHHHH
T ss_conf             6996677757999999999----99649999989999999983


No 248
>smart00350 MCM minichromosome  maintenance proteins.
Probab=98.31  E-value=7.3e-05  Score=54.12  Aligned_cols=223  Identities=17%  Similarity=0.172  Sum_probs=120.9

Q ss_pred             HHHHCCHHHHHHHCHHHHHHHHHHHHHH-HHCCCCCCCCCCC--EEEEECCCCHHHHHHHHHHHHHCCCCEEEEEHHHHH
Q ss_conf             4210000246653458999999999877-5204456578740--688614320038899999873047733772068861
Q gi|254780163|r  468 LSNLEKNLGTVVYGQEEAIKKLSSSIKI-ARAGLSDPNKPIG--CYVFSGPTGVGKTEISKQLAFALGVQLLRFDMSEYM  544 (798)
Q Consensus       468 l~~l~~~l~~~v~GQ~~ai~~v~~~i~~-~~~gl~~~~rP~g--~flf~GptGvGKTelak~la~~~~~~lir~dmsey~  544 (798)
                      +..|-+.+--.++|.+..-.++.-.+.- ..-.+.+..+-.|  ..|++|-+|+||+.|-|..+.....+...--+    
T Consensus       194 ~~~L~~SiaP~I~G~~~vK~allL~L~GG~~~~~~~g~~~Rg~ihiLLvGDPGtgKSqlLk~~~~iaprsvytsG~----  269 (509)
T smart00350      194 YERLSRSLAPSIYGHEDIKKAILLLLFGGVHKNLPDGMKIRGDINILLLGDPGTAKSQLLKYVEKTAPRAVYTTGK----  269 (509)
T ss_pred             HHHHHHHHCCCCCCCHHHHHHHHHHHCCCCCCCCCCCCEECCCEEEEEECCCCCCHHHHHHHHHHHCCCEEEEECC----
T ss_conf             9999985497323878899999999708876648988504154149984699823629999999858860687344----


Q ss_pred             CCCCCCHHCCCCC-HHC-C--CCCCCCCCHHHHHCCCEEEEECCHHHCCHHHHHHHHHHHHHHHCCCCCCC-EECC-CCE
Q ss_conf             2465301104780-002-5--64443100355515851777404455028999999998777502177997-7612-542
Q gi|254780163|r  545 ERHAVSRLIGAPP-GYV-G--FGQGGILADSVDQNPYSVVLLDEIEKSHPDVLNILLQIMDYGILTDQSGK-KISF-RNV  618 (798)
Q Consensus       545 e~~~vs~LiGapp-GYv-G--~~egg~Lte~vr~~P~sVvl~DEiEKAh~~v~~~llqild~G~ltd~~Gr-~vdf-~n~  618 (798)
                       ..|...|..+-- ... |  .=|+|-|.-    ..-.|+..||++|...+-...|+..|+.++++=+++- ...+ ..|
T Consensus       270 -gsS~aGLTaav~rd~~~ge~~leaGALVl----AD~GiccIDEfdKm~~~dr~alhEaMEQQtisiaKaGi~~tL~aR~  344 (509)
T smart00350      270 -GSSAVGLTAAVTRDPETREFTLEGGALVL----ADNGVCCIDEFDKMDDSDRTAIHEAMEQQTISIAKAGITTTLNARC  344 (509)
T ss_pred             -CCCCCCCEEEEEECCCCCCEEECCCCEEC----CCCCEEEEEEHHHCCHHHHHHHHHHHHHCEEEEECCCEEEEEECCC
T ss_conf             -45557706899981788837872564120----5675478521320787789999999974877874375179985573


Q ss_pred             EEEEECCCCHHHHHHCCCCCCCCCCHHHHHHHHHHHCCHHHHCCCCEEEEC-CCCCHHHHHHHHHHHHHH----------
Q ss_conf             999942421455330368988211148899999872887881776828962-889999999999999999----------
Q gi|254780163|r  619 ILIMTTNAGALEMSKARIGFGSSRNDDADKEALRNFLSPEFLNRLDSIIPF-FPLSSDIIRQVVHKFIMK----------  687 (798)
Q Consensus       619 iii~TsN~G~~~~~~~~~g~~~~~~~~~~~~~l~~~f~peflnRid~ii~F-~~l~~~~~~~i~~~~l~~----------  687 (798)
                      -|+.++|-        .  ++.-.......+  .-.|+|.+|.|+|-|++. ...+++.=..|++..+..          
T Consensus       345 sVlAAaNP--------~--~g~yd~~~s~~e--ni~l~~~LLSRFDLIf~l~D~~~~~~D~~ia~hil~~h~~~~~~~~~  412 (509)
T smart00350      345 SVLAAANP--------I--GGRYDPKLTPEE--NIDLPAPILSRFDLLFVVLDEVDEERDRELAKHVVDLHRYSHPEPDE  412 (509)
T ss_pred             EEEEEECC--------C--CCCCCCCCCHHH--HCCCCHHHHHHCCEEEEEECCCCHHHHHHHHHHHHHHHHCCCCCCCC
T ss_conf             59986556--------5--563788899999--46898035410238999615898788999999999987415887545


Q ss_pred             ----------HHHH--HHHCCCEEEECHHHHHHHHH
Q ss_conf             ----------9999--98669889998899999997
Q gi|254780163|r  688 ----------LELQ--LQEKGISFHFSEEVINWLVS  711 (798)
Q Consensus       688 ----------l~~~--l~~~~i~l~~~~~~~~~l~~  711 (798)
                                +.+=  +++.++.=.+++++.+.|.+
T Consensus       413 ~~~~~~~~~~lrkYI~yar~~~~P~ls~eA~~~i~~  448 (509)
T smart00350      413 ADEVPISQEFLRKYIAYAREKIKPKLSEEAAEKLVK  448 (509)
T ss_pred             CCCCCCCHHHHHHHHHHHHHCCCCCCCHHHHHHHHH
T ss_conf             568868999999999999862899789999999999


No 249
>KOG0989 consensus
Probab=98.30  E-value=2.9e-05  Score=56.94  Aligned_cols=172  Identities=22%  Similarity=0.326  Sum_probs=102.2

Q ss_pred             HHHHCHHHHHHHHHHHHHHHHCCCCCCCCCCCEEEEECCCCHHHHHHHHHHHHHC------CCCEEEEEHHHHHCCC---
Q ss_conf             6653458999999999877520445657874068861432003889999987304------7733772068861246---
Q gi|254780163|r  477 TVVYGQEEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFAL------GVQLLRFDMSEYMERH---  547 (798)
Q Consensus       477 ~~v~GQ~~ai~~v~~~i~~~~~gl~~~~rP~g~flf~GptGvGKTelak~la~~~------~~~lir~dmsey~e~~---  547 (798)
                      ..+.||++.|..+.+++.+ +      +-|  .+||-||.|+|||-+|+++|..+      ....+-.+-|...-..   
T Consensus        36 de~~gQe~vV~~L~~a~~~-~------~lp--~~LFyGPpGTGKTStalafar~L~~~~~~~~rvl~lnaSderGisvvr  106 (346)
T KOG0989          36 DELAGQEHVVQVLKNALLR-R------ILP--HYLFYGPPGTGKTSTALAFARALNCEQLFPCRVLELNASDERGISVVR  106 (346)
T ss_pred             HHHCCHHHHHHHHHHHHHH-C------CCC--EEEEECCCCCCHHHHHHHHHHHHCCCCCCCCCHHHHCCCCCCCCCCHH
T ss_conf             7650159999999999860-6------886--078668999867689999999855742355542431366001431006


Q ss_pred             ----CCCHHCCCCCHHCCCCCCCCCCHHHHHCCCEEEEECCHHHCCHHHHHHHHHHHHHHHCCCCCCCEECCCCEEEEEE
Q ss_conf             ----5301104780002564443100355515851777404455028999999998777502177997761254299994
Q gi|254780163|r  548 ----AVSRLIGAPPGYVGFGQGGILADSVDQNPYSVVLLDEIEKSHPDVLNILLQIMDYGILTDQSGKKISFRNVILIMT  623 (798)
Q Consensus       548 ----~vs~LiGappGYvG~~egg~Lte~vr~~P~sVvl~DEiEKAh~~v~~~llqild~G~ltd~~Gr~vdf~n~iii~T  623 (798)
                          ..++|.+.-++-.||          --.||-|+.|||-+--..+-|+.|..++|+-           -++|.+|+-
T Consensus       107 ~Kik~fakl~~~~~~~~~~----------~~~~fKiiIlDEcdsmtsdaq~aLrr~mE~~-----------s~~trFiLI  165 (346)
T KOG0989         107 EKIKNFAKLTVLLKRSDGY----------PCPPFKIIILDECDSMTSDAQAALRRTMEDF-----------SRTTRFILI  165 (346)
T ss_pred             HHHCCHHHHHHCCCCCCCC----------CCCCCEEEEEECHHHHHHHHHHHHHHHHHCC-----------CCCEEEEEE
T ss_conf             6523799875025565678----------8986328997416453099999999998625-----------466599997


Q ss_pred             CCCCHHHHHHCCCCCCCCCCHHHHHHHHHHHCCHHHHCCCCEEEECCCCCHHHHHHHHHHHHHHHHHHHHHCCCEEEECH
Q ss_conf             24214553303689882111488999998728878817768289628899999999999999999999986698899988
Q gi|254780163|r  624 TNAGALEMSKARIGFGSSRNDDADKEALRNFLSPEFLNRLDSIIPFFPLSSDIIRQVVHKFIMKLELQLQEKGISFHFSE  703 (798)
Q Consensus       624 sN~G~~~~~~~~~g~~~~~~~~~~~~~l~~~f~peflnRid~ii~F~~l~~~~~~~i~~~~l~~l~~~l~~~~i~l~~~~  703 (798)
                      +|-=+..+                         +-...|. .-+-|.+|..+++.+.+    ..+.   ...|  +.+++
T Consensus       166 cnylsrii-------------------------~pi~SRC-~KfrFk~L~d~~iv~rL----~~Ia---~~E~--v~~d~  210 (346)
T KOG0989         166 CNYLSRII-------------------------RPLVSRC-QKFRFKKLKDEDIVDRL----EKIA---SKEG--VDIDD  210 (346)
T ss_pred             CCCHHHCC-------------------------HHHHHHH-HHHCCCCCCHHHHHHHH----HHHH---HHHC--CCCCH
T ss_conf             38856477-------------------------2877467-77128876447899999----9998---8858--99787


Q ss_pred             HHHHHHHHCC
Q ss_conf             9999999718
Q gi|254780163|r  704 EVINWLVSHG  713 (798)
Q Consensus       704 ~~~~~l~~~~  713 (798)
                      ++++++++.+
T Consensus       211 ~al~~I~~~S  220 (346)
T KOG0989         211 DALKLIAKIS  220 (346)
T ss_pred             HHHHHHHHHC
T ss_conf             8999999973


No 250
>TIGR02915 PEP_resp_reg putative PEP-CTERM system response regulator; InterPro: IPR014264   Members of this protein family share full-length homology with (but do not include) the acetoacetate metabolism regulatory protein AtoC (see Q06065 from SWISSPROT). These proteins have a Fis family DNA binding sequence, a response regulator receiver domain, and sigma-54 interaction domain. They are found strictly within a subset of Gram-negative bacterial species with the proposed PEP-CTERM/exosortase system, analogous to the LPXTG/sortase system  common in Gram-positive bacteria, where members of IPR014265 from INTERPRO and IPR014266 from INTERPRO also occur..
Probab=98.30  E-value=7.8e-05  Score=53.88  Aligned_cols=247  Identities=18%  Similarity=0.292  Sum_probs=172.1

Q ss_pred             HHHHHHHHHHCCCCCCHHHHHCCHHHHHHHHCC---HHHHHHHCHHHHHHHHHHHHHHHHCCCCCCCCCCCEEEEECCCC
Q ss_conf             789998663102453101110011233421000---02466534589999999998775204456578740688614320
Q gi|254780163|r  441 EKDIKKTIASMNRSIHTTSFSRDDDSVLSNLEK---NLGTVVYGQEEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTG  517 (798)
Q Consensus       441 ~~~i~~~~~~~~~gip~~~~~~~~~~~l~~l~~---~l~~~v~GQ~~ai~~v~~~i~~~~~gl~~~~rP~g~flf~GptG  517 (798)
                      ..||..++.++.  ..+..+..+++. |.....   .=-+-+|||++-+.+|+..|.+-    .+.+  + +.|++|=||
T Consensus       106 d~d~L~liv~RA--f~L~~Le~ENRr-L~~~~~~Gst~~~Gli~~~~~m~kic~tIekv----A~sd--~-TvllLGESG  175 (451)
T TIGR02915       106 DPDVLKLIVDRA--FRLYTLETENRR-LQSALGGGSTALEGLITSSPGMQKICRTIEKV----APSD--I-TVLLLGESG  175 (451)
T ss_pred             CHHHHHHHHHHH--HHHHHHHHHHHH-HHHCCCCCCCCCCCEEECCCCHHHHHHHHHHH----CCCC--C-EEEEECCCC
T ss_conf             578999999998--888888887699-87406887410365220685067898886521----2000--0-130104667


Q ss_pred             HHHHHHHHHHHHHC---CCCEEEEEHHHHHCCCCCCHHCCCCCHHCCCCCCCCCCHHHHHCCC-------EEEEECCHHH
Q ss_conf             03889999987304---7733772068861246530110478000256444310035551585-------1777404455
Q gi|254780163|r  518 VGKTEISKQLAFAL---GVQLLRFDMSEYMERHAVSRLIGAPPGYVGFGQGGILADSVDQNPY-------SVVLLDEIEK  587 (798)
Q Consensus       518 vGKTelak~la~~~---~~~lir~dmsey~e~~~vs~LiGappGYvG~~egg~Lte~vr~~P~-------sVvl~DEiEK  587 (798)
                      +||==+||+|-.-+   +++||-|||.-==|-===|-|.       |||+ |-.|-|+++.+=       .=++||||=-
T Consensus       176 TGKEV~ArA~H~~S~R~~~~FVAINCAAIPEnLLEsELF-------GyEK-GAFTGA~k~T~GKIE~A~~GTLFLDEIGD  247 (451)
T TIGR02915       176 TGKEVLARALHELSDRKDKRFVAINCAAIPENLLESELF-------GYEK-GAFTGAVKQTLGKIEYAHGGTLFLDEIGD  247 (451)
T ss_pred             CHHHHHHHHHHHHCCCCCCCEEEEECCCCCCHHHHHHHH-------CCCC-HHHHHHHCCCCCCEEEECCCCCCCCCHHC
T ss_conf             117899989842057897773444167457524667760-------3410-12422003477616750688301111220


Q ss_pred             CCHHHHHHHHHHHHHHHCCCCCCCE---ECCCCEEEEEECCCCHHHHHHCCCCCCCCCCHHHHHHH-HHHHCCHHHHCCC
Q ss_conf             0289999999987775021779977---61254299994242145533036898821114889999-9872887881776
Q gi|254780163|r  588 SHPDVLNILLQIMDYGILTDQSGKK---ISFRNVILIMTTNAGALEMSKARIGFGSSRNDDADKEA-LRNFLSPEFLNRL  663 (798)
Q Consensus       588 Ah~~v~~~llqild~G~ltd~~Gr~---vdf~n~iii~TsN~G~~~~~~~~~g~~~~~~~~~~~~~-l~~~f~peflnRi  663 (798)
                      ---..+-=||--|.|=.+.==-||.   ||   +=|||-||.                   +.+.. -...||-.+.=||
T Consensus       248 LP~~LQAKLLRFLQErVIER~GGR~eIPVD---VRvvCATnq-------------------dL~~~i~eg~FREDLfYRl  305 (451)
T TIGR02915       248 LPLNLQAKLLRFLQERVIERLGGREEIPVD---VRVVCATNQ-------------------DLKKMIAEGTFREDLFYRL  305 (451)
T ss_pred             CCHHHHHHHHHHHHHHHHHCCCCCCCCCCC---EEEEECCCH-------------------HHHHHHHCCCCCCCCEEEE
T ss_conf             676689999987546663105887245614---267503224-------------------6899985489720001346


Q ss_pred             CEEE-ECCCC--CHHHHHHHHHHHHHHHHHHHHHCCCEEEECHHHHHHHHHCCCCCCCCCHHHHHHHHHHH
Q ss_conf             8289-62889--99999999999999999999866988999889999999718981015326799999862
Q gi|254780163|r  664 DSII-PFFPL--SSDIIRQVVHKFIMKLELQLQEKGISFHFSEEVINWLVSHGYDVKMGARPLERIIKEHV  731 (798)
Q Consensus       664 d~ii-~F~~l--~~~~~~~i~~~~l~~l~~~l~~~~i~l~~~~~~~~~l~~~~~~~~~GAR~l~r~i~~~i  731 (798)
                      -+|. ..=||  -.+|..-+++.++.+......  .-...||++++++|-.+.+=-.  -|.|...|++-|
T Consensus       306 ~Eisi~iPPLR~R~gDa~lLA~~Fl~rf~~~~k--~~~~~F~~DA~~ale~h~WPGN--vRELEN~vKRAV  372 (451)
T TIGR02915       306 AEISITIPPLRDRDGDAVLLANAFLERFARELK--RKAKGFTDDALRALEAHKWPGN--VRELENKVKRAV  372 (451)
T ss_pred             EEEEEECCCCCCCHHHHHHHHHHHHHHHHHHHC--CCCCCHHHHHHHHHHCCCCCCC--HHHHHCHHHEEE
T ss_conf             667862588998601899999999998878733--0216606999999760699884--154403002134


No 251
>PRK00149 dnaA chromosomal replication initiation protein; Reviewed
Probab=98.30  E-value=4.7e-05  Score=55.50  Aligned_cols=207  Identities=16%  Similarity=0.294  Sum_probs=119.5

Q ss_pred             CHHHHHHHCHHHHHH-HHHHHHHHHHCCCCCCCCCCCEEEEECCCCHHHHHHHHHHHH-----HCCCCEEEEEHHHHHCC
Q ss_conf             002466534589999-999998775204456578740688614320038899999873-----04773377206886124
Q gi|254780163|r  473 KNLGTVVYGQEEAIK-KLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAF-----ALGVQLLRFDMSEYMER  546 (798)
Q Consensus       473 ~~l~~~v~GQ~~ai~-~v~~~i~~~~~gl~~~~rP~g~flf~GptGvGKTelak~la~-----~~~~~lir~dmsey~e~  546 (798)
                      -.+..-|+|...... +.+.++-      .+|+.+---+++.|++|+|||.|..+++-     .-+...+-+...+|+..
T Consensus       116 yTFdnFVvG~sN~lA~aAA~~Va------~~pg~~yNPLfIyG~~GlGKTHLl~AIgn~~~~~~p~~~v~Y~tae~F~~~  189 (447)
T PRK00149        116 YTFDNFVVGKSNRLAHAAALAVA------ENPGKAYNPLFIYGGVGLGKTHLLHAIGNYILEKNPNAKVVYVSSEKFTND  189 (447)
T ss_pred             CCCCCCEECCCCHHHHHHHHHHH------HCCCCCCCCEEEECCCCCCHHHHHHHHHHHHHHHCCCCEEEEEEHHHHHHH
T ss_conf             60326222698599999999998------376767785589779988788999999999998589972899549999999


Q ss_pred             CCCCHHCCCCCHHCCCCCCCCCCHHHH--HCCCEEEEECCHHH--CCHHHHHHHHHHHHHHHCCCCCCCEECCCCEEEEE
Q ss_conf             653011047800025644431003555--15851777404455--02899999999877750217799776125429999
Q gi|254780163|r  547 HAVSRLIGAPPGYVGFGQGGILADSVD--QNPYSVVLLDEIEK--SHPDVLNILLQIMDYGILTDQSGKKISFRNVILIM  622 (798)
Q Consensus       547 ~~vs~LiGappGYvG~~egg~Lte~vr--~~P~sVvl~DEiEK--Ah~~v~~~llqild~G~ltd~~Gr~vdf~n~iii~  622 (798)
                      ..-+ |-           .+. ++..|  -+..-|+|+|.|.-  .....+.-|+++|+  .|.++. +       -||+
T Consensus       190 ~v~a-l~-----------~~~-~~~Fr~~yr~~DvLliDDiqfl~gk~~tqeeff~~fn--~l~~~~-k-------qiv~  246 (447)
T PRK00149        190 FVKA-LR-----------NNA-MEEFKEKYRSVDVLLIDDIQFLAGKEKTQEEFFHTFN--ALHENN-K-------QIVI  246 (447)
T ss_pred             HHHH-HH-----------CCC-HHHHHHHHHCCCEEEECHHHHHHCCHHHHHHHHHHHH--HHHHCC-C-------EEEE
T ss_conf             9999-85-----------186-9999999972885432148886055779999999999--999849-9-------6899


Q ss_pred             ECCCCHHHHHHCCCCCCCCCCHHHHHHHHHHHCCHHHHCCCC--EEEECCCCCHHHHHHHHHHHHHHHHHHHHHCCCEEE
Q ss_conf             424214553303689882111488999998728878817768--289628899999999999999999999986698899
Q gi|254780163|r  623 TTNAGALEMSKARIGFGSSRNDDADKEALRNFLSPEFLNRLD--SIIPFFPLSSDIIRQVVHKFIMKLELQLQEKGISFH  700 (798)
Q Consensus       623 TsN~G~~~~~~~~~g~~~~~~~~~~~~~l~~~f~peflnRid--~ii~F~~l~~~~~~~i~~~~l~~l~~~l~~~~i~l~  700 (798)
                      ||.---.++                     ..|.+.+..|+-  -++...|.+.+....|+.....       ..+  +.
T Consensus       247 tsd~~P~~l---------------------~~l~~rL~SRf~~Gl~~~i~~Pd~e~r~~Il~~k~~-------~~~--~~  296 (447)
T PRK00149        247 TSDRPPKEL---------------------EGLEDRLRSRFEWGLTVDIEPPDLETRVAILQKKAE-------EEG--IN  296 (447)
T ss_pred             ECCCCHHHC---------------------CCCCHHHHHHHHCCEEEECCCCCHHHHHHHHHHHHH-------HCC--CC
T ss_conf             578896765---------------------651177886763762651059999999999999999-------728--99


Q ss_pred             ECHHHHHHHHHCCCCCCCCCHHHHHHHHHH----------HHHHHHHHHHC
Q ss_conf             988999999971898101532679999986----------23599999962
Q gi|254780163|r  701 FSEEVINWLVSHGYDVKMGARPLERIIKEH----------VKVPLADEILF  741 (798)
Q Consensus       701 ~~~~~~~~l~~~~~~~~~GAR~l~r~i~~~----------i~~~la~~il~  741 (798)
                      +++++++||+++-.+   -.|.|..++.+.          +...++..+|.
T Consensus       297 l~~~v~~~iA~~~~~---nvR~LeGal~~l~a~~~~~~~~i~~~~~~~~l~  344 (447)
T PRK00149        297 LPNEVLEFIAKRIRS---NIRELEGALNRLVAYASLTGRPITLELAKEALK  344 (447)
T ss_pred             CCHHHHHHHHHHCCC---CHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHH
T ss_conf             998999999971268---899999999999999998689999999999999


No 252
>PRK08084 DNA replication initiation factor; Provisional
Probab=98.29  E-value=0.00014  Score=52.18  Aligned_cols=184  Identities=17%  Similarity=0.275  Sum_probs=106.1

Q ss_pred             CHHHHHHHCHHHHHHHHHHHHHHHHCCCCCCCCCCCEEEEECCCCHHHHHHHHHHHH---HCCCCEEEEEHHHHHCCCCC
Q ss_conf             002466534589999999998775204456578740688614320038899999873---04773377206886124653
Q gi|254780163|r  473 KNLGTVVYGQEEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAF---ALGVQLLRFDMSEYMERHAV  549 (798)
Q Consensus       473 ~~l~~~v~GQ~~ai~~v~~~i~~~~~gl~~~~rP~g~flf~GptGvGKTelak~la~---~~~~~lir~dmsey~e~~~v  549 (798)
                      ..+..-|+|....+   +.+++..-.  ..+++   .+.+.||+|+|||.|..+.+.   ..+.....+.+.++.+.   
T Consensus        19 ~tfdnFi~g~n~~~---~~al~~~~~--~~~~~---~l~l~G~~G~GKTHLLqA~~~~~~~~~~~~~yl~~~~~~~~---   87 (235)
T PRK08084         19 ETFASFYPGDNDSL---LAALQNVLR--QEHSG---YIYLWGREGAGRSHLLHAACAELSQRGDAVGYVPLDKRAWF---   87 (235)
T ss_pred             CCHHCCCCCCCHHH---HHHHHHHHH--CCCCC---EEEEECCCCCCHHHHHHHHHHHHHCCCCCEEEEEHHHHHHH---
T ss_conf             66302344886999---999999985--78987---69998999988899999999999707985799877986651---


Q ss_pred             CHHCCCCCHHCCCCCCCCCCHHHHHCCCEEEEECCHHHC--CH----HHHHHHHHHHHHHHCCCCCCCEECCCCEEEEEE
Q ss_conf             011047800025644431003555158517774044550--28----999999998777502177997761254299994
Q gi|254780163|r  550 SRLIGAPPGYVGFGQGGILADSVDQNPYSVVLLDEIEKS--HP----DVLNILLQIMDYGILTDQSGKKISFRNVILIMT  623 (798)
Q Consensus       550 s~LiGappGYvG~~egg~Lte~vr~~P~sVvl~DEiEKA--h~----~v~~~llqild~G~ltd~~Gr~vdf~n~iii~T  623 (798)
                            .|.         ..+.+  ..+.+|++|.|+.-  .+    .+|++|=.+.+.|             +|-|+||
T Consensus        88 ------~~~---------~l~~l--~~~dll~iDDi~~i~g~~~~ee~lF~l~N~~~~~g-------------~~~ll~t  137 (235)
T PRK08084         88 ------VPE---------VLEGM--EQLSLVCIDNIECIAGDELWEMAIFDLYNRILESG-------------KTRLLIT  137 (235)
T ss_pred             ------HHH---------HHHHH--HHCCEEEEECHHHHCCCHHHHHHHHHHHHHHHHHC-------------CCEEEEE
T ss_conf             ------799---------99876--41898998274554699789999999999999848-------------9669996


Q ss_pred             CCCCHHHHHHCCCCCCCCCCHHHHHHHHHHHCCHHHHCCC--CEEEECCCCCHHHHHHHHHHHHHHHHHHHHHCCCEEEE
Q ss_conf             2421455330368988211148899999872887881776--82896288999999999999999999999866988999
Q gi|254780163|r  624 TNAGALEMSKARIGFGSSRNDDADKEALRNFLSPEFLNRL--DSIIPFFPLSSDIIRQVVHKFIMKLELQLQEKGISFHF  701 (798)
Q Consensus       624 sN~G~~~~~~~~~g~~~~~~~~~~~~~l~~~f~peflnRi--d~ii~F~~l~~~~~~~i~~~~l~~l~~~l~~~~i~l~~  701 (798)
                      |+.-...+                     ..+-|.+..|+  ..++--.|++.++...|+...       ...+|+.  +
T Consensus       138 s~~~P~~l---------------------~~~l~DL~SRl~~g~~~~i~~~dde~~~~iL~~~-------a~~rgl~--l  187 (235)
T PRK08084        138 GDRPPRQL---------------------NLGLPDLASRLDWGQIYKLQPLSDEEKLQALQLR-------ARLRGFE--L  187 (235)
T ss_pred             CCCCHHHC---------------------CCCCHHHHHHHHCCCEEEECCCCHHHHHHHHHHH-------HHHCCCC--C
T ss_conf             79882430---------------------2312889999956972785599989999999999-------9973999--9


Q ss_pred             CHHHHHHHHHCCCCCCCCCHHHHHHHHHH
Q ss_conf             88999999971898101532679999986
Q gi|254780163|r  702 SEEVINWLVSHGYDVKMGARPLERIIKEH  730 (798)
Q Consensus       702 ~~~~~~~l~~~~~~~~~GAR~l~r~i~~~  730 (798)
                      ++++.+||+++... .+  |.|..++.+.
T Consensus       188 ~~~V~~yl~~~~~R-~~--~~L~~~l~~L  213 (235)
T PRK08084        188 PEDVGRFLLKRLDR-EM--RTLFMTLDQL  213 (235)
T ss_pred             CHHHHHHHHHHCCC-CH--HHHHHHHHHH
T ss_conf             98999999986158-89--9999999999


No 253
>PRK08903 hypothetical protein; Validated
Probab=98.28  E-value=4.3e-05  Score=55.78  Aligned_cols=161  Identities=19%  Similarity=0.292  Sum_probs=96.3

Q ss_pred             EEEECCCCHHHHHHHHHHHH---HCCCCEEEEEHHHHHCCCCCCHHCCCCCHHCCCCCCCCCCHHHHHCCCEEEEECCHH
Q ss_conf             88614320038899999873---047733772068861246530110478000256444310035551585177740445
Q gi|254780163|r  510 YVFSGPTGVGKTEISKQLAF---ALGVQLLRFDMSEYMERHAVSRLIGAPPGYVGFGQGGILADSVDQNPYSVVLLDEIE  586 (798)
Q Consensus       510 flf~GptGvGKTelak~la~---~~~~~lir~dmsey~e~~~vs~LiGappGYvG~~egg~Lte~vr~~P~sVvl~DEiE  586 (798)
                      +.+.||+|+|||.|..+.+.   ..+...+.+++.++.+.     +.       +          .  .-..++++|.|+
T Consensus        45 l~i~G~~G~GKTHLl~a~~~~~~~~~~~~~yl~~~~~~~~-----~~-------~----------~--~~~d~l~iDDi~  100 (227)
T PRK08903         45 FYLWGEAGSGRSHLLQALVAAASEGGKNARYLDPASPLLA-----FD-------F----------D--PRAELYAVDDVE  100 (227)
T ss_pred             EEEECCCCCCHHHHHHHHHHHHHHCCCCEEEECCCCCHHH-----HH-------H----------H--HCCCEEEEECCC
T ss_conf             9998999998889999999999806997499651104577-----74-------2----------0--018989996411


Q ss_pred             HCCHH----HHHHHHHHHHHHHCCCCCCCEECCCCEEEEEECCCCHHHHHHCCCCCCCCCCHHHHHHHHHHHCCHHHHCC
Q ss_conf             50289----99999998777502177997761254299994242145533036898821114889999987288788177
Q gi|254780163|r  587 KSHPD----VLNILLQIMDYGILTDQSGKKISFRNVILIMTTNAGALEMSKARIGFGSSRNDDADKEALRNFLSPEFLNR  662 (798)
Q Consensus       587 KAh~~----v~~~llqild~G~ltd~~Gr~vdf~n~iii~TsN~G~~~~~~~~~g~~~~~~~~~~~~~l~~~f~peflnR  662 (798)
                      .-..+    +|+++=.+.+.|             ++++++||+.....                    +  .+.|.+.+|
T Consensus       101 ~i~~~~q~~lF~l~N~~~~~~-------------~~~ll~s~~~~p~~--------------------l--~~~~DL~SR  145 (227)
T PRK08903        101 RLDDAQQIALFNLFNRVRAHG-------------KTALLVAGPAAPLA--------------------L--DVREDLRTR  145 (227)
T ss_pred             CCCCHHHHHHHHHHHHHHHCC-------------CCEEEECCCCCHHH--------------------C--CCCHHHHHH
T ss_conf             489569999999999999729-------------94899718997120--------------------1--200899999


Q ss_pred             CC--EEEECCCCCHHHHHHHHHHHHHHHHHHHHHCCCEEEECHHHHHHHHHCCCCCCCCCHHHHHHHHHH----------
Q ss_conf             68--289628899999999999999999999986698899988999999971898101532679999986----------
Q gi|254780163|r  663 LD--SIIPFFPLSSDIIRQVVHKFIMKLELQLQEKGISFHFSEEVINWLVSHGYDVKMGARPLERIIKEH----------  730 (798)
Q Consensus       663 id--~ii~F~~l~~~~~~~i~~~~l~~l~~~l~~~~i~l~~~~~~~~~l~~~~~~~~~GAR~l~r~i~~~----------  730 (798)
                      +-  -++...|++.+....|+.+.       ..++|+  .+++++.+||+.+....   .|.|..++.+.          
T Consensus       146 l~~gl~~~i~~pdde~~~~iL~~~-------a~~rgl--~l~~~v~~yl~~r~~R~---~~~L~~~l~~Ld~~sl~~kr~  213 (227)
T PRK08903        146 LGWGLVYEVKPLSDEDKIAALKAA-------AAERGL--QLADEVPDYLLTHFRRD---MPSLMALLDALDRYSLEQKRA  213 (227)
T ss_pred             HHCCCEEEEECCCHHHHHHHHHHH-------HHHCCC--CCCHHHHHHHHHHHCCC---HHHHHHHHHHHHHHHHHCCCC
T ss_conf             938973899797999999999999-------996299--99889999999983478---999999999999999982999


Q ss_pred             HHHHHHHHHHC
Q ss_conf             23599999962
Q gi|254780163|r  731 VKVPLADEILF  741 (798)
Q Consensus       731 i~~~la~~il~  741 (798)
                      |.-|+++++|.
T Consensus       214 iTi~lvkevLa  224 (227)
T PRK08903        214 VTLPLLREMLA  224 (227)
T ss_pred             CCHHHHHHHHC
T ss_conf             99999999855


No 254
>PRK06893 DNA replication initiation factor; Validated
Probab=98.28  E-value=1.1e-05  Score=60.02  Aligned_cols=159  Identities=16%  Similarity=0.296  Sum_probs=95.1

Q ss_pred             EEEEECCCCHHHHHHHHHHH---HHCCCCEEEEEHHHHHCCCCCCHHCCCCCHHCCCCCCCCCCHHHHHCCCEEEEECCH
Q ss_conf             68861432003889999987---304773377206886124653011047800025644431003555158517774044
Q gi|254780163|r  509 CYVFSGPTGVGKTEISKQLA---FALGVQLLRFDMSEYMERHAVSRLIGAPPGYVGFGQGGILADSVDQNPYSVVLLDEI  585 (798)
Q Consensus       509 ~flf~GptGvGKTelak~la---~~~~~~lir~dmsey~e~~~vs~LiGappGYvG~~egg~Lte~vr~~P~sVvl~DEi  585 (798)
                      .|.+.||+|+|||.|..+.+   ...+...+.++|++..+-         +|-         ..+.++  .+.+|++|.|
T Consensus        41 ~l~i~G~~gsGKTHLLqa~~~~~~~~~~~~~yi~~~~~~~~---------~~~---------~l~~l~--~~d~l~iDDi  100 (229)
T PRK06893         41 FFYIWGGKSSGKSHLLKAVSNHYLLNQRTAIYIPLSKSQYF---------SPA---------VLENLE--QQDLVCLDDL  100 (229)
T ss_pred             EEEEECCCCCCHHHHHHHHHHHHHHHCCCEEEEEHHHHHHC---------CHH---------HHHHHH--HCCEEEEECH
T ss_conf             79998999998899999999999971898599973775640---------699---------998765--4797999672


Q ss_pred             HHC--CHHHHHHHHHHHHHHHCCCCCCCEECCCCEEEEEECCCCHHHHHHCCCCCCCCCCHHHHHHHHHHHCCHHHHCCC
Q ss_conf             550--289999999987775021779977612542999942421455330368988211148899999872887881776
Q gi|254780163|r  586 EKS--HPDVLNILLQIMDYGILTDQSGKKISFRNVILIMTTNAGALEMSKARIGFGSSRNDDADKEALRNFLSPEFLNRL  663 (798)
Q Consensus       586 EKA--h~~v~~~llqild~G~ltd~~Gr~vdf~n~iii~TsN~G~~~~~~~~~g~~~~~~~~~~~~~l~~~f~peflnRi  663 (798)
                      +.-  .++....|..++.  ++.++       .++++++||+.-...+                     .+.-|.+..|+
T Consensus       101 ~~i~g~~~~e~~lF~l~N--~l~~~-------~~~~ll~ss~~~p~~l---------------------~~~l~DL~SRl  150 (229)
T PRK06893        101 QAVIGNEEWELAIFDLFN--RIKES-------GKTLLLISANQSPHAL---------------------QIKLPDLASRL  150 (229)
T ss_pred             HHHCCCHHHHHHHHHHHH--HHHHC-------CCCEEEEECCCCHHHH---------------------CCHHHHHHHHH
T ss_conf             342488389999999999--99975-------9917998579883322---------------------10026799999


Q ss_pred             C--EEEECCCCCHHHHHHHHHHHHHHHHHHHHHCCCEEEECHHHHHHHHHCCCCCCCCCHHHHHHHHH
Q ss_conf             8--28962889999999999999999999998669889998899999997189810153267999998
Q gi|254780163|r  664 D--SIIPFFPLSSDIIRQVVHKFIMKLELQLQEKGISFHFSEEVINWLVSHGYDVKMGARPLERIIKE  729 (798)
Q Consensus       664 d--~ii~F~~l~~~~~~~i~~~~l~~l~~~l~~~~i~l~~~~~~~~~l~~~~~~~~~GAR~l~r~i~~  729 (798)
                      -  .++-..|++.+....|+.+.       ...+|+  .+++++.+||+++.. +.+  |.|..++++
T Consensus       151 ~~~~~~~i~~~dd~~~~~iL~~~-------a~~rgl--~l~~~v~~yl~~r~~-R~~--~~l~~~l~~  206 (229)
T PRK06893        151 TWGEIYQLNDLTDEQKIEVLQRN-------AYQRGI--ELSDETANFLLKRLD-RDM--HTLFDALDL  206 (229)
T ss_pred             HCCEEEEECCCCHHHHHHHHHHH-------HHHCCC--CCCHHHHHHHHHHHC-CCH--HHHHHHHHH
T ss_conf             68836996677757999999999-------996499--999899999999834-789--999999999


No 255
>pfam02861 Clp_N Clp amino terminal domain. This short domain is found in one or two copies at the amino terminus of ClpA and ClpB proteins from bacteria and eukaryotes. The function of these domains is uncertain but they may form a protein binding site.
Probab=98.28  E-value=1.6e-06  Score=65.97  Aligned_cols=50  Identities=38%  Similarity=0.551  Sum_probs=44.8

Q ss_pred             HHHHHHHCCCCCCCHHHHHHHHHHCH--HHHHHHHHCCCCHHHHHHHHHHHH
Q ss_conf             99999982899511999999982074--689999985999899999999996
Q gi|254780163|r   15 ALVLANERNHEYATLEHLLLALIDDS--DAAIVMLSCNVDLKVLKNNLLNYI   64 (798)
Q Consensus        15 A~~lAk~~~H~~Vt~EHLLLaLL~d~--~~~~iL~~~giD~~~Lk~~Le~~L   64 (798)
                      |+++|++++|+||++||||++|++++  .+..+|..+|+|.+.+++.++..+
T Consensus         1 A~~~A~~~~~~~i~~EHlLlall~~~~~~~~~il~~~g~~~~~l~~~i~~~~   52 (53)
T pfam02861         1 AQELAKELGHQYIGTEHLLLALLEEDDGIAARLLKKAGVDLDALREAIEKLL   52 (53)
T ss_pred             CHHHHHHCCCCCCCHHHHHHHHHHCCCCHHHHHHHHCCCCHHHHHHHHHHHH
T ss_conf             9888978699853499999999865885899999995989999999999870


No 256
>PRK10923 glnG nitrogen regulation protein NR(I); Provisional
Probab=98.27  E-value=3.8e-06  Score=63.33  Aligned_cols=151  Identities=24%  Similarity=0.392  Sum_probs=87.0

Q ss_pred             CCHHHHHHHHHHHHHHHHHHC--CCCCCEEEECCCCCHHHHHHHHHHHHHHCCCCCHHHHEEEEEEEEHHHH--------
Q ss_conf             611222178999999998622--6778748966764116689999999985489883452014455404675--------
Q gi|254780163|r  202 KVDILVGRHEEINRTIQILCR--RSKNNPLYVGDPGVGKTAIAEGFAKQIVDGMVPDILLGARIFSLDMGNL--------  271 (798)
Q Consensus       202 KLDPVIGRd~EI~riiqIL~R--R~KNn~~lvG~~gvGktaive~la~~i~~~~vp~~l~~~~i~~ld~~~l--------  271 (798)
                      ...++||....++++.+.+.|  ++..++++.||+|+||..++..+-..=-       -++..++.+|.+++        
T Consensus       136 ~~~~liG~S~~m~~v~~~i~~~a~~~~pVLI~GE~GTGK~~~Ar~IH~~S~-------r~~~pfi~vnC~~~~~~~~e~e  208 (469)
T PRK10923        136 PTTDIIGEAPAMQDVFRIIGRLSRSSISVLINGESGTGKELVAHALHRHSP-------RAKAPFIALNMAAIPKDLIESE  208 (469)
T ss_pred             CCCCCEECCHHHHHHHHHHHHHHCCCCCEEEECCCCCCHHHHHHHHHHCCC-------CCCCCCEEEECCCCCHHHHHHH
T ss_conf             755654689999999999999858899789989898269999999997488-------7799957876788997789999


Q ss_pred             HCCCCCCCHHHHH---HHHHHHHHCCCCCEEEEECCHHHHHCCCCCCCCCCCHHHHHHHHHCCC-------------CEE
Q ss_conf             3063431237899---999998720389839997361663015544434477788887663026-------------603
Q gi|254780163|r  272 IAGTRYRGDFEER---IKKIVKEIESYANAILYIDEIHTLVGAGSASGISVDASNLLKPALSSG-------------AVR  335 (798)
Q Consensus       272 ~ag~~~rg~fe~r---~~~~~~~~~~~~~~ilfideih~ligag~~~g~~~d~an~lkP~L~rg-------------~~~  335 (798)
                      +-|. .+|.|..-   ..+.+++   ..+=-||+|||+.|         +.+.-.-|--+|..|             ++|
T Consensus       209 LFG~-~~gaf~ga~~~~~g~~e~---a~~GTLfLdeI~~L---------~~~~Q~kLl~~L~~~~~~~~g~~~~~~~d~R  275 (469)
T PRK10923        209 LFGH-EKGAFTGANTIRQGRFEQ---ADGGTLFLDEIGDM---------PLDVQTRLLRVLADGQFYRVGGYAPVKVDVR  275 (469)
T ss_pred             HHCC-CCCCCCCCCCCCCCCHHH---CCCCCEEHHHHHHC---------CHHHHHHHHHHHHCCCEEECCCCCEEEECCE
T ss_conf             7087-667878864245873664---38992656636648---------9999999999985593785799851221437


Q ss_pred             EEEECCHHHHHHHHHCCH---HHHHHCEEEEECCCCHHHHH
Q ss_conf             887304899999852011---14320014430687868999
Q gi|254780163|r  336 CIGSTTYSEYRQFFEKDK---ALVRRFQKIDVSEPSIEDAI  373 (798)
Q Consensus       336 ~IgatT~~ey~~~~e~d~---al~rrF~~i~v~ep~~~~~~  373 (798)
                      +|.+|+.+ ....++...   -|--|+..+.|.=|+-.+-.
T Consensus       276 iIaat~~~-L~~~v~~g~Fr~dLyyrL~~~~I~lPpLReR~  315 (469)
T PRK10923        276 IIAATHQN-LEQRVQEGKFREDLFHRLNVIRVHLPPLRERR  315 (469)
T ss_pred             EEEECCCC-HHHHHHHCCHHHHHHHHHHHHCCCCCCHHHCH
T ss_conf             99707879-99986608177999986442401584654465


No 257
>pfam03215 Rad17 Rad17 cell cycle checkpoint protein.
Probab=98.25  E-value=0.00017  Score=51.52  Aligned_cols=138  Identities=13%  Similarity=0.145  Sum_probs=65.8

Q ss_pred             CCHHHHH-HHHHHHHHCCCCHHHHHHHHHHHHHHHH--HHCCCCCCEEEECCCCCHHHHHHHHHHHHH----HCCCCCHH
Q ss_conf             3035654-4258877548611222178999999998--622677874896676411668999999998----54898834
Q gi|254780163|r  185 PALSAYC-VDLTEKVKKGKVDILVGRHEEINRTIQI--LCRRSKNNPLYVGDPGVGKTAIAEGFAKQI----VDGMVPDI  257 (798)
Q Consensus       185 ~~LdkFg-~DLTe~AreGKLDPVIGRd~EI~riiqI--L~RR~KNn~~lvG~~gvGktaive~la~~i----~~~~vp~~  257 (798)
                      |.-++|. .++.++|-..|      .=+||++=++-  ..|++|.=-+|.|+||+|||+.|+-||..+    .+..-|..
T Consensus         8 pW~ekyaP~~l~ELAVHKK------KV~eV~~WL~~~~~~~~~~~iLlLtGPaG~GKTTTI~lLAkeLG~ei~EW~NP~~   81 (490)
T pfam03215         8 LWTEKYKPRRRDELAIHKK------KIAEVDHWLKAVFLESNKQLILLLTGPSGCGKSTTVKVLSKELGIEIIEWSNPEY   81 (490)
T ss_pred             CCHHHCCCCCHHHHHHHHH------HHHHHHHHHHHHHCCCCCCEEEEEECCCCCCHHHHHHHHHHHHCCEEEEECCCCC
T ss_conf             6414308887899855354------3999999999985477773189987989988999999999975968998148654


Q ss_pred             HHEEEE-EEEEH---HHHHCCCCCCCHHHHHHHHHHHH--H--CCCCCEEEEECCHHHHHCCCCCCCCCCCHHHHHHHHH
Q ss_conf             520144-55404---67530634312378999999987--2--0389839997361663015544434477788887663
Q gi|254780163|r  258 LLGARI-FSLDM---GNLIAGTRYRGDFEERIKKIVKE--I--ESYANAILYIDEIHTLVGAGSASGISVDASNLLKPAL  329 (798)
Q Consensus       258 l~~~~i-~~ld~---~~l~ag~~~rg~fe~r~~~~~~~--~--~~~~~~ilfideih~ligag~~~g~~~d~an~lkP~L  329 (798)
                      ..+... +..+-   ..-.-+.+---+|++-+..--..  +  .....-|++|+|+-+..-.     .....-+.|.-+|
T Consensus        82 ~~~~~~~~q~~d~~g~~~~~~~S~~~~F~eFLlr~~ky~sL~~~~~~kriILIEE~Pn~~~~-----d~~~fr~~L~~~L  156 (490)
T pfam03215        82 LHNPDNECQKPDFRGDCIVNSLSQMEQFREFLLRGARYGSLQGGGLKKKLILVEELPNQFYS-----DAEKFREVIREVL  156 (490)
T ss_pred             CCCCCCHHHCCCCCCCCCCCCCCHHHHHHHHHHHCCCCCCCCCCCCCCEEEEEECCCCCCCC-----CHHHHHHHHHHHH
T ss_conf             56775022101212345766663777767887622335654457887359999658874423-----6699999999999


Q ss_pred             CCCC
Q ss_conf             0266
Q gi|254780163|r  330 SSGA  333 (798)
Q Consensus       330 ~rg~  333 (798)
                      ..+.
T Consensus       157 ~s~~  160 (490)
T pfam03215       157 QSIW  160 (490)
T ss_pred             HHCC
T ss_conf             7089


No 258
>PRK09112 DNA polymerase III subunit delta'; Validated
Probab=98.25  E-value=0.00011  Score=52.91  Aligned_cols=197  Identities=18%  Similarity=0.221  Sum_probs=121.7

Q ss_pred             HHHHHHHHHHHHHHHHHHCCCCCCE-EEECCCCCHHHHHHHHHHHHHHCCC----CCHHHHEEEEEEEEHHHHHCCCC--
Q ss_conf             1222178999999998622677874-8966764116689999999985489----88345201445540467530634--
Q gi|254780163|r  204 DILVGRHEEINRTIQILCRRSKNNP-LYVGDPGVGKTAIAEGFAKQIVDGM----VPDILLGARIFSLDMGNLIAGTR--  276 (798)
Q Consensus       204 DPVIGRd~EI~riiqIL~RR~KNn~-~lvG~~gvGktaive~la~~i~~~~----vp~~l~~~~i~~ld~~~l~ag~~--  276 (798)
                      +-+||-+.-++.+.+.+...+=.+. ++.|++|||||+++..+|+.+....    .|..+.+.-.-+.....+.+|+.  
T Consensus        23 ~~liGq~~~~~~L~~a~~~gRl~HA~Lf~GP~GiGKaTlA~~~A~~Ll~~~~~~~~~~~~~~pd~~~~~~r~i~~g~hpd  102 (352)
T PRK09112         23 NRLFGHEEARAFLAQAYREGRLHHALLFEGPEGIGKATLAFHLANHILSHPDPNEAPETLADPDPASPLWRQIAQGAHPN  102 (352)
T ss_pred             HHHCCHHHHHHHHHHHHHCCCCCCEEEEECCCCCCHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCHHHHHHHCCCCCC
T ss_conf             46278699999999999849965246535899808999999999998669986668655678887877899997489999


Q ss_pred             --------------CCCHH-HHHHHHHHHHHCC----CCCEEEEECCHHHHHCCCCCCCCCCCHHHHHHHHHCC--CCEE
Q ss_conf             --------------31237-8999999987203----8983999736166301554443447778888766302--6603
Q gi|254780163|r  277 --------------YRGDF-EERIKKIVKEIES----YANAILYIDEIHTLVGAGSASGISVDASNLLKPALSS--GAVR  335 (798)
Q Consensus       277 --------------~rg~f-e~r~~~~~~~~~~----~~~~ilfideih~ligag~~~g~~~d~an~lkP~L~r--g~~~  335 (798)
                                    .+... =+-++.+.+.+..    .+.-|..||+.|+|         +.+++|-|.-.|..  ....
T Consensus       103 l~~i~r~~d~k~~~~~~~I~vd~iR~l~~~~~~~~~~~~~kv~Iid~ad~m---------~~~aaNALLK~LEEPp~~~~  173 (352)
T PRK09112        103 LLHLTRPFDEKTGKFKTAITVDEIRRVTHFLSQTSGDGNWRIVIIDPADDM---------NRNAANAILKTLEEPPARAL  173 (352)
T ss_pred             EEEEECCCCHHHHHHHCCCCHHHHHHHHHHHCCCCCCCCEEEEEECCHHHH---------HHHHHHHHHHHHHCCCCCEE
T ss_conf             565534322021454335777999999998454886688069998187874---------69999999998534898748


Q ss_pred             EEEECCHHHHHHHHHCCHHHHHHCEEEEECCCCHHHHHHHHHHHHHHHHHHCCCEECCHHHHHHHHHHHHHCCCCCCHHH
Q ss_conf             88730489999985201114320014430687868999999861276654103512111789999986542015556467
Q gi|254780163|r  336 CIGSTTYSEYRQFFEKDKALVRRFQKIDVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLPDK  415 (798)
Q Consensus       336 ~IgatT~~ey~~~~e~d~al~rrF~~i~v~ep~~~~~~~iL~~~~~~ye~~h~v~~~~~al~~av~ls~ryi~~r~lPdk  415 (798)
                      +|-.||..+  +..   +.+-.|-|++.....+.++....|+.+...    .++ ..++++...+.+|.=      -|..
T Consensus       174 fiLit~~~~--~ll---~TI~SRCq~~~f~pL~~~di~~~L~~i~~~----~~~-~~~~~~~~l~~~a~G------S~~~  237 (352)
T PRK09112        174 FILISHSSG--RLL---PTIRSRCQPISLKPLDDDELKKALSHLGSK----QGI-SAGEETEALLQRSEG------SVRK  237 (352)
T ss_pred             EEEEECCHH--HCH---HHHHHHCCCCCCCCCCHHHHHHHHHHHHHC----CCC-CCHHHHHHHHHHHCC------CHHH
T ss_conf             998869977--776---899974332148893989999999987512----689-987999999987089------9889


Q ss_pred             HHHHHHHHHH
Q ss_conf             9889986533
Q gi|254780163|r  416 AIDVIDEAGA  425 (798)
Q Consensus       416 AidllDea~a  425 (798)
                      |+.|++.-|.
T Consensus       238 Al~L~~~~gl  247 (352)
T PRK09112        238 ALLLLNYGGL  247 (352)
T ss_pred             HHHHHCCCHH
T ss_conf             9987448779


No 259
>KOG0726 consensus
Probab=98.24  E-value=3.4e-06  Score=63.65  Aligned_cols=132  Identities=33%  Similarity=0.476  Sum_probs=56.7

Q ss_pred             CEEEECCCCCHHHHHHHHHHHHHHCCCCCHHHHEEEEEEEEHHHHHCCCCCCCHHHHHHHHHHHHHCCCCCEEEEECCHH
Q ss_conf             74896676411668999999998548988345201445540467530634312378999999987203898399973616
Q gi|254780163|r  227 NPLYVGDPGVGKTAIAEGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIESYANAILYIDEIH  306 (798)
Q Consensus       227 n~~lvG~~gvGktaive~la~~i~~~~vp~~l~~~~i~~ld~~~l~ag~~~rg~fe~r~~~~~~~~~~~~~~ilfideih  306 (798)
                      .+||-|+||.|||-++..+|..    .-..+|+   ++   .+-||  .||-|+=-.-++.++.-+..+.+.|.|||||.
T Consensus       221 GVIlyG~PGTGKTLLAKAVANq----TSATFlR---vv---GseLi--QkylGdGpklvRqlF~vA~e~apSIvFiDEId  288 (440)
T KOG0726         221 GVILYGEPGTGKTLLAKAVANQ----TSATFLR---VV---GSELI--QKYLGDGPKLVRELFRVAEEHAPSIVFIDEID  288 (440)
T ss_pred             EEEEECCCCCCHHHHHHHHHCC----CCHHHHH---HH---HHHHH--HHHHCCCHHHHHHHHHHHHHCCCCEEEEEHHH
T ss_conf             0588679997536888877245----5212455---65---08999--98736551999999988875298269864001


Q ss_pred             HHHCCC---CCCCCC-------CCHHHHHHHHHCCCCEEEEEECCHHHHHHHHHCCHHHHH--HC-EEEEECCCCHHHHH
Q ss_conf             630155---444344-------777888876630266038873048999998520111432--00-14430687868999
Q gi|254780163|r  307 TLVGAG---SASGIS-------VDASNLLKPALSSGAVRCIGSTTYSEYRQFFEKDKALVR--RF-QKIDVSEPSIEDAI  373 (798)
Q Consensus       307 ~ligag---~~~g~~-------~d~an~lkP~L~rg~~~~IgatT~~ey~~~~e~d~al~r--rF-~~i~v~ep~~~~~~  373 (798)
                      .+ |.-   +++|+.       +..-|-|--.=+||++++|.||.--|     .-||||-|  |. .+|..+-|+..+-.
T Consensus       289 Ai-GtKRyds~SggerEiQrtmLELLNQldGFdsrgDvKvimATnrie-----~LDPaLiRPGrIDrKIef~~pDe~Tkk  362 (440)
T KOG0726         289 AI-GTKRYDSNSGGEREIQRTMLELLNQLDGFDSRGDVKVIMATNRIE-----TLDPALIRPGRIDRKIEFPLPDEKTKK  362 (440)
T ss_pred             HH-CCCCCCCCCCHHHHHHHHHHHHHHHCCCCCCCCCEEEEEECCCCC-----CCCHHHCCCCCCCCCCCCCCCCHHHHC
T ss_conf             10-452134788507899999999987426866567758997416534-----467755278754311125797556323


Q ss_pred             HHH
Q ss_conf             999
Q gi|254780163|r  374 EIV  376 (798)
Q Consensus       374 ~iL  376 (798)
                      +|.
T Consensus       363 kIf  365 (440)
T KOG0726         363 KIF  365 (440)
T ss_pred             EEE
T ss_conf             156


No 260
>TIGR02880 cbbX_cfxQ CbbX protein; InterPro: IPR000470 Proteins in this family are now designated CbbX. Some previously were CfxQ (carbon fixation Q). Its gene is often found immmediately downstream of the Rubisco large and small chain genes, and it is suggested to be necessary for Rubisco expression. CbbX has been shown to be necessary for photoautotrophic growth. The Cfx genes in Alcaligenes eutrophus encode a number of Calvin cycle enzymes . The observed sizes of two of the gene products, CfxX and CfxY, are 35 kDa and 27 kDa respectively . No functions could be assigned to CfxX and CfxY. These proteins show a high degree of similarity to the Bacillus subtilis stage V sporulation protein K . ; GO: 0005524 ATP binding.
Probab=98.23  E-value=0.0001  Score=52.97  Aligned_cols=215  Identities=17%  Similarity=0.309  Sum_probs=146.8

Q ss_pred             CHHHHHHHCHHHHHHHHHHH-------HHHHHCCCCCCCCCCCEEEEECCCCHHHHHHHHHHHH-------HCCCCEEEE
Q ss_conf             00246653458999999999-------8775204456578740688614320038899999873-------047733772
Q gi|254780163|r  473 KNLGTVVYGQEEAIKKLSSS-------IKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAF-------ALGVQLLRF  538 (798)
Q Consensus       473 ~~l~~~v~GQ~~ai~~v~~~-------i~~~~~gl~~~~rP~g~flf~GptGvGKTelak~la~-------~~~~~lir~  538 (798)
                      +.|.+.+||-...-..|-+.       -.|...||.. ..|.--+-|+|.+|+|||..|..+|.       --...+|.+
T Consensus        18 ~~l~~~l~Gl~Pvk~r~~~~a~lllv~~~r~~~~l~~-~~P~lhm~ftG~PGtGkttva~~m~~~l~~lGy~r~G~~~~~   96 (284)
T TIGR02880        18 DQLDRELIGLKPVKTRIREIAALLLVERLRQKLGLAS-AAPSLHMSFTGNPGTGKTTVALRMAQILHRLGYVRKGHLVSV   96 (284)
T ss_pred             HHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHH-CCCCEEEEECCCCCCCHHHHHHHHHHHHHHCCCCCCCCEEEE
T ss_conf             9876762164158899999999999999998742210-488326775168987248999999999987154003626785


Q ss_pred             EHHHHHCCCCCCHHCCCCCHHCCCCCCCCCCHHHHHCCCEEEEECCHHHCC---------HHHHHHHHHHHHHHHCCCCC
Q ss_conf             068861246530110478000256444310035551585177740445502---------89999999987775021779
Q gi|254780163|r  539 DMSEYMERHAVSRLIGAPPGYVGFGQGGILADSVDQNPYSVVLLDEIEKSH---------PDVLNILLQIMDYGILTDQS  609 (798)
Q Consensus       539 dmsey~e~~~vs~LiGappGYvG~~egg~Lte~vr~~P~sVvl~DEiEKAh---------~~v~~~llqild~G~ltd~~  609 (798)
                      -         -.-|+|.   ||||... .--|-+++.--+|++.||--.-+         .+-..+|||++++-      
T Consensus        97 t---------rddlvGq---y~GhtaP-ktke~lk~a~GGvlfideayyly~P~nerdyG~eaieillq~men~------  157 (284)
T TIGR02880        97 T---------RDDLVGQ---YIGHTAP-KTKEVLKRAMGGVLFIDEAYYLYRPDNERDYGQEAIEILLQVMENQ------  157 (284)
T ss_pred             E---------HHHHHHH---HHCCCCC-HHHHHHHHHCCCEEEEECHHHHCCCCCCCHHHHHHHHHHHHHHHCC------
T ss_conf             3---------0013112---2125772-2689998742873664220332177641022379999999987236------


Q ss_pred             CCEECCCCEEEEEECCCCHHHHHHCCCCCCCCCCHHHHHHHHHHHC--CHHHHCCCCEEEECCCCCHHHHHHHHHHHHHH
Q ss_conf             9776125429999424214553303689882111488999998728--87881776828962889999999999999999
Q gi|254780163|r  610 GKKISFRNVILIMTTNAGALEMSKARIGFGSSRNDDADKEALRNFL--SPEFLNRLDSIIPFFPLSSDIIRQVVHKFIMK  687 (798)
Q Consensus       610 Gr~vdf~n~iii~TsN~G~~~~~~~~~g~~~~~~~~~~~~~l~~~f--~peflnRid~ii~F~~l~~~~~~~i~~~~l~~  687 (798)
                        .-   +.+||+.             |+         .+.+..+|  .|-|-.|+-.-|-|-..+.+++..|...+|.+
T Consensus       158 --r~---~lvvi~a-------------Gy---------~~rm~~f~~snPG~~sr~a~h~~fPdy~~~~l~~ia~~~l~~  210 (284)
T TIGR02880       158 --RD---DLVVILA-------------GY---------KDRMDSFFESNPGLSSRVAHHVDFPDYSEEELLAIAELMLEE  210 (284)
T ss_pred             --CC---CEEEEEE-------------CC---------HHHHHHHHHCCCCHHHHHHHHCCCCCCCHHHHHHHHHHHHHH
T ss_conf             --55---3788871-------------70---------788888751178624677643158887767899999998865


Q ss_pred             HHHHHHHCCCEEEECHHHHHHHHHCCCCCCC-CCHHHHHHHHHHHHHHHHHHH
Q ss_conf             9999986698899988999999971898101-532679999986235999999
Q gi|254780163|r  688 LELQLQEKGISFHFSEEVINWLVSHGYDVKM-GARPLERIIKEHVKVPLADEI  739 (798)
Q Consensus       688 l~~~l~~~~i~l~~~~~~~~~l~~~~~~~~~-GAR~l~r~i~~~i~~~la~~i  739 (798)
                      -.-++.     -+......+|+..+-..|.| .||+++..|++.=...-...+
T Consensus       211 ~~y~~~-----~~~~~~~~~y~~~r~~~P~f~nars~rna~dr~rlr~a~rl~  258 (284)
T TIGR02880       211 QQYRLS-----AEAEEALADYIALRRKQPFFANARSIRNALDRARLRQANRLL  258 (284)
T ss_pred             HHCCHH-----HHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             412111-----889999999999863178314678899999889888899999


No 261
>COG1224 TIP49 DNA helicase TIP49, TBP-interacting protein [Transcription]
Probab=98.23  E-value=7.7e-05  Score=53.92  Aligned_cols=44  Identities=41%  Similarity=0.671  Sum_probs=35.7

Q ss_pred             CEEEECCCCCHHHHHHHHHHHHHHCCCCCH-HHHEEEEEEEEHHHH
Q ss_conf             748966764116689999999985489883-452014455404675
Q gi|254780163|r  227 NPLYVGDPGVGKTAIAEGFAKQIVDGMVPD-ILLGARIFSLDMGNL  271 (798)
Q Consensus       227 n~~lvG~~gvGktaive~la~~i~~~~vp~-~l~~~~i~~ld~~~l  271 (798)
                      -++++|+||.|||||+-|+|+-.-. +||- .+.+-.||++++...
T Consensus        67 giLi~GppgTGKTAlA~gIa~eLG~-dvPF~~isgsEiYS~E~kKT  111 (450)
T COG1224          67 GILIVGPPGTGKTALAMGIARELGE-DVPFVAISGSEIYSLEVKKT  111 (450)
T ss_pred             EEEEECCCCCCHHHHHHHHHHHHCC-CCCCEEECCCEEEEECCCHH
T ss_conf             7999789997688999999998589-99821501332233100088


No 262
>PRK11608 pspF phage shock protein operon transcriptional activator; Provisional
Probab=98.21  E-value=2.2e-05  Score=57.84  Aligned_cols=145  Identities=21%  Similarity=0.295  Sum_probs=87.1

Q ss_pred             CCCHHHHHHHHHHHHHHHHHHC--CCCCCEEEECCCCCHHHHHHHHHHHHHHCCCCCHHHHEEEEEEEEHHHHHC-----
Q ss_conf             8611222178999999998622--677874896676411668999999998548988345201445540467530-----
Q gi|254780163|r  201 GKVDILVGRHEEINRTIQILCR--RSKNNPLYVGDPGVGKTAIAEGFAKQIVDGMVPDILLGARIFSLDMGNLIA-----  273 (798)
Q Consensus       201 GKLDPVIGRd~EI~riiqIL~R--R~KNn~~lvG~~gvGktaive~la~~i~~~~vp~~l~~~~i~~ld~~~l~a-----  273 (798)
                      |-.|-+||...-++++.+.+.|  ++..++++.||+|+||+.++..+-..=-.       .+..++.+|.+.+-.     
T Consensus         3 ~~~~~liG~S~~m~~v~~~~~~~A~~~~pVLI~GE~GtGK~~~Ar~IH~~S~r-------~~~pfi~v~C~~l~~~~~e~   75 (325)
T PRK11608          3 EYKDNLLGEANSFLEVLEQVSHLAPLDKPVLIIGERGTGKELIASRLHYLSSR-------WQGPFISLNCAALNENLLDS   75 (325)
T ss_pred             CCCCCCEECCHHHHHHHHHHHHHHCCCCCEEEECCCCCCHHHHHHHHHHCCCC-------CCCCCEEEECCCCCHHHHHH
T ss_conf             77899858999999999999999688999898898983799999999965886-------79997788779899778899


Q ss_pred             ---C--------C--CCCCHHHHHHHHHHHHHCCCCCEEEEECCHHHHHCCCCCCCCCCCHHHHHHHHHCCC--------
Q ss_conf             ---6--------3--431237899999998720389839997361663015544434477788887663026--------
Q gi|254780163|r  274 ---G--------T--RYRGDFEERIKKIVKEIESYANAILYIDEIHTLVGAGSASGISVDASNLLKPALSSG--------  332 (798)
Q Consensus       274 ---g--------~--~~rg~fe~r~~~~~~~~~~~~~~ilfideih~ligag~~~g~~~d~an~lkP~L~rg--------  332 (798)
                         |        +  ...|-||           ...+--||+|||+.+         +.++-.-|--+|..|        
T Consensus        76 ~LFG~~~g~~~~~~~~~~g~le-----------~a~gGTL~L~eI~~l---------~~~~Q~~Ll~~l~~~~~~r~g~~  135 (325)
T PRK11608         76 ELFGHEAGAFTGAQKRHPGRFE-----------RADGGTLFLDELATA---------PMLVQEKLLRVIEYGELERVGGS  135 (325)
T ss_pred             HHCCCCCCCCCCCCCCCCCHHH-----------CCCCCEEEEECHHHC---------CHHHHHHHHHHHHCCCEEECCCC
T ss_conf             8727755676775324687343-----------568986997374547---------99999999999864908857998


Q ss_pred             -----CEEEEEECCHHHHHHHHHCCH---HHHHHCEEEEECCCCHHHHH
Q ss_conf             -----603887304899999852011---14320014430687868999
Q gi|254780163|r  333 -----AVRCIGSTTYSEYRQFFEKDK---ALVRRFQKIDVSEPSIEDAI  373 (798)
Q Consensus       333 -----~~~~IgatT~~ey~~~~e~d~---al~rrF~~i~v~ep~~~~~~  373 (798)
                           ++|+|++|+-+ ..+.++...   -|-.||..+.|.=|+-.+-.
T Consensus       136 ~~~~~~~RiIa~t~~~-l~~lv~~g~fr~dLy~rL~~~~I~lPpLReR~  183 (325)
T PRK11608        136 QPLQVNVRLVCATNAD-LPAMVNEGTFRADLLDRLAFDVVQLPPLRERQ  183 (325)
T ss_pred             CCCCCCEEEEECCCHH-HHHHHHHCCCHHHHHHHHHHHHCCCCCHHHCC
T ss_conf             7665646887133220-89999839567999856530111586845471


No 263
>PRK06835 DNA replication protein DnaC; Validated
Probab=98.21  E-value=2.6e-05  Score=57.38  Aligned_cols=129  Identities=20%  Similarity=0.223  Sum_probs=81.7

Q ss_pred             CHHHHHHHHHHHHHHHHCCCCCCCCCCCEEEEECCCCHHHHHHHHHHHHHC---CCCEEEEEHHHHHCCCCCCHHCCCCC
Q ss_conf             458999999999877520445657874068861432003889999987304---77337720688612465301104780
Q gi|254780163|r  481 GQEEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFAL---GVQLLRFDMSEYMERHAVSRLIGAPP  557 (798)
Q Consensus       481 GQ~~ai~~v~~~i~~~~~gl~~~~rP~g~flf~GptGvGKTelak~la~~~---~~~lir~dmsey~e~~~vs~LiGapp  557 (798)
                      .--+.+..+....+..-.....   +-.++||.||||||||.||-++|..+   +...+-+...++.+.-.-.+.-    
T Consensus       160 sprenm~~i~~~~~~fi~~F~~---~~~nLlf~G~~G~GKTfLa~~IA~ell~~g~sViy~ta~~L~~~l~~~~~~----  232 (330)
T PRK06835        160 SPRENMENILEKCLNFIKNFDK---NNENLLFYGNTGTGKTFLSNCIAKELLDRGKTVIYRTSDELIENLREIRFN----  232 (330)
T ss_pred             CHHHHHHHHHHHHHHHHHHCCC---CCCCEEEECCCCCCHHHHHHHHHHHHHHCCCEEEEEEHHHHHHHHHHHHCC----
T ss_conf             9899999999999999872478---888669889999988999999999999879949996299999999997545----


Q ss_pred             HHCCCCCC--CCCCHHHHHCCCEEEEECCH--HHCCHHHHHHHHHHHHHHHCCCCCCCEECCCCEEEEEECCCCHHHHHH
Q ss_conf             00256444--31003555158517774044--550289999999987775021779977612542999942421455330
Q gi|254780163|r  558 GYVGFGQG--GILADSVDQNPYSVVLLDEI--EKSHPDVLNILLQIMDYGILTDQSGKKISFRNVILIMTTNAGALEMSK  633 (798)
Q Consensus       558 GYvG~~eg--g~Lte~vr~~P~sVvl~DEi--EKAh~~v~~~llqild~G~ltd~~Gr~vdf~n~iii~TsN~G~~~~~~  633 (798)
                           .++  -.+.+.+..  .-++++|++  |...+-+...|.+++++ |+..+         .-.|.|||+.-.++.+
T Consensus       233 -----~~~~~~~~~~~l~~--~DLLIIDDLG~E~~t~~~~~~Lf~iIN~-R~~~~---------k~tIITTNl~~~eL~~  295 (330)
T PRK06835        233 -----NDNDAPELEDLLIN--CDLLIIDDLGTESITEFSKTELFNLINK-RLLMN---------KKMIISTNLSLEELLK  295 (330)
T ss_pred             -----CCCCHHHHHHHHHH--CCEEEEECCCCCCCCHHHHHHHHHHHHH-HHHCC---------CCEEEECCCCHHHHHH
T ss_conf             -----76448999999961--8989972103455886899999999999-98679---------9979988999899999


No 264
>PRK07399 DNA polymerase III subunit delta'; Validated
Probab=98.20  E-value=0.00018  Score=51.27  Aligned_cols=193  Identities=20%  Similarity=0.214  Sum_probs=114.8

Q ss_pred             CCHHHHHHHHHHHHHHHHHHCCCCCCE-EEECCCCCHHHHHHHHHHHHHHCCCCCHHHHEEEEE--------EEEHHHHH
Q ss_conf             611222178999999998622677874-896676411668999999998548988345201445--------54046753
Q gi|254780163|r  202 KVDILVGRHEEINRTIQILCRRSKNNP-LYVGDPGVGKTAIAEGFAKQIVDGMVPDILLGARIF--------SLDMGNLI  272 (798)
Q Consensus       202 KLDPVIGRd~EI~riiqIL~RR~KNn~-~lvG~~gvGktaive~la~~i~~~~vp~~l~~~~i~--------~ld~~~l~  272 (798)
                      .++.|||-+.-++.+...+...+=.+. +++|+.|+||++.+..+|+.+...+-+..-..+++.        -+......
T Consensus         2 ~F~~iiGq~~~~~~L~~ai~~~rl~hAyLF~Gp~G~GK~~~A~~fa~~Ll~~~~~~~~~~~ri~~~nHPDl~~i~P~~~~   81 (314)
T PRK07399          2 LFANLIGQPLAIELLTAAIEQNRIAPAYLFAGPEGVGRKLAALRFIEGLLSQGSPSKNIRRRLEEGNHPDLLWVEPTYQH   81 (314)
T ss_pred             CCCCCCCCHHHHHHHHHHHHCCCCCCEEEEECCCCCCHHHHHHHHHHHHHCCCCCCCCHHHHHHCCCCCCEEEEECCCCC
T ss_conf             83312594999999999998599674487789998329999999999985789999766558751899977886056200


Q ss_pred             CCCCCCC-HHH--------------HHHHHHHHHHCC----CCCEEEEECCHHHHHCCCCCCCCCCCHHHHHHHHHC-CC
Q ss_conf             0634312-378--------------999999987203----898399973616630155444344777888876630-26
Q gi|254780163|r  273 AGTRYRG-DFE--------------ERIKKIVKEIES----YANAILYIDEIHTLVGAGSASGISVDASNLLKPALS-SG  332 (798)
Q Consensus       273 ag~~~rg-~fe--------------~r~~~~~~~~~~----~~~~ilfideih~ligag~~~g~~~d~an~lkP~L~-rg  332 (798)
                      .|..+-. +++              +.++.+...+..    .+.-|..||+.|++         +..|+|-|-=.|. -+
T Consensus        82 ~g~~~~~~~~~~~~~~~~~~~~I~idqIR~l~~~l~~~p~~~~~kVvII~~ae~m---------~~~AaNaLLKtLEEP~  152 (314)
T PRK07399         82 QGKLITASEAEEAGLKRKSPPQIRLEQIREIKRFLSRPPLEAPRKVVVIEDAETM---------NEAAANALLKTLEEPG  152 (314)
T ss_pred             CCCCCCHHHHHHHHHHCCCCCCCCHHHHHHHHHHHCCCCCCCCCEEEEECCHHHC---------CHHHHHHHHHHHCCCC
T ss_conf             3454557789876530268777879999999999731885688479998897871---------9999999998614787


Q ss_pred             CEEEEEECCHHHHHHHHHCCHHHHHHCEEEEECCCCHHHHHHHHHHHHHHHHHHCCCEECCHHHHHHHHHHHHHCCCCCC
Q ss_conf             60388730489999985201114320014430687868999999861276654103512111789999986542015556
Q gi|254780163|r  333 AVRCIGSTTYSEYRQFFEKDKALVRRFQKIDVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKL  412 (798)
Q Consensus       333 ~~~~IgatT~~ey~~~~e~d~al~rrF~~i~v~ep~~~~~~~iL~~~~~~ye~~h~v~~~~~al~~av~ls~ryi~~r~l  412 (798)
                      .-.+|=.|+..+  +.   =+-+..|-|.|.....+.++-..+|......  .  .-.+..   .+.+.+|.      --
T Consensus       153 ~~~fILit~~~~--~l---LpTI~SRCQ~i~F~~l~~~~i~~~L~~~~~~--~--~~~~~~---~~l~~~A~------Gs  214 (314)
T PRK07399        153 NGTLILIAPSPE--SL---LPTIVSRCQIIPFYRLSDEQLEQVLKRLGDN--I--NEILDH---PELLALAQ------GS  214 (314)
T ss_pred             CCEEEEEECCHH--HC---CHHHHCCCEEEECCCCCHHHHHHHHHHCCCC--C--CCCCCH---HHHHHHHC------CC
T ss_conf             856999979936--49---1466418756338998999999999971664--3--310278---99998817------99


Q ss_pred             HHHHHHHHH
Q ss_conf             467988998
Q gi|254780163|r  413 PDKAIDVID  421 (798)
Q Consensus       413 PdkAidllD  421 (798)
                      |++|++.++
T Consensus       215 pG~a~~~~~  223 (314)
T PRK07399        215 PGAAIANIE  223 (314)
T ss_pred             HHHHHHHHH
T ss_conf             799999999


No 265
>pfam01078 Mg_chelatase Magnesium chelatase, subunit ChlI. Magnesium-chelatase is a three-component enzyme that catalyses the insertion of Mg2+ into protoporphyrin IX. This is the first unique step in the synthesis of (bacterio)chlorophyll. Due to this, it is thought that Mg-chelatase has an important role in channelling inter- mediates into the (bacterio)chlorophyll branch in response to conditions suitable for photosynthetic growth. ChlI and BchD have molecular weight between 38-42 kDa.
Probab=98.19  E-value=1.2e-05  Score=59.86  Aligned_cols=144  Identities=24%  Similarity=0.377  Sum_probs=77.2

Q ss_pred             HHHHHHHHHHHHHHH-HCCCCCCEEEECCCCCHHHHHHHHHHHHHHCCCCCHHHHEEEEEE-------------------
Q ss_conf             221789999999986-226778748966764116689999999985489883452014455-------------------
Q gi|254780163|r  206 LVGRHEEINRTIQIL-CRRSKNNPLYVGDPGVGKTAIAEGFAKQIVDGMVPDILLGARIFS-------------------  265 (798)
Q Consensus       206 VIGRd~EI~riiqIL-~RR~KNn~~lvG~~gvGktaive~la~~i~~~~vp~~l~~~~i~~-------------------  265 (798)
                      |+|.+. .+|.++|= +..  .|.+|+|+||+|||.+++.++.-.-.-..-+.+.-..|++                   
T Consensus         5 i~GQ~~-akrAl~iAaaG~--H~lLl~GpPG~GKTmlA~rl~~iLP~l~~~e~le~~~i~S~~g~~~~~~l~~~rPfr~P   81 (207)
T pfam01078         5 VKGQEQ-AKRALEIAAAGG--HNLLMIGPPGSGKTMLAKRLPGILPPLTEQEALEVTAIHSVAGLGGDGGLIRRRPFRAP   81 (207)
T ss_pred             HCCCHH-HHHHHHHHHCCC--CCEEEECCCCCCHHHHHHHHHCCCCCCCHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCC
T ss_conf             638599-999999985478--75897889980299999763014899878998877764230368777774457986578


Q ss_pred             ---EEHHHHHCCCCCCCHHHHHHHHHHHHHCCCCCEEEEECCHHHHHCCCCCCCCCCCHHHHHHHHHCCCCEEE------
Q ss_conf             ---40467530634312378999999987203898399973616630155444344777888876630266038------
Q gi|254780163|r  266 ---LDMGNLIAGTRYRGDFEERIKKIVKEIESYANAILYIDEIHTLVGAGSASGISVDASNLLKPALSSGAVRC------  336 (798)
Q Consensus       266 ---ld~~~l~ag~~~rg~fe~r~~~~~~~~~~~~~~ilfideih~ligag~~~g~~~d~an~lkP~L~rg~~~~------  336 (798)
                         ....+|+-|-. .        ----|+..+-+=|||+||+.-.         +-++-+.|...|+.|++.+      
T Consensus        82 Hhs~s~~aliGGg~-~--------~~PGeIslAH~GVLFLDE~~Ef---------~~~vle~LrqpLE~~~v~IsRa~~~  143 (207)
T pfam01078        82 HHSASAAALVGGGS-I--------PRPGEISLAHNGVLFLDELPEF---------SRRVLESLRQPLEDGEITISRARAK  143 (207)
T ss_pred             CCCCCHHHCCCCCC-C--------CCCCCEEECCCCEEEECCHHHC---------CHHHHHHHHHHHCCCCEEEEECCCE
T ss_conf             87643633226888-8--------9997066636878884764653---------9889999987660494899956758


Q ss_pred             ---------EEEC-----------------CHHHHHHHHHC-CHHHHHHCEE-EEECCCCHH
Q ss_conf             ---------8730-----------------48999998520-1114320014-430687868
Q gi|254780163|r  337 ---------IGST-----------------TYSEYRQFFEK-DKALVRRFQK-IDVSEPSIE  370 (798)
Q Consensus       337 ---------Igat-----------------T~~ey~~~~e~-d~al~rrF~~-i~v~ep~~~  370 (798)
                               |+|+                 |+.+-++|..| ...|-.||.. |.|..++.+
T Consensus       144 ~~~PA~f~LvaA~NPCpCG~~~~~~~~C~C~~~~~~~Y~~rlSgPllDRiDl~v~~~~~~~~  205 (207)
T pfam01078       144 VTFPARFQLVAAMNPCPCGYLGDPDKRCRCTPRQIRRYLSRLSGPLLDRIDLQVEVPRLSAE  205 (207)
T ss_pred             EEECCCEEEEEECCCCCCCCCCCCCCCCCCCHHHHHHHHHHCCHHHHCCEEEEEECCCCCHH
T ss_conf             98604348888505777787889999757889999999876452202068789977899957


No 266
>PRK11331 5-methylcytosine-specific restriction enzyme subunit McrB; Provisional
Probab=98.18  E-value=1.4e-05  Score=59.25  Aligned_cols=147  Identities=24%  Similarity=0.288  Sum_probs=90.7

Q ss_pred             HHHHHHHHHCCCCCCEEEECCCCCHHHHHHHHHHHHHHCCCCCHHHHEEEEE-EEEHHHHHCCCCC-CCHHH---HHHHH
Q ss_conf             9999998622677874896676411668999999998548988345201445-5404675306343-12378---99999
Q gi|254780163|r  213 INRTIQILCRRSKNNPLYVGDPGVGKTAIAEGFAKQIVDGMVPDILLGARIF-SLDMGNLIAGTRY-RGDFE---ERIKK  287 (798)
Q Consensus       213 I~riiqIL~RR~KNn~~lvG~~gvGktaive~la~~i~~~~vp~~l~~~~i~-~ld~~~l~ag~~~-rg~fe---~r~~~  287 (798)
                      |+..  +++-++|-|+||-|.||+|||-++..||.-+..++.|....-..+. +.+-...+-|-+- -+.|+   ..+..
T Consensus       184 i~~~--~~sLktKknvIL~G~pGtGKT~lAk~lA~~l~g~~~~~rv~~VqfhpsysYEDfi~Gyrp~~~gf~~~~G~f~~  261 (459)
T PRK11331        184 IETI--LKRLTIKKNIILQGPPGVGKTFVARRLAYLLTGEKAPQRVNMVQFHQSYSYEDFIQGYRPNGVGFRRKDGIFYN  261 (459)
T ss_pred             HHHH--HHHHCCCCCEEEECCCCCCHHHHHHHHHHHHHCCCCCCCEEEEEECCCCCHHHHHCCCCCCCCCCEECCCHHHH
T ss_conf             9999--99854588279658999887899999999970788778468998358866178764605688861326836999


Q ss_pred             HHHHHCCCC--CEEEEECCHH------------HHHCCCCCCCCCCCHHHHHHHHHC--------CCCEEEEEECCHHHH
Q ss_conf             998720389--8399973616------------630155444344777888876630--------266038873048999
Q gi|254780163|r  288 IVKEIESYA--NAILYIDEIH------------TLVGAGSASGISVDASNLLKPALS--------SGAVRCIGSTTYSEY  345 (798)
Q Consensus       288 ~~~~~~~~~--~~ilfideih------------~ligag~~~g~~~d~an~lkP~L~--------rg~~~~IgatT~~ey  345 (798)
                      +.+.+++++  +-++.||||.            +++-+-+... .+   .+-.|+..        -..+-+||...... 
T Consensus       262 ~~~~A~~~p~~~y~~iideinr~~~~~~fgel~~liE~dkR~~-~~---~~~l~ys~~~~~~f~vP~Nl~iigtmNtad-  336 (459)
T PRK11331        262 FCQQAKEQPEKKYVFIIDEINRANLSKVFGEVMMLMEHDKRGE-NW---SVPLTYSENDEERFYVPENVYIIGLMNTAD-  336 (459)
T ss_pred             HHHHHHHCCCCCEEEEEEHHHCCCHHHHHHHHHHHHHHCCCCC-CC---EEEEECCCCCCCEECCCCCEEEEEECCCCC-
T ss_conf             9999984989876999843203388999999999964125676-52---256300368885334688659998503341-


Q ss_pred             HHHHHCCHHHHHHCEEEEECC
Q ss_conf             998520111432001443068
Q gi|254780163|r  346 RQFFEKDKALVRRFQKIDVSE  366 (798)
Q Consensus       346 ~~~~e~d~al~rrF~~i~v~e  366 (798)
                      |.+---|.||.|||.-+.+.+
T Consensus       337 rs~~~~d~alrRrf~f~~~~p  357 (459)
T PRK11331        337 RSLAVVDYALRRRFSFIDIEP  357 (459)
T ss_pred             HHHHHHHHHHHHHHCCEECCC
T ss_conf             068878999986502121589


No 267
>PRK08769 DNA polymerase III subunit delta'; Validated
Probab=98.18  E-value=0.00039  Score=48.89  Aligned_cols=120  Identities=19%  Similarity=0.281  Sum_probs=77.2

Q ss_pred             HHHHHHHHHHHHHHHHCCCCCCCCCCCEEEEECCCCHHHHHHHHHHHHHC-CCCEEEEEHHHHHCCCCCCHHC--CCCCH
Q ss_conf             58999999999877520445657874068861432003889999987304-7733772068861246530110--47800
Q gi|254780163|r  482 QEEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFAL-GVQLLRFDMSEYMERHAVSRLI--GAPPG  558 (798)
Q Consensus       482 Q~~ai~~v~~~i~~~~~gl~~~~rP~g~flf~GptGvGKTelak~la~~~-~~~lir~dmsey~e~~~vs~Li--GappG  558 (798)
                      |..+.+.+..++...|.       | -.+||.||.|+||+.+|+.+|..+ ....   |.   .......+++  |+-|-
T Consensus         9 q~~~~~~L~~~i~~~rl-------~-HA~Lf~Gp~G~GK~~~A~~~A~~llc~~~---~~---~~~~~~~~~i~~g~HPD   74 (319)
T PRK08769          9 QQRAFDQTVAALDAGRL-------G-HGLLICGPEGLGKRAVALALAEHVLASGP---DP---ALAQRTRQLIAAGTHPD   74 (319)
T ss_pred             CHHHHHHHHHHHHCCCC-------C-CEEEEECCCCCCHHHHHHHHHHHHHCCCC---CC---CCCCHHHHHHHCCCCCC
T ss_conf             68999999999976994-------2-06875899987899999999999837997---97---65433889996689989


Q ss_pred             HCCC----CCC-------------CCCCHHHHHCC----CEEEEECCHHHCCHHHHHHHHHHHHHHHCCCCCCCEECCCC
Q ss_conf             0256----444-------------31003555158----51777404455028999999998777502177997761254
Q gi|254780163|r  559 YVGF----GQG-------------GILADSVDQNP----YSVVLLDEIEKSHPDVLNILLQIMDYGILTDQSGKKISFRN  617 (798)
Q Consensus       559 YvG~----~eg-------------g~Lte~vr~~P----~sVvl~DEiEKAh~~v~~~llqild~G~ltd~~Gr~vdf~n  617 (798)
                      |.--    ++.             -.|.+.+...|    |-|+++|+.|+..++-.|.||..|+|=-           .+
T Consensus        75 ~~~i~~~~~~~~~k~k~~I~IdqiR~l~~~~~~~p~~g~~KV~IId~Ad~mn~~AaNalLK~LEEPp-----------~~  143 (319)
T PRK08769         75 LQLVSFIPNRTGDKLRTEIVIEQVREISQKLALTPQYGIAQVVIVDPADAINRSACNALLKTLEEPS-----------PG  143 (319)
T ss_pred             EEEEECCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCCCCEEEEECCHHHCCHHHHHHHHHHHCCCC-----------CC
T ss_conf             6877534444543112348699999999996137202795699980667528999999999822799-----------88


Q ss_pred             EEEEEECCC
Q ss_conf             299994242
Q gi|254780163|r  618 VILIMTTNA  626 (798)
Q Consensus       618 ~iii~TsN~  626 (798)
                      ++||++|+-
T Consensus       144 ~~~iL~~~~  152 (319)
T PRK08769        144 RYLWLISAQ  152 (319)
T ss_pred             EEEEEEECC
T ss_conf             489998699


No 268
>PRK07471 DNA polymerase III subunit delta'; Validated
Probab=98.17  E-value=0.00051  Score=48.03  Aligned_cols=191  Identities=16%  Similarity=0.182  Sum_probs=115.7

Q ss_pred             HHHHHHHHHHHHHHHHHCCCCCCE-EEECCCCCHHHHHHHHHHHHHHCCCCCHHHHE-E--EEEEEE----HHHHH-CC-
Q ss_conf             222178999999998622677874-89667641166899999999854898834520-1--445540----46753-06-
Q gi|254780163|r  205 ILVGRHEEINRTIQILCRRSKNNP-LYVGDPGVGKTAIAEGFAKQIVDGMVPDILLG-A--RIFSLD----MGNLI-AG-  274 (798)
Q Consensus       205 PVIGRd~EI~riiqIL~RR~KNn~-~lvG~~gvGktaive~la~~i~~~~vp~~l~~-~--~i~~ld----~~~l~-ag-  274 (798)
                      -|||-+.-++.+.+-+...+=.+. ++.|++||||++++..+|+.+.....+..... .  .-+.++    ....+ +| 
T Consensus        18 ~liGqe~~~~~L~~a~~~grl~HA~Lf~Gp~GiGK~tlA~~~A~~ll~~~~~~~~~~~~~~~~l~~~~~~p~~r~i~~~~   97 (363)
T PRK07471         18 ALFGHAAAEAALLDAYRSGRLHHAWLIGGPQGIGKATLAYRMARFLLATPPPGGDAVFPPPASLAVDPDHPVARRIAAGA   97 (363)
T ss_pred             CCCCHHHHHHHHHHHHHCCCCCCEEEEECCCCCCHHHHHHHHHHHHHCCCCCCCCCCCCCHHHHCCCCCCCHHHHHHCCC
T ss_conf             31681999999999998599764587679998188999999999985799977777678705312587772899995269


Q ss_pred             ---------------CCCCCHH-HHHHHHHHHHHC----CCCCEEEEECCHHHHHCCCCCCCCCCCHHHHHHHHHCC--C
Q ss_conf             ---------------3431237-899999998720----38983999736166301554443447778888766302--6
Q gi|254780163|r  275 ---------------TRYRGDF-EERIKKIVKEIE----SYANAILYIDEIHTLVGAGSASGISVDASNLLKPALSS--G  332 (798)
Q Consensus       275 ---------------~~~rg~f-e~r~~~~~~~~~----~~~~~ilfideih~ligag~~~g~~~d~an~lkP~L~r--g  332 (798)
                                     .+.+++. =+-++.+...+.    ..+.-|.-||+.|.+         +..++|-|.-.|.-  .
T Consensus        98 hpdl~~i~r~~d~k~~~~~~~I~Vd~iR~l~~~~~~~p~~g~~kV~IId~ad~m---------n~~aaNALLK~LEEPP~  168 (363)
T PRK07471         98 HGGLLTLERSWNEKGKRLRTVITVDEVRETIGFFGLTAAEGGWRVVIVDTADEM---------NANAANALLKVLEEPPA  168 (363)
T ss_pred             CCCEEEEECCCCCCCCCCCCCCCHHHHHHHHHHHCCCCCCCCCEEEEEECHHHH---------CHHHHHHHHHHHCCCCC
T ss_conf             998466762001133321244539999999999724852489669998687873---------88999999997215898


Q ss_pred             CEEEEEECC-HHHHHHHHHCCHHHHHHCEEEEECCCCHHHHHHHHHHHHHHHHHHCCCEECCHHHHHHHHHHHHHCCCCC
Q ss_conf             603887304-8999998520111432001443068786899999986127665410351211178999998654201555
Q gi|254780163|r  333 AVRCIGSTT-YSEYRQFFEKDKALVRRFQKIDVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRK  411 (798)
Q Consensus       333 ~~~~IgatT-~~ey~~~~e~d~al~rrF~~i~v~ep~~~~~~~iL~~~~~~ye~~h~v~~~~~al~~av~ls~ryi~~r~  411 (798)
                      ..-+|=.|+ ++..      =+.+-.|-|.+.....+.++-...|.       ..++..++++.+..++.+|.=      
T Consensus       169 ~t~fiLit~~~~~l------lpTI~SRCq~~~~~~l~~~~~~~~L~-------~~~~~~~~~~~~~~la~~a~G------  229 (363)
T PRK07471        169 RSLLLLVSHAPARL------LPTIRSRCRKLRLRPLAPEDVIAALA-------EAGGPALDDAELAALAALAEG------  229 (363)
T ss_pred             CEEEEEEECCHHHC------HHHHHHHCCCCCCCCCCHHHHHHHHH-------HHCCCCCCHHHHHHHHHHCCC------
T ss_conf             83899863997777------79999735242589959999999999-------843899998999999997589------


Q ss_pred             CHHHHHHHHHHH
Q ss_conf             646798899865
Q gi|254780163|r  412 LPDKAIDVIDEA  423 (798)
Q Consensus       412 lPdkAidllDea  423 (798)
                      -|.+|+.|++.-
T Consensus       230 s~~~Al~l~~~~  241 (363)
T PRK07471        230 SVGRALRLAGGD  241 (363)
T ss_pred             CHHHHHHHHCCC
T ss_conf             999999874798


No 269
>KOG0732 consensus
Probab=98.17  E-value=7.5e-06  Score=61.21  Aligned_cols=82  Identities=32%  Similarity=0.577  Sum_probs=35.5

Q ss_pred             EEECCCCHHHHHHHHHHHHHC--CCCEEEEEHHHHHCCCCCCHHCCCCCHHCCCCCC--CCCCHHHHHCCCEEEEECCHH
Q ss_conf             861432003889999987304--7733772068861246530110478000256444--310035551585177740445
Q gi|254780163|r  511 VFSGPTGVGKTEISKQLAFAL--GVQLLRFDMSEYMERHAVSRLIGAPPGYVGFGQG--GILADSVDQNPYSVVLLDEIE  586 (798)
Q Consensus       511 lf~GptGvGKTelak~la~~~--~~~lir~dmsey~e~~~vs~LiGappGYvG~~eg--g~Lte~vr~~P~sVvl~DEiE  586 (798)
                      ||.||+|+|||-+|++||...  +..-+.|.|..=.+  -.|       -|||..|-  -+|.|--+++-+||+.||||+
T Consensus       303 L~~GppGTGkTl~araLa~~~s~~~~kisffmrkgaD--~ls-------kwvgEaERqlrllFeeA~k~qPSIIffdeId  373 (1080)
T KOG0732         303 LFHGPPGTGKTLMARALAAACSRGNRKISFFMRKGAD--CLS-------KWVGEAERQLRLLFEEAQKTQPSIIFFDEID  373 (1080)
T ss_pred             EECCCCCCCHHHHHHHHHHHHCCCCCCCCHHHHCCCH--HHC-------CCCCCHHHHHHHHHHHHHCCCCEEEECCCCC
T ss_conf             3028998725688886665405411020244314844--332-------5447577889988988744485177305556


Q ss_pred             -----------HCCHHHHHHHHHHHH
Q ss_conf             -----------502899999999877
Q gi|254780163|r  587 -----------KSHPDVLNILLQIMD  601 (798)
Q Consensus       587 -----------KAh~~v~~~llqild  601 (798)
                                 +-|..|...||-+||
T Consensus       374 GlapvrSskqEqih~SIvSTLLaLmd  399 (1080)
T KOG0732         374 GLAPVRSSKQEQIHASIVSTLLALMD  399 (1080)
T ss_pred             CCCCCCCCHHHHHHHHHHHHHHHHCC
T ss_conf             64656536677744567777887604


No 270
>COG3854 SpoIIIAA ncharacterized protein conserved in bacteria [Function unknown]
Probab=98.17  E-value=2.2e-05  Score=57.85  Aligned_cols=113  Identities=30%  Similarity=0.421  Sum_probs=85.3

Q ss_pred             HHHHHHHHHCCCCCCEEEECCCCCHHHHHHHHHHHHHHCCCCCHHHHEEEEEEEEHHHHHCCCCCCC----HHHHHHH--
Q ss_conf             9999998622677874896676411668999999998548988345201445540467530634312----3789999--
Q gi|254780163|r  213 INRTIQILCRRSKNNPLYVGDPGVGKTAIAEGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRG----DFEERIK--  286 (798)
Q Consensus       213 I~riiqIL~RR~KNn~~lvG~~gvGktaive~la~~i~~~~vp~~l~~~~i~~ld~~~l~ag~~~rg----~fe~r~~--  286 (798)
                      ++-+++.|--..+.|.+++|+||||||++...+|+.+..|--  ....+++.-+|-.+=+|| -.+|    ++-.|+.  
T Consensus       125 ~~~li~~ly~~g~lntLiigpP~~GKTTlLRdiaR~~s~g~~--~~l~kkv~IiDersEIag-~~~gvpq~~~g~R~dVl  201 (308)
T COG3854         125 ANPLIKDLYQNGWLNTLIIGPPQVGKTTLLRDIARLLSDGIN--QFLPKKVGIIDERSEIAG-CLNGVPQHGRGRRMDVL  201 (308)
T ss_pred             CHHHHHHHHHCCCEEEEEECCCCCCHHHHHHHHHHHHHCCCC--CCCCCEEEEEECCCHHHC-CCCCCCHHHHHHHHHHC
T ss_conf             218899998437224699659988707799999998631511--267732899715004303-43588603232210104


Q ss_pred             -------HHHHHHCCCCCEEEEECCHHHHHCCCCCCCCCCCHHHHHHHHHCCCCEEEEEEC
Q ss_conf             -------999872038983999736166301554443447778888766302660388730
Q gi|254780163|r  287 -------KIVKEIESYANAILYIDEIHTLVGAGSASGISVDASNLLKPALSSGAVRCIGST  340 (798)
Q Consensus       287 -------~~~~~~~~~~~~ilfideih~ligag~~~g~~~d~an~lkP~L~rg~~~~Igat  340 (798)
                             .+|..+++..+-++.+|||-|          -.|+- -+.-++.+| +++|+..
T Consensus       202 d~cpk~~gmmmaIrsm~PEViIvDEIGt----------~~d~~-A~~ta~~~G-Vkli~Ta  250 (308)
T COG3854         202 DPCPKAEGMMMAIRSMSPEVIIVDEIGT----------EEDAL-AILTALHAG-VKLITTA  250 (308)
T ss_pred             CCCHHHHHHHHHHHHCCCCEEEEECCCC----------HHHHH-HHHHHHHCC-CEEEEEE
T ss_conf             6561788899999954995799834364----------77799-999998548-5899950


No 271
>PRK12422 chromosomal replication initiation protein; Provisional
Probab=98.16  E-value=0.00021  Score=50.78  Aligned_cols=205  Identities=14%  Similarity=0.233  Sum_probs=112.3

Q ss_pred             CCHHHHHHHCHHHHHHH-HHHHHHHHHCCCCCCCCCCCEEEEECCCCHHHHHHHHHHHHHC---CCCEEEEEHHHHHCCC
Q ss_conf             00024665345899999-9999877520445657874068861432003889999987304---7733772068861246
Q gi|254780163|r  472 EKNLGTVVYGQEEAIKK-LSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFAL---GVQLLRFDMSEYMERH  547 (798)
Q Consensus       472 ~~~l~~~v~GQ~~ai~~-v~~~i~~~~~gl~~~~rP~g~flf~GptGvGKTelak~la~~~---~~~lir~dmsey~e~~  547 (798)
                      +-.+..-|+|-...... .+.++..  +--..++.|---++..|++|.|||.|..+++-..   ....+-+...+|+...
T Consensus       107 ~ytFd~FVvG~~N~lA~~aa~~va~--~~~~~~g~~yNPLfIyG~~GlGKTHLL~AIgn~i~~~~~kV~Yvtae~F~~~~  184 (455)
T PRK12422        107 EMTFANFLVTPENDLPFRILQEFAK--VSEQGKGFPFNPIYLFGPEGSGKTHLMQAAVSALRESGGKILYVSSELFTEHL  184 (455)
T ss_pred             CCCCCCEEECCCCHHHHHHHHHHHH--CCCCCCCCCCCCEEEECCCCCCHHHHHHHHHHHHHCCCCEEEEECHHHHHHHH
T ss_conf             7835583315860999999999983--75535887678758878999978999999999853799869997499999999


Q ss_pred             CCCHHCCCCCHHCCCCCCCCCCHHHHHCCCEEEEECCHHH--CCHHHHHHHHHHHHHHHCCCCCCCEECCCCEEEEEECC
Q ss_conf             5301104780002564443100355515851777404455--02899999999877750217799776125429999424
Q gi|254780163|r  548 AVSRLIGAPPGYVGFGQGGILADSVDQNPYSVVLLDEIEK--SHPDVLNILLQIMDYGILTDQSGKKISFRNVILIMTTN  625 (798)
Q Consensus       548 ~vs~LiGappGYvG~~egg~Lte~vr~~P~sVvl~DEiEK--Ah~~v~~~llqild~G~ltd~~Gr~vdf~n~iii~TsN  625 (798)
                      .-+ |        ..+.-...-+..  +-.-|+|+|.|.-  .-+..+.-|..+|+  .|.++.        --||+||.
T Consensus       185 v~a-i--------~~~~~~~Fr~~y--r~~DvLLIDDIQfl~gK~~tqeEff~tfN--~L~~~~--------KQIVitsD  243 (455)
T PRK12422        185 VSA-I--------RSGEMQRFRSFY--RNVDALFIEDIEVFSGKGATQEEFFHTFN--SLHTEG--------KLIVISSS  243 (455)
T ss_pred             HHH-H--------HCCCHHHHHHHH--HCCCEEEEEHHHHHHCCHHHHHHHHHHHH--HHHHCC--------CEEEEECC
T ss_conf             999-9--------758899999999--63887763147887284889999999999--999859--------96999689


Q ss_pred             CCHHHHHHCCCCCCCCCCHHHHHHHHHHHCCHHHHCCCCEEEECCCCCHHHHHHHHHHHHHHHHHHHHHCCCEEEECHHH
Q ss_conf             21455330368988211148899999872887881776828962889999999999999999999998669889998899
Q gi|254780163|r  626 AGALEMSKARIGFGSSRNDDADKEALRNFLSPEFLNRLDSIIPFFPLSSDIIRQVVHKFIMKLELQLQEKGISFHFSEEV  705 (798)
Q Consensus       626 ~G~~~~~~~~~g~~~~~~~~~~~~~l~~~f~peflnRid~ii~F~~l~~~~~~~i~~~~l~~l~~~l~~~~i~l~~~~~~  705 (798)
                      ---.++             ....+.|+..|.-      --++.-.|-+.+....|+....       ...+  +.+++++
T Consensus       244 r~P~el-------------~~l~~RL~SRf~~------GL~v~I~~Pd~etr~~Il~~k~-------~~~~--~~l~~ev  295 (455)
T PRK12422        244 YAPGDL-------------KAMEERLISRFEW------GIAIPIHPLTREGLRSFLMRQA-------EQLS--IRIEETA  295 (455)
T ss_pred             CCHHHH-------------HHHHHHHHHHHHC------CEEECCCCCCHHHHHHHHHHHH-------HHCC--CCCCHHH
T ss_conf             895765-------------1268999988637------6132168999899999999999-------8718--8884468


Q ss_pred             HHHHHHCCCCCCCCCHHHHHHHHHH
Q ss_conf             9999971898101532679999986
Q gi|254780163|r  706 INWLVSHGYDVKMGARPLERIIKEH  730 (798)
Q Consensus       706 ~~~l~~~~~~~~~GAR~l~r~i~~~  730 (798)
                      ++||+++-.+   ..|.|...+.+.
T Consensus       296 ~~~iA~~i~~---niReLeGal~~l  317 (455)
T PRK12422        296 LDFLIQALSS---NVKTLLHALTLL  317 (455)
T ss_pred             HHHHHHHHHH---HHHHHHHHHHHH
T ss_conf             9999999755---179999999999


No 272
>PRK09087 hypothetical protein; Validated
Probab=98.16  E-value=0.00012  Score=52.50  Aligned_cols=171  Identities=19%  Similarity=0.291  Sum_probs=79.8

Q ss_pred             CCCCCCEEEEECCCCHHHHHHHHHHHHHCCCCEEEEEHHHHHCCCCCCHHCCCCCHHCCCCCCCCCCHHHHHCCCEEEEE
Q ss_conf             57874068861432003889999987304773377206886124653011047800025644431003555158517774
Q gi|254780163|r  503 PNKPIGCYVFSGPTGVGKTEISKQLAFALGVQLLRFDMSEYMERHAVSRLIGAPPGYVGFGQGGILADSVDQNPYSVVLL  582 (798)
Q Consensus       503 ~~rP~g~flf~GptGvGKTelak~la~~~~~~lir~dmsey~e~~~vs~LiGappGYvG~~egg~Lte~vr~~P~sVvl~  582 (798)
                      |+-|...+.+.||.|+|||.|+...+...+.  +.++......                        +.........+++
T Consensus        40 ~~w~~~~~~L~Gp~gsGKTHL~~~~~~~~~a--~~~~~~~~~~------------------------~~~~~~~~~~~~i   93 (226)
T PRK09087         40 PNWPSPVVVLAGPVGSGKTHLASIWREKADA--LLVHPNEIGS------------------------DAANAAAERPVLI   93 (226)
T ss_pred             CCCCCCEEEEECCCCCCHHHHHHHHHHHHCC--EEECHHHCCH------------------------HHHHHHCCCCEEE
T ss_conf             2677775899899999886999999998099--6836687474------------------------6676532798899


Q ss_pred             CCHHHCC-HH--HHHHHHHHHHHHHCCCCCCCEECCCCEEEEEECCCCHHHHHHCCCCCCCCCCHHHHHHHHHHHCCHHH
Q ss_conf             0445502-89--99999998777502177997761254299994242145533036898821114889999987288788
Q gi|254780163|r  583 DEIEKSH-PD--VLNILLQIMDYGILTDQSGKKISFRNVILIMTTNAGALEMSKARIGFGSSRNDDADKEALRNFLSPEF  659 (798)
Q Consensus       583 DEiEKAh-~~--v~~~llqild~G~ltd~~Gr~vdf~n~iii~TsN~G~~~~~~~~~g~~~~~~~~~~~~~l~~~f~pef  659 (798)
                      |.+++.. .+  +|+++=++.+              .++-++|||+.....+     .+.        .+.|+..|+-  
T Consensus        94 dd~d~~~~dEe~LFhl~N~~~~--------------~~~~LLlts~~~p~~l-----~~~--------L~DL~SRL~~--  144 (226)
T PRK09087         94 EDIDAGGFDETGLFHLINSVRQ--------------AGTSLLMTSRLWPSAW-----NVK--------LPDLKSRLKA--  144 (226)
T ss_pred             ECCCCCCCCHHHHHHHHHHHHH--------------CCCEEEEECCCCHHHC-----CCC--------CHHHHHHHHC--
T ss_conf             7487777478999999999985--------------3987999889895666-----762--------4689999857--


Q ss_pred             HCCCCEEEECCCCCHHHHHHHHHHHHHHHHHHHHHCCCEEEECHHHHHHHHHCCCCCCCCCHHHHHHHH-------HHHH
Q ss_conf             177682896288999999999999999999999866988999889999999718981015326799999-------8623
Q gi|254780163|r  660 LNRLDSIIPFFPLSSDIIRQVVHKFIMKLELQLQEKGISFHFSEEVINWLVSHGYDVKMGARPLERIIK-------EHVK  732 (798)
Q Consensus       660 lnRid~ii~F~~l~~~~~~~i~~~~l~~l~~~l~~~~i~l~~~~~~~~~l~~~~~~~~~GAR~l~r~i~-------~~i~  732 (798)
                          --++-..+.+.+.+..++.+..       ++||  +.+++++++||+.+.--.-..+..+-..|.       +.|.
T Consensus       145 ----~~~~~I~~pdD~ll~~~L~k~~-------~~r~--l~l~~~v~~yll~r~~Rs~~~l~~~l~~LD~~SL~~kr~IT  211 (226)
T PRK09087        145 ----ATVVEIGEPDDALLSGVIFKLF-------ADRQ--LYVEPHVVYYLVSRMERSLFAAQTIVERLDRLALERKSRIT  211 (226)
T ss_pred             ----CEEEEECCCCHHHHHHHHHHHH-------HHCC--CCCCHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHCCCCCC
T ss_conf             ----8579835999899999999998-------7576--57888899999984588999999999999999998189998


Q ss_pred             HHHHHHHHC
Q ss_conf             599999962
Q gi|254780163|r  733 VPLADEILF  741 (798)
Q Consensus       733 ~~la~~il~  741 (798)
                      -|++.++|.
T Consensus       212 iplikevL~  220 (226)
T PRK09087        212 RALAAEVLN  220 (226)
T ss_pred             HHHHHHHHH
T ss_conf             999999998


No 273
>COG0470 HolB ATPase involved in DNA replication [DNA replication, recombination, and repair]
Probab=98.15  E-value=8e-05  Score=53.80  Aligned_cols=118  Identities=30%  Similarity=0.368  Sum_probs=75.3

Q ss_pred             HHHCHHHHHHHHHHHHHHHHCCCCCCCCCCCEEEEECCCCHHHHHHHHHHHHHCC------------------------C
Q ss_conf             6534589999999998775204456578740688614320038899999873047------------------------7
Q gi|254780163|r  478 VVYGQEEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFALG------------------------V  533 (798)
Q Consensus       478 ~v~GQ~~ai~~v~~~i~~~~~gl~~~~rP~g~flf~GptGvGKTelak~la~~~~------------------------~  533 (798)
                      .++|+++++..+...+....      +-|- .+||.||+|+|||.+|.+||..+.                        .
T Consensus         2 ~~~~~~~~~~~l~~~~~~~~------~~~h-alL~~Gp~G~Gktt~a~~lA~~l~~~~~~~~~~~~~~~~~~~~~~~~~~   74 (325)
T COG0470           2 ELVPWQEAVKRLLVQALESG------RLPH-ALLFYGPPGVGKTTAALALAKELLCENPTGLLPCGHCRSCKLIPAGNHP   74 (325)
T ss_pred             CCCCCHHHHHHHHHHHHHCC------CCCC-CEEEECCCCCCHHHHHHHHHHHHCCCCCCCCCCCCHHHHHHHHCCCCCC
T ss_conf             64332358999999998658------8876-1003799999789999999999658664334552002244432025688


Q ss_pred             CEEEEEHHHHHCCCCCCHHCCCCCHHCCCCCCCCCCHHHH----HCCCEEEEECCHHHCCHHHHHHHHHHHHHHHCCCCC
Q ss_conf             3377206886124653011047800025644431003555----158517774044550289999999987775021779
Q gi|254780163|r  534 QLLRFDMSEYMERHAVSRLIGAPPGYVGFGQGGILADSVD----QNPYSVVLLDEIEKSHPDVLNILLQIMDYGILTDQS  609 (798)
Q Consensus       534 ~lir~dmsey~e~~~vs~LiGappGYvG~~egg~Lte~vr----~~P~sVvl~DEiEKAh~~v~~~llqild~G~ltd~~  609 (798)
                      .++.++-|.-....            ++-++=..+.+..-    ..++-||++||+|+-+++..|.|+-.+++-      
T Consensus        75 d~lel~~s~~~~~~------------i~~~~vr~~~~~~~~~~~~~~~kviiidead~mt~~A~nallk~lEep------  136 (325)
T COG0470          75 DFLELNPSDLRKID------------IIVEQVRELAEFLSESPLEGGYKVVIIDEADKLTEDAANALLKTLEEP------  136 (325)
T ss_pred             CEEEECCCCCCCCC------------CHHHHHHHHHHHCCCCCCCCCCEEEEEECCCCCCHHHHHHHHHHCCCC------
T ss_conf             65997732133330------------069999999986044656677269997320326988887675433248------


Q ss_pred             CCEECCCCEEEEEECC
Q ss_conf             9776125429999424
Q gi|254780163|r  610 GKKISFRNVILIMTTN  625 (798)
Q Consensus       610 Gr~vdf~n~iii~TsN  625 (798)
                           =.||.|||++|
T Consensus       137 -----~~~~~~il~~n  147 (325)
T COG0470         137 -----PKNTRFILITN  147 (325)
T ss_pred             -----CCCEEEEEEEC
T ss_conf             -----88716999749


No 274
>pfam00493 MCM MCM2/3/5 family.
Probab=98.15  E-value=0.00026  Score=50.12  Aligned_cols=175  Identities=21%  Similarity=0.298  Sum_probs=89.1

Q ss_pred             CCCCCEEEECCCCCHHHHHHHHHHHHHHCCCCCHHHHEEEEEEEEHHH----HHCCC---CCCCHHHHHHHHHHHHHCCC
Q ss_conf             677874896676411668999999998548988345201445540467----53063---43123789999999872038
Q gi|254780163|r  223 RSKNNPLYVGDPGVGKTAIAEGFAKQIVDGMVPDILLGARIFSLDMGN----LIAGT---RYRGDFEERIKKIVKEIESY  295 (798)
Q Consensus       223 R~KNn~~lvG~~gvGktaive~la~~i~~~~vp~~l~~~~i~~ld~~~----l~ag~---~~rg~fe~r~~~~~~~~~~~  295 (798)
                      |..-|.+|||+||+|||.+....+. +...         -+|.-..++    |.|..   ++-|+|-=+--.+   +-.+
T Consensus        55 Rg~ihiLLvGdPG~gKSqlLk~~~~-~~pr---------~~~tsg~~ss~~GLTa~~~~d~~~~~~~leaGal---vlAd  121 (327)
T pfam00493        55 RGDINVLLVGDPGTAKSQLLKYVAK-LAPR---------AVYTSGKGSSAAGLTAAVVRDPDTGEWTLEAGAL---VLAD  121 (327)
T ss_pred             CCCCEEEEECCCCCCHHHHHHHHHH-HCCC---------CEEECCCCCCCCCCEEEEEEECCCCCEEEECCCE---EECC
T ss_conf             3651189846998156099999998-6887---------0883177665677615899806888369836847---7558


Q ss_pred             CCEEEEECCHHHHHCCCCCCCCCCCHHHHHHHHHCCCCEE---------------EEEECCHHH--HH------HHHHCC
Q ss_conf             9839997361663015544434477788887663026603---------------887304899--99------985201
Q gi|254780163|r  296 ANAILYIDEIHTLVGAGSASGISVDASNLLKPALSSGAVR---------------CIGSTTYSE--YR------QFFEKD  352 (798)
Q Consensus       296 ~~~ilfideih~ligag~~~g~~~d~an~lkP~L~rg~~~---------------~IgatT~~e--y~------~~~e~d  352 (798)
                       +=|+.|||+.-+        ..-|-+-|+ -+|+.+.+.               +|+|+.|.+  |.      .-|.-.
T Consensus       122 -~Gv~cIDEfdk~--------~~~d~saL~-EAMEqqtVsIaKaGi~~tL~ar~sVlAaaNP~~g~yd~~~~~~~ni~Lp  191 (327)
T pfam00493       122 -GGVCCIDEFDKM--------NEEDRVAIH-EAMEQQTISIAKAGIVATLNARCSVLAAANPIFGRYDPKKSVAENINLP  191 (327)
T ss_pred             -CCEEEEECCCCC--------CHHHHHHHH-HHHHHCEEEEECCCEEEEECCCCEEEEEECCCCCCCCCCCCHHHHCCCC
T ss_conf             -982785005558--------876799999-9998681776338538972587179985277677378888988855897


Q ss_pred             HHHHHHCEEE--EECCCCHHHHHHHHHHHHHHHHHHC------CCEECCHHHHHHHHHHHHHCCCCCCHHHHHHHHH
Q ss_conf             1143200144--3068786899999986127665410------3512111789999986542015556467988998
Q gi|254780163|r  353 KALVRRFQKI--DVSEPSIEDAIEIVKGIKPYFEEHH------QLRYSKEAIRAAVQLSVRHFTSRKLPDKAIDVID  421 (798)
Q Consensus       353 ~al~rrF~~i--~v~ep~~~~~~~iL~~~~~~ye~~h------~v~~~~~al~~av~ls~ryi~~r~lPdkAidllD  421 (798)
                      .+|-.||.-|  ..+.|+.+.-..|.+.+...+....      ...++.+-+..-+.++.+++.- .+++.|.+.|-
T Consensus       192 ~~lLsRFDLif~l~D~~~~~~D~~ia~~i~~~~~~~~~~~~~~~~~~~~~~l~~yi~~ar~~~~P-~ls~ea~~~i~  267 (327)
T pfam00493       192 PPLLSRFDLIFVLLDKPDEEKDEELAKHIVDLHRHGEEEEIETEDYVDPELLRKYIAYARENIFP-KLSDEAREKLV  267 (327)
T ss_pred             HHHHCCEEEEEEEECCCCHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCHHHHHHHHHHHHHHCCC-CCCHHHHHHHH
T ss_conf             67745010798840689868899999999998744688655568879999999999999852788-77989999999


No 275
>KOG1969 consensus
Probab=98.14  E-value=6.3e-05  Score=54.58  Aligned_cols=170  Identities=22%  Similarity=0.310  Sum_probs=89.4

Q ss_pred             HHHHHHHHHHHHHHCCCCCCE-EEECCCCCHHHHHHHHHHHHHHCCCCCHHHHEEEEEEEEHHHHHCCCCCCCHHHHHHH
Q ss_conf             178999999998622677874-8966764116689999999985489883452014455404675306343123789999
Q gi|254780163|r  208 GRHEEINRTIQILCRRSKNNP-LYVGDPGVGKTAIAEGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGDFEERIK  286 (798)
Q Consensus       208 GRd~EI~riiqIL~RR~KNn~-~lvG~~gvGktaive~la~~i~~~~vp~~l~~~~i~~ld~~~l~ag~~~rg~fe~r~~  286 (798)
                      +++.|+-.+.-=.++|-+.-. +|-|+||.|||++++-.|..          .|+++++++..-==++    -.+++|+-
T Consensus       308 ~~~ke~~~~~~~~s~RP~kKilLL~GppGlGKTTLAHViAkq----------aGYsVvEINASDeRt~----~~v~~kI~  373 (877)
T KOG1969         308 PTEKEVLDMELDPSKRPPKKILLLCGPPGLGKTTLAHVIAKQ----------AGYSVVEINASDERTA----PMVKEKIE  373 (877)
T ss_pred             CCHHHHHHCCCCCCCCCCCCEEEEECCCCCCHHHHHHHHHHH----------CCCEEEEECCCCCCCH----HHHHHHHH
T ss_conf             643455632468667984006875368878724799999986----------2854887325554347----88999999


Q ss_pred             HHHHHHC----CCCCEEEEECCHHHHHCCCCCCCCCCCHHHHHHHHHCCCCEEEEEECCHHHHHHHHHC-----------
Q ss_conf             9998720----3898399973616630155444344777888876630266038873048999998520-----------
Q gi|254780163|r  287 KIVKEIE----SYANAILYIDEIHTLVGAGSASGISVDASNLLKPALSSGAVRCIGSTTYSEYRQFFEK-----------  351 (798)
Q Consensus       287 ~~~~~~~----~~~~~ilfideih~ligag~~~g~~~d~an~lkP~L~rg~~~~IgatT~~ey~~~~e~-----------  351 (798)
                      +.+.--.    ...++-|.||||.     |+--    -|-++|.-.+-+-..+..|---...-+|-=.+           
T Consensus       374 ~avq~~s~l~adsrP~CLViDEID-----Ga~~----~~Vdvilslv~a~~k~~~Gkq~~~~~~rkkkr~~~L~RPIICI  444 (877)
T KOG1969         374 NAVQNHSVLDADSRPVCLVIDEID-----GAPR----AAVDVILSLVKATNKQATGKQAKKDKKRKKKRSKLLTRPIICI  444 (877)
T ss_pred             HHHHHCCCCCCCCCCCEEEEECCC-----CCCH----HHHHHHHHHHHHHCCHHHCCCCCCHHHHHHHCCCCCCCCEEEE
T ss_conf             988641122568886359984246-----8728----9999999999741614216866320345553046545877898


Q ss_pred             -----CHHHH--HHC-EEEEECCCCHHHHHHHHHHHHHHHHHHCCCEECCHHHHHHHHHHH
Q ss_conf             -----11143--200-144306878689999998612766541035121117899999865
Q gi|254780163|r  352 -----DKALV--RRF-QKIDVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSV  404 (798)
Q Consensus       352 -----d~al~--rrF-~~i~v~ep~~~~~~~iL~~~~~~ye~~h~v~~~~~al~~av~ls~  404 (798)
                           -|||.  |-| +.|.+..|+...-++-|+-+-.    .-+.+...-+|.+..++..
T Consensus       445 CNdLYaPaLR~Lr~~A~ii~f~~p~~s~Lv~RL~~IC~----rE~mr~d~~aL~~L~el~~  501 (877)
T KOG1969         445 CNDLYAPALRPLRPFAEIIAFVPPSQSRLVERLNEICH----RENMRADSKALNALCELTQ  501 (877)
T ss_pred             ECCCCCHHHHHCCCCEEEEEECCCCHHHHHHHHHHHHH----HHCCCCCHHHHHHHHHHHC
T ss_conf             64755533331021048999569976689999999976----4157788789999999861


No 276
>PRK11361 acetoacetate metabolism regulatory protein AtoC; Provisional
Probab=98.12  E-value=2.4e-05  Score=57.51  Aligned_cols=145  Identities=20%  Similarity=0.263  Sum_probs=84.2

Q ss_pred             CCHHHHHHHHHHHHHHHHHHC--CCCCCEEEECCCCCHHHHHHHHHHHHHHCCCCCHHHHEEEEEEEEHHHHHC------
Q ss_conf             611222178999999998622--677874896676411668999999998548988345201445540467530------
Q gi|254780163|r  202 KVDILVGRHEEINRTIQILCR--RSKNNPLYVGDPGVGKTAIAEGFAKQIVDGMVPDILLGARIFSLDMGNLIA------  273 (798)
Q Consensus       202 KLDPVIGRd~EI~riiqIL~R--R~KNn~~lvG~~gvGktaive~la~~i~~~~vp~~l~~~~i~~ld~~~l~a------  273 (798)
                      ..+.+||+..-++++.+.+.|  .+..++++.||+|+||..++..+-..=       .-++..++.+|.+++-.      
T Consensus       141 ~~~~lig~S~~m~~v~~~i~~~A~s~~~VLI~GEsGTGKe~~Ar~IH~~S-------~r~~~pFv~vnc~ai~~~l~ese  213 (457)
T PRK11361        141 QWGHILTNSPAMMDICKDTAKIALSQASVLISGESGTGKELIARAIHYNS-------RRAKGPFIKVNCAALPESLLESE  213 (457)
T ss_pred             CCCCCEECCHHHHHHHHHHHHHHCCCCCEEEECCCCCCHHHHHHHHHHHC-------CCCCCCEEEEECCCCCHHHHHHH
T ss_conf             56774546999999999999984889958998899857899999999837-------98899838764787985778999


Q ss_pred             --C----------CCCCCHHHHHHHHHHHHHCCCCCEEEEECCHHHHHCCCCCCCCCCCHHHHHHHHHCCC---------
Q ss_conf             --6----------3431237899999998720389839997361663015544434477788887663026---------
Q gi|254780163|r  274 --G----------TRYRGDFEERIKKIVKEIESYANAILYIDEIHTLVGAGSASGISVDASNLLKPALSSG---------  332 (798)
Q Consensus       274 --g----------~~~rg~fe~r~~~~~~~~~~~~~~ilfideih~ligag~~~g~~~d~an~lkP~L~rg---------  332 (798)
                        |          ....|-||+           +.+=-||+|||+.+         +++.-.-|--+|..+         
T Consensus       214 LFG~~kgaftga~~~~~G~~e~-----------A~gGTLfLdeI~~l---------~~~~Q~kLLr~L~~~~~~~~g~~~  273 (457)
T PRK11361        214 LFGHEKGAFTGAQTLRQGLFER-----------ANEGTLLLDEIGEM---------PLVLQAKLLRILQEREFERIGGHQ  273 (457)
T ss_pred             HHCCCCCCCCCCCCCCCCCHHH-----------CCCCCEECCCHHHH---------HHHHHHHHHHHHHCCCEEECCCCC
T ss_conf             7187667878853146986133-----------59982631466452---------399999999998649278569971


Q ss_pred             ----CEEEEEECCHHHHHHHHHCC---HHHHHHCEEEEECCCCHHHHHH
Q ss_conf             ----60388730489999985201---1143200144306878689999
Q gi|254780163|r  333 ----AVRCIGSTTYSEYRQFFEKD---KALVRRFQKIDVSEPSIEDAIE  374 (798)
Q Consensus       333 ----~~~~IgatT~~ey~~~~e~d---~al~rrF~~i~v~ep~~~~~~~  374 (798)
                          ++|+|+||+.+ ..+.++.-   ..|--|+..+.|.=|.-.+-..
T Consensus       274 ~~~~dvRiIaaT~~~-L~~~v~~g~Fr~DLyyrL~~~~i~lPpLReR~e  321 (457)
T PRK11361        274 TIKVDIRIIAATNRD-LQAMVKEGTFREDLFYRLNVIHLILPPLRDRRE  321 (457)
T ss_pred             EEEECCEEEECCCCC-HHHHHHCCCCHHHHHHHHCEEEEECCCHHHCHH
T ss_conf             366534899657878-599987583238899530221251738545875


No 277
>KOG0740 consensus
Probab=98.11  E-value=0.00011  Score=52.69  Aligned_cols=128  Identities=27%  Similarity=0.357  Sum_probs=72.7

Q ss_pred             HHCHHHHHHHHHHHHHHHHC---CCCCCCCCCCEEEEECCCCHHHHHHHHHHHHHCCCCEEEEEHHHHHCCCCCCHHCCC
Q ss_conf             53458999999999877520---445657874068861432003889999987304773377206886124653011047
Q gi|254780163|r  479 VYGQEEAIKKLSSSIKIARA---GLSDPNKPIGCYVFSGPTGVGKTEISKQLAFALGVQLLRFDMSEYMERHAVSRLIGA  555 (798)
Q Consensus       479 v~GQ~~ai~~v~~~i~~~~~---gl~~~~rP~g~flf~GptGvGKTelak~la~~~~~~lir~dmsey~e~~~vs~LiGa  555 (798)
                      +-|.+.|-..+-.++..--.   ....-+.|+.+.|+.||.|+|||-|++++|-.+...+.-+--|         .|.+-
T Consensus       155 i~gl~~~k~~l~e~vi~p~lr~d~F~glr~p~rglLLfGPpgtGKtmL~~aiAsE~~atff~iSas---------sLtsK  225 (428)
T KOG0740         155 IAGLEDAKQSLKEAVILPLLRPDLFLGLREPVRGLLLFGPPGTGKTMLAKAIATESGATFFNISAS---------SLTSK  225 (428)
T ss_pred             CCCHHHHHHHHHHHHHHCCCCHHHHHCCCCCCCHHHEECCCCCCHHHHHHHHHHHHCCEEEECCHH---------HHHHH
T ss_conf             740566899865423220455376523544531112005898844799999986206657630688---------86532


Q ss_pred             CCHHCCCCC-CCCCCHHH-HHCCCEEEEECCHHH--------CCHH----HHHHHHHHHHHHHCCCCCCCEECCCCEEEE
Q ss_conf             800025644-43100355-515851777404455--------0289----999999987775021779977612542999
Q gi|254780163|r  556 PPGYVGFGQ-GGILADSV-DQNPYSVVLLDEIEK--------SHPD----VLNILLQIMDYGILTDQSGKKISFRNVILI  621 (798)
Q Consensus       556 ppGYvG~~e-gg~Lte~v-r~~P~sVvl~DEiEK--------Ah~~----v~~~llqild~G~ltd~~Gr~vdf~n~iii  621 (798)
                         |||-.| ......+| |..-+||++.|||++        +|+.    -...|+|..  |..+-...      +.++|
T Consensus       226 ---~~Ge~eK~vralf~vAr~~qPsvifidEidslls~Rs~~e~e~srr~ktefLiq~~--~~~s~~~d------rvlvi  294 (428)
T KOG0740         226 ---YVGESEKLVRALFKVARSLQPSVIFIDEIDSLLSKRSDNEHESSRRLKTEFLLQFD--GKNSAPDD------RVLVI  294 (428)
T ss_pred             ---CCCHHHHHHHHHHHHHHHCCCEEEEECHHHHHHHHCCCCCCCCCHHHHHHHHHHHC--CCCCCCCC------EEEEE
T ss_conf             ---46707789999999987139708984025678863687545445556557776540--44578887------07998


Q ss_pred             EECCC
Q ss_conf             94242
Q gi|254780163|r  622 MTTNA  626 (798)
Q Consensus       622 ~TsN~  626 (798)
                      -|||.
T Consensus       295 gaTN~  299 (428)
T KOG0740         295 GATNR  299 (428)
T ss_pred             ECCCC
T ss_conf             15888


No 278
>KOG0726 consensus
Probab=98.10  E-value=1.2e-05  Score=59.71  Aligned_cols=158  Identities=27%  Similarity=0.451  Sum_probs=101.2

Q ss_pred             CHHHHHHHHHHHHHH--------HHCCCCCCCCCCCEEEEECCCCHHHHHHHHHHHHHCCCCEEEEEHHHHHCCCCCCHH
Q ss_conf             458999999999877--------520445657874068861432003889999987304773377206886124653011
Q gi|254780163|r  481 GQEEAIKKLSSSIKI--------ARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFALGVQLLRFDMSEYMERHAVSRL  552 (798)
Q Consensus       481 GQ~~ai~~v~~~i~~--------~~~gl~~~~rP~g~flf~GptGvGKTelak~la~~~~~~lir~dmsey~e~~~vs~L  552 (798)
                      |-+.-|..+-+++-.        -.-|++.|   -|+.| .|++|+|||.|||++|-...--|+|+--||...+      
T Consensus       189 Gle~QiQEiKEsvELPLthPE~YeemGikpP---KGVIl-yG~PGTGKTLLAKAVANqTSATFlRvvGseLiQk------  258 (440)
T KOG0726         189 GLESQIQEIKESVELPLTHPEYYEEMGIKPP---KGVIL-YGEPGTGKTLLAKAVANQTSATFLRVVGSELIQK------  258 (440)
T ss_pred             CHHHHHHHHHHHHCCCCCCHHHHHHCCCCCC---CEEEE-ECCCCCCHHHHHHHHHCCCCHHHHHHHHHHHHHH------
T ss_conf             5789999999863388898789997288999---70588-6799975368888772455212455650899998------


Q ss_pred             CCCCCHHCCCCCCCCCCHHHH----HCCCEEEEECCHHH-----------CCHHHHHHHHHHHHHHHCCCCCCCEECCCC
Q ss_conf             047800025644431003555----15851777404455-----------028999999998777502177997761254
Q gi|254780163|r  553 IGAPPGYVGFGQGGILADSVD----QNPYSVVLLDEIEK-----------SHPDVLNILLQIMDYGILTDQSGKKISFRN  617 (798)
Q Consensus       553 iGappGYvG~~egg~Lte~vr----~~P~sVvl~DEiEK-----------Ah~~v~~~llqild~G~ltd~~Gr~vdf~n  617 (798)
                            |.|  +|-.|...+-    -+.-|+|+.|||+-           +.++|+..+|.+|..=-=.|+.|      +
T Consensus       259 ------ylG--dGpklvRqlF~vA~e~apSIvFiDEIdAiGtKRyds~SggerEiQrtmLELLNQldGFdsrg------D  324 (440)
T KOG0726         259 ------YLG--DGPKLVRELFRVAEEHAPSIVFIDEIDAIGTKRYDSNSGGEREIQRTMLELLNQLDGFDSRG------D  324 (440)
T ss_pred             ------HHC--CCHHHHHHHHHHHHHCCCCEEEEEHHHHHCCCCCCCCCCHHHHHHHHHHHHHHHCCCCCCCC------C
T ss_conf             ------736--55199999998887529826986400110452134788507899999999987426866567------7


Q ss_pred             EEEEEECCCCHHHHHHCCCCCCCCCCHHHHHHHHHHHCCHHHHCCCCEEEECCCCCHHHHHHHHHHHH
Q ss_conf             29999424214553303689882111488999998728878817768289628899999999999999
Q gi|254780163|r  618 VILIMTTNAGALEMSKARIGFGSSRNDDADKEALRNFLSPEFLNRLDSIIPFFPLSSDIIRQVVHKFI  685 (798)
Q Consensus       618 ~iii~TsN~G~~~~~~~~~g~~~~~~~~~~~~~l~~~f~peflnRid~ii~F~~l~~~~~~~i~~~~l  685 (798)
                      .-+||.+|-    |             +...++|   .||   +|||.-|-|.--+...-++|..+.-
T Consensus       325 vKvimATnr----i-------------e~LDPaL---iRP---GrIDrKIef~~pDe~TkkkIf~IHT  369 (440)
T KOG0726         325 VKVIMATNR----I-------------ETLDPAL---IRP---GRIDRKIEFPLPDEKTKKKIFQIHT  369 (440)
T ss_pred             EEEEEECCC----C-------------CCCCHHH---CCC---CCCCCCCCCCCCCHHHHCEEEEEEE
T ss_conf             589974165----3-------------4467755---278---7543111257975563231568750


No 279
>TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily. Members of this protein are marked as probable ATPases by the nucleotide binding P-loop motif GXXGXGKTT, a motif DEAQ similar to the DEAD/H box of helicases, and extensive homology to ATPases of MSHA-type pilus systems and to GspA proteins associated with type II protein secretion systems.
Probab=98.09  E-value=0.00049  Score=48.18  Aligned_cols=207  Identities=19%  Similarity=0.287  Sum_probs=116.9

Q ss_pred             CHHHHHHHHHHHHHHHHCCCCCCCCCCCEEEEECCCCHHHHHHHHHHHHHCC-CCEEEE-------EHHHHHCCCCCCHH
Q ss_conf             4589999999998775204456578740688614320038899999873047-733772-------06886124653011
Q gi|254780163|r  481 GQEEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFALG-VQLLRF-------DMSEYMERHAVSRL  552 (798)
Q Consensus       481 GQ~~ai~~v~~~i~~~~~gl~~~~rP~g~flf~GptGvGKTelak~la~~~~-~~lir~-------dmsey~e~~~vs~L  552 (798)
                      .+.+|...+..++       .. ++  |.-+++|+.|+|||.+.+.|...+. ...+.+       ..+|+..  .+..-
T Consensus        27 ~h~~al~~L~~~l-------~~-~~--g~~lltGe~GtGKTtllr~l~~~l~~~~~~~~~i~~~~l~~~~ll~--~i~~~   94 (269)
T TIGR03015        27 GHKRAMAYLEYGL-------SQ-RE--GFILITGEVGAGKTTLIRNLLKRLDQERVVAAKLVNTRVDAEDLLR--MVAAD   94 (269)
T ss_pred             HHHHHHHHHHHHH-------HC-CC--CEEEEECCCCCCHHHHHHHHHHHCCCCCEEEEEECCCCCCHHHHHH--HHHHH
T ss_conf             6999999999999-------64-89--6599972998988999999998459345489997699999999999--99998


Q ss_pred             CCCCCHHCCCCCCC---CCC----HHHHHCCCEEEEECCHHHCCHHHHHHHHHHHHHHHCCCCCCCEECCCCEEEEEECC
Q ss_conf             04780002564443---100----35551585177740445502899999999877750217799776125429999424
Q gi|254780163|r  553 IGAPPGYVGFGQGG---ILA----DSVDQNPYSVVLLDEIEKSHPDVLNILLQIMDYGILTDQSGKKISFRNVILIMTTN  625 (798)
Q Consensus       553 iGappGYvG~~egg---~Lt----e~vr~~P~sVvl~DEiEKAh~~v~~~llqild~G~ltd~~Gr~vdf~n~iii~TsN  625 (798)
                      .|.||...  +...   +|.    +...+.-..|+++||-.+-.+++++-|-.++.  .-+|+..      =.-+|+.  
T Consensus        95 lg~~~~~~--~~~~~~~~l~~~L~~~~~~g~~~vliIDEAq~L~~~~Le~Lr~L~n--~e~~~~~------ll~iiL~--  162 (269)
T TIGR03015        95 FGLETEGR--DKAALLRELEDFLIEQFAAGKRALLVVDEAQNLTPELLEELRMLSN--FQTDNAK------LLQIFLV--  162 (269)
T ss_pred             CCCCCCCC--CHHHHHHHHHHHHHHHHHCCCCEEEEEECHHHCCHHHHHHHHHHHC--CCCCCCC------CEEEEEE--
T ss_conf             59898898--9999999999999999966994699972422199999999999970--1358887------0489995--


Q ss_pred             CCHHHHHHCCCCCCCCCCHHHHHHHHHHHCCHHHHCCCCEEEECCCCCHHHHHHHHHHHHHHHHHHHHHCCCEEEECHHH
Q ss_conf             21455330368988211148899999872887881776828962889999999999999999999998669889998899
Q gi|254780163|r  626 AGALEMSKARIGFGSSRNDDADKEALRNFLSPEFLNRLDSIIPFFPLSSDIIRQVVHKFIMKLELQLQEKGISFHFSEEV  705 (798)
Q Consensus       626 ~G~~~~~~~~~g~~~~~~~~~~~~~l~~~f~peflnRid~ii~F~~l~~~~~~~i~~~~l~~l~~~l~~~~i~l~~~~~~  705 (798)
                       |.-++                .+.++..--+.|-.||..-+...||+.++...-++-.|+..     ..+-..-+++++
T Consensus       163 -GqpeL----------------~~~L~~~~~~~l~qRI~~~~~L~pl~~eet~~YI~~RL~~A-----G~~~~~~Ft~~A  220 (269)
T TIGR03015       163 -GQPEF----------------RETLQSPQLQQLRQRIIASCHLGPLDREETREYIEHRLERA-----GNRDAPVFSEGA  220 (269)
T ss_pred             -CCHHH----------------HHHHCCCCHHHHHHCEEEEEEECCCCHHHHHHHHHHHHHHC-----CCCCCCCCCHHH
T ss_conf             -78679----------------99872740254555076799847999899999999999866-----999999859999


Q ss_pred             HHHHHHCCCCCCCCCHHHHHHHHHHHHHHHHHHHH
Q ss_conf             99999718981015326799999862359999996
Q gi|254780163|r  706 INWLVSHGYDVKMGARPLERIIKEHVKVPLADEIL  740 (798)
Q Consensus       706 ~~~l~~~~~~~~~GAR~l~r~i~~~i~~~la~~il  740 (798)
                      ++.|.+..       +.+-|.|.+.-...|-....
T Consensus       221 ~~~I~~~S-------~G~PR~IN~Lc~~aLl~a~~  248 (269)
T TIGR03015       221 FDAIHRFS-------RGIPRLINILCDRLLLSAFL  248 (269)
T ss_pred             HHHHHHHC-------CCCHHHHHHHHHHHHHHHHH
T ss_conf             99999986-------99008999999999999999


No 280
>PRK11388 DNA-binding transcriptional regulator DhaR; Provisional
Probab=98.09  E-value=7.5e-05  Score=54.01  Aligned_cols=176  Identities=20%  Similarity=0.304  Sum_probs=90.6

Q ss_pred             CCHHHHHHHHHHHHHHHHHHC--CCCCCEEEECCCCCHHHHHHHHHHHHHHCCCCCHHHHEEEEEEEEHHHH--------
Q ss_conf             611222178999999998622--6778748966764116689999999985489883452014455404675--------
Q gi|254780163|r  202 KVDILVGRHEEINRTIQILCR--RSKNNPLYVGDPGVGKTAIAEGFAKQIVDGMVPDILLGARIFSLDMGNL--------  271 (798)
Q Consensus       202 KLDPVIGRd~EI~riiqIL~R--R~KNn~~lvG~~gvGktaive~la~~i~~~~vp~~l~~~~i~~ld~~~l--------  271 (798)
                      -++.++|.+.-++++++--.|  +..-+++|.||+|+||+.++..+-    +..   .-++..++.+|-+++        
T Consensus       323 ~f~~l~g~s~~~~~~~~~a~~~a~~~~pVLI~GE~GtGKe~lAraIH----~~S---~r~~~pfv~vnC~ai~~~~~e~e  395 (639)
T PRK11388        323 TFDHMPQDSPQMRRLIHFGRQAAKSSFPILLCGEEGVGKALLAQAIH----NES---ERAAGPYIAVNCQLLPDEALAEE  395 (639)
T ss_pred             CHHHCCCCCHHHHHHHHHHHHHHCCCCCEEEECCCCCCHHHHHHHHH----HCC---CCCCCCEEEEECCCCCHHHHHHH
T ss_conf             85544679999999999999996889968988989810999999999----557---77899818987898984678998


Q ss_pred             HCCCCCCCHHHHHHHHHHHHHCCCCCEEEEECCHHHHHCCCCCCCCCCCHHHHHHHHHCCC-------------CEEEEE
Q ss_conf             3063431237899999998720389839997361663015544434477788887663026-------------603887
Q gi|254780163|r  272 IAGTRYRGDFEERIKKIVKEIESYANAILYIDEIHTLVGAGSASGISVDASNLLKPALSSG-------------AVRCIG  338 (798)
Q Consensus       272 ~ag~~~rg~fe~r~~~~~~~~~~~~~~ilfideih~ligag~~~g~~~d~an~lkP~L~rg-------------~~~~Ig  338 (798)
                      +-|.. .|.......+.+   .....=.||+|||+.|         +++.-.-|--+|..|             ++|+|+
T Consensus       396 lfG~~-~~~~~~g~~g~~---e~A~gGTL~LdeI~~l---------p~~~Q~~LlrvL~~~~~~r~g~~~~~~vdvRiia  462 (639)
T PRK11388        396 FLGSD-RTDSENGRLSKF---ELAHGGTLFLEKVEYL---------SVELQSALLQVLKTGVITRLDSRRLIPVDVRVIA  462 (639)
T ss_pred             HCCCC-CCCCCCCCCCHH---HCCCCCEEEECCHHHC---------CHHHHHHHHHHHHCCCEEECCCCCEEEEEEEEEE
T ss_conf             73877-676434668624---4036982884672649---------9999999999986593785699946664279997


Q ss_pred             ECCHHHHHHHHHCCH---HHHHHCEEEEECCCCHHHHH---H-HHHHHHHHHHHHC--CCEECCHHHHH
Q ss_conf             304899999852011---14320014430687868999---9-9986127665410--35121117899
Q gi|254780163|r  339 STTYSEYRQFFEKDK---ALVRRFQKIDVSEPSIEDAI---E-IVKGIKPYFEEHH--QLRYSKEAIRA  398 (798)
Q Consensus       339 atT~~ey~~~~e~d~---al~rrF~~i~v~ep~~~~~~---~-iL~~~~~~ye~~h--~v~~~~~al~~  398 (798)
                      +|+.+- ...++...   .|--|+....|.=|.-.+-.   . +.+.+-..+...+  .+.++++|+..
T Consensus       463 at~~~l-~~~v~~g~fr~dLyyrl~~~~i~lPpLReR~~Di~~L~~~~l~~~~~~~~~~~~ls~~a~~~  530 (639)
T PRK11388        463 TTTADL-AMLVEQNRFSRQLYYALHAFEITIPPLRMRREDIPALVNNKLRSLEKRFSTRLKIDDDALAR  530 (639)
T ss_pred             ECCHHH-HHHHHCCCCHHHHHHHHHHHHCCCCCHHHCHHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHH
T ss_conf             364508-99987498549999876744105733232534399999999999999719999989999999


No 281
>KOG0729 consensus
Probab=98.09  E-value=6.1e-06  Score=61.86  Aligned_cols=123  Identities=28%  Similarity=0.485  Sum_probs=85.2

Q ss_pred             HCHHHHHHHHHHHH--------HHHHCCCCCCCCCCCEEEEECCCCHHHHHHHHHHHHHCCCCEEEEEHHHHHCCCCCCH
Q ss_conf             34589999999998--------7752044565787406886143200388999998730477337720688612465301
Q gi|254780163|r  480 YGQEEAIKKLSSSI--------KIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFALGVQLLRFDMSEYMERHAVSR  551 (798)
Q Consensus       480 ~GQ~~ai~~v~~~i--------~~~~~gl~~~~rP~g~flf~GptGvGKTelak~la~~~~~~lir~dmsey~e~~~vs~  551 (798)
                      =|-.+-|+.+-+.+        +-...|+.+|   -|++|+ ||+|+|||.+|+++|--..-.|||+=-||.-.+     
T Consensus       180 GGCKeqIEklREVVE~PlL~PErfv~LGIdPP---KGvlly-GPPGtGKTL~ARAVANRTdAcFIRViGSELVQK-----  250 (435)
T KOG0729         180 GGCKEQIEKLREVVELPLLHPERFVNLGIDPP---KGVLLY-GPPGTGKTLCARAVANRTDACFIRVIGSELVQK-----  250 (435)
T ss_pred             CCHHHHHHHHHHHHHCCCCCHHHHHHCCCCCC---CCEEEE-CCCCCCHHHHHHHHHCCCCCEEEEEHHHHHHHH-----
T ss_conf             36699999999988432558888875278998---733786-899986108999874566745876311899999-----


Q ss_pred             HCCCCCHHCCCCCCC----CCCHHHHHCCCEEEEECCHHH-----------CCHHHHHHHHHHHHHHHCCCCCCCEECCC
Q ss_conf             104780002564443----100355515851777404455-----------02899999999877750217799776125
Q gi|254780163|r  552 LIGAPPGYVGFGQGG----ILADSVDQNPYSVVLLDEIEK-----------SHPDVLNILLQIMDYGILTDQSGKKISFR  616 (798)
Q Consensus       552 LiGappGYvG~~egg----~Lte~vr~~P~sVvl~DEiEK-----------Ah~~v~~~llqild~G~ltd~~Gr~vdf~  616 (798)
                             |||  ||-    .|.+.-|.+--|+|+||||+-           ...+|+...|.++-.=-=.|..|      
T Consensus       251 -------YvG--EGARMVRElFeMAr~KKACiiFFDEiDAiGGaRFDDg~ggDNEVQRTMLEli~QLDGFDpRG------  315 (435)
T KOG0729         251 -------YVG--EGARMVRELFEMARTKKACIIFFDEIDAIGGARFDDGAGGDNEVQRTMLELINQLDGFDPRG------  315 (435)
T ss_pred             -------HHH--HHHHHHHHHHHHHCCCCEEEEEEECCCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCCCCC------
T ss_conf             -------862--46899999999852365279984101022672035788872799999999998603778888------


Q ss_pred             CEEEEEECCC
Q ss_conf             4299994242
Q gi|254780163|r  617 NVILIMTTNA  626 (798)
Q Consensus       617 n~iii~TsN~  626 (798)
                      |.-++|.+|-
T Consensus       316 NIKVlmATNR  325 (435)
T KOG0729         316 NIKVLMATNR  325 (435)
T ss_pred             CEEEEEECCC
T ss_conf             7589863489


No 282
>pfam07724 AAA_2 AAA domain (Cdc48 subfamily). This Pfam entry includes some of the AAA proteins not detected by the pfam00004 model.
Probab=98.08  E-value=9.1e-06  Score=60.58  Aligned_cols=94  Identities=26%  Similarity=0.415  Sum_probs=65.0

Q ss_pred             CCCCEEEECCCCCHHHHHHHHHHHHHHCCCCCHHHHEEEEEEEEHHHHH--------CC--CCCCCHHHHHHHHHHHHHC
Q ss_conf             7787489667641166899999999854898834520144554046753--------06--3431237899999998720
Q gi|254780163|r  224 SKNNPLYVGDPGVGKTAIAEGFAKQIVDGMVPDILLGARIFSLDMGNLI--------AG--TRYRGDFEERIKKIVKEIE  293 (798)
Q Consensus       224 ~KNn~~lvG~~gvGktaive~la~~i~~~~vp~~l~~~~i~~ld~~~l~--------ag--~~~rg~fe~r~~~~~~~~~  293 (798)
                      -..|-+++|++|||||.++..||..+-.++.       .+..+|++.+.        -|  ..|.|-=|..  .+.+.++
T Consensus         2 p~~~~l~~GPsGvGKT~lAk~la~~l~~~~~-------~~i~~dm~e~~~~~~v~~l~g~~~gyvg~~~~G--~l~~~v~   72 (168)
T pfam07724         2 PIGSFLFLGPTGVGKTELAKALAELLFGDER-------ALIRIDMSEYMEEHSVSRLIGAPPGYVGYEEGG--QLTEAVR   72 (168)
T ss_pred             CCEEEEEECCCCCCHHHHHHHHHHHHCCCCC-------CEEEECCCCCCCHHHHHHHCCCCCCCCCCCCCC--CHHHHHH
T ss_conf             8379998898998999999999999679853-------448855756542569998705899872624265--0789998


Q ss_pred             CCCCEEEEECCHHHHHCCCCCCCCCCCHHHHHHHHHCCCCEE
Q ss_conf             389839997361663015544434477788887663026603
Q gi|254780163|r  294 SYANAILYIDEIHTLVGAGSASGISVDASNLLKPALSSGAVR  335 (798)
Q Consensus       294 ~~~~~ilfideih~ligag~~~g~~~d~an~lkP~L~rg~~~  335 (798)
                      ++++-|+|||||+-.         .-++-|.|.+.|..|.++
T Consensus        73 ~~p~~VillDEIeKa---------~~~V~~~LL~ild~g~~~  105 (168)
T pfam07724        73 RKPYSIVLIDEIEKA---------HPGVQNDLLQILEGGTLT  105 (168)
T ss_pred             HCCCCEEEEHHHHHH---------CHHHHHHHHHHCCCCCEE
T ss_conf             389848986577665---------899999999870587063


No 283
>PRK09183 transposase/IS protein; Provisional
Probab=98.08  E-value=2.9e-05  Score=57.03  Aligned_cols=112  Identities=23%  Similarity=0.348  Sum_probs=66.5

Q ss_pred             CCCCCEEEECCCCCHHHHHHHHHHHHHHCCCCCHHHHEEEEEEEEHHHHHC---CCCCCCHHHHHHHHHHHHHCCCCCEE
Q ss_conf             677874896676411668999999998548988345201445540467530---63431237899999998720389839
Q gi|254780163|r  223 RSKNNPLYVGDPGVGKTAIAEGFAKQIVDGMVPDILLGARIFSLDMGNLIA---GTRYRGDFEERIKKIVKEIESYANAI  299 (798)
Q Consensus       223 R~KNn~~lvG~~gvGktaive~la~~i~~~~vp~~l~~~~i~~ld~~~l~a---g~~~rg~fe~r~~~~~~~~~~~~~~i  299 (798)
                      .++-|+||+|+||||||-++-+|+...+.       +|++++-..+..|+.   -+...|.+...++..+.    . .-+
T Consensus        99 ~~~~Nvil~G~~GtGKThLA~Alg~~A~~-------~G~~v~f~~~~~L~~~L~~a~~~~~~~~~l~r~l~----~-~dL  166 (258)
T PRK09183         99 ERNENIVLLGPSGVGKTHLAIALGYEAVR-------AGIKVRFTTAADLLLQLSTAQRQGRYKTTLQRGVM----A-PRL  166 (258)
T ss_pred             HCCCCEEEECCCCCCHHHHHHHHHHHHHH-------CCCEEEEEEHHHHHHHHHHHHHCCCHHHHHHHHHC----C-CCE
T ss_conf             55886799899998689999999999998-------79939997899999999999876859999998743----4-651


Q ss_pred             EEECCHHHHHCCCCCCCCCCCHHHHHHHHHC-CCCE-EEEEEC--CHHHHHHHHHCCH
Q ss_conf             9973616630155444344777888876630-2660-388730--4899999852011
Q gi|254780163|r  300 LYIDEIHTLVGAGSASGISVDASNLLKPALS-SGAV-RCIGST--TYSEYRQFFEKDK  353 (798)
Q Consensus       300 lfideih~ligag~~~g~~~d~an~lkP~L~-rg~~-~~Igat--T~~ey~~~~e~d~  353 (798)
                      |.|||+-..      .- +-..+++|--.++ |=+- .+|-+|  .+++|...|-.|+
T Consensus       167 LIiDdlG~~------~~-~~~~~~~lfeli~~Rye~~S~IiTSn~~~~~W~~~f~~D~  217 (258)
T PRK09183        167 LIIDEIGYL------PF-SQEEANLFFQVIAKRYEKGAMILTSNLPFGQWDQTFAGDA  217 (258)
T ss_pred             EEEHHHHCC------CC-CHHHHHHHHHHHHHHHCCCCEEEECCCCHHHHHHHCCCCH
T ss_conf             443133154------68-8889999999999985767789988999789856516869


No 284
>PRK08939 primosomal protein DnaI; Reviewed
Probab=98.07  E-value=6.2e-05  Score=54.62  Aligned_cols=126  Identities=22%  Similarity=0.274  Sum_probs=78.0

Q ss_pred             HHHHHHHHHHHHHHHCCCCCCCCCCCEEEEECCCCHHHHHHHHHHHHHC---CCCEEEEEHHHHHCCCCCCHHCCCCCHH
Q ss_conf             8999999999877520445657874068861432003889999987304---7733772068861246530110478000
Q gi|254780163|r  483 EEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFAL---GVQLLRFDMSEYMERHAVSRLIGAPPGY  559 (798)
Q Consensus       483 ~~ai~~v~~~i~~~~~gl~~~~rP~g~flf~GptGvGKTelak~la~~~---~~~lir~dmsey~e~~~vs~LiGappGY  559 (798)
                      -.|+.++.+-+....     ++...--+++.||.|||||.|+.++|-.+   +.+.+-+.|++|...-.-  -++.    
T Consensus       138 ~~a~~~a~~F~~~y~-----~~~~~kGlyl~G~~G~GKTyL~~aian~La~~g~~v~~v~~p~~~~~lK~--s~~d----  206 (306)
T PRK08939        138 LDALMAALDFLEAYK-----PGEKVKGLYLYGDFGVGKTYLLAAIANELAKKGVSSTLVHFPEFIRELKN--AISD----  206 (306)
T ss_pred             HHHHHHHHHHHHHHC-----CCCCCCEEEEECCCCCCHHHHHHHHHHHHHHCCCEEEEEEHHHHHHHHHH--HHCC----
T ss_conf             999999999999737-----69888778898999998999999999999986992999875999999999--8648----


Q ss_pred             CCCCCCCCCCHHHHHCCCEEEEECCH--HHCCHHHHHHHHHHHHHHHCCCCCCCEECCCCEEEEEECCCCHHHHHH
Q ss_conf             25644431003555158517774044--550289999999987775021779977612542999942421455330
Q gi|254780163|r  560 VGFGQGGILADSVDQNPYSVVLLDEI--EKSHPDVLNILLQIMDYGILTDQSGKKISFRNVILIMTTNAGALEMSK  633 (798)
Q Consensus       560 vG~~egg~Lte~vr~~P~sVvl~DEi--EKAh~~v~~~llqild~G~ltd~~Gr~vdf~n~iii~TsN~G~~~~~~  633 (798)
                         +.-..+.+++++-|  |++||+|  |...+=+-+=+|++.=+.|+....         -.|+|||..-+++..
T Consensus       207 ---~s~~~~i~~~k~~~--vLiLDDiGaE~~t~W~rd~vl~~IL~~Rm~~~l---------PTffTSN~~~~eLe~  268 (306)
T PRK08939        207 ---GSVKEKIDAVKEAP--VLMLDDIGAEQMSSWVRDEVLGVILQYRMQEEL---------PTFFTSNFDFDELEH  268 (306)
T ss_pred             ---CCHHHHHHHHHCCC--EEEEECCCCCCCCHHHHHHHHHHHHHHHHHCCC---------CEEEECCCCHHHHHH
T ss_conf             ---98899999984499--899844465426777899899999999997499---------979977999999999


No 285
>KOG0743 consensus
Probab=98.07  E-value=7.3e-05  Score=54.12  Aligned_cols=219  Identities=19%  Similarity=0.246  Sum_probs=120.0

Q ss_pred             CCCCCCHHHHHCCHHHHHHHHCCHHHHHHHCHHHHHHHHHHH-HHHHHCCCCCCCCCCCEEEEECCCCHHHHHHHHHHHH
Q ss_conf             024531011100112334210000246653458999999999-8775204456578740688614320038899999873
Q gi|254780163|r  451 MNRSIHTTSFSRDDDSVLSNLEKNLGTVVYGQEEAIKKLSSS-IKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAF  529 (798)
Q Consensus       451 ~~~gip~~~~~~~~~~~l~~l~~~l~~~v~GQ~~ai~~v~~~-i~~~~~gl~~~~rP~g~flf~GptGvGKTelak~la~  529 (798)
                      .|.-+|...-..-+.   +.|+..++++|+.-=+   ..++. -.-.+.|-.  =|  --+||-||+|+|||-+--|+|-
T Consensus       188 ~W~~v~f~HpstF~T---laMd~~~K~~I~~Dl~---~F~k~k~~YkrvGka--wK--RGYLLYGPPGTGKSS~IaAmAn  257 (457)
T KOG0743         188 EWRSVGFPHPSTFET---LAMDPDLKERIIDDLD---DFIKGKDFYKRVGKA--WK--RGYLLYGPPGTGKSSFIAAMAN  257 (457)
T ss_pred             CCEECCCCCCCCCCC---CCCCHHHHHHHHHHHH---HHHHCCHHHHHCCCC--CC--CCCEEECCCCCCHHHHHHHHHH
T ss_conf             612568999987442---0148667899999999---997223578864845--00--0412047999988899999972


Q ss_pred             HCCCCEEEEEHHHHHCCCCCCHHCCCCCHHCCCCCCCCCCHHHHHCCCEEEEECCHHHCC----------HHH-------
Q ss_conf             047733772068861246530110478000256444310035551585177740445502----------899-------
Q gi|254780163|r  530 ALGVQLLRFDMSEYMERHAVSRLIGAPPGYVGFGQGGILADSVDQNPYSVVLLDEIEKSH----------PDV-------  592 (798)
Q Consensus       530 ~~~~~lir~dmsey~e~~~vs~LiGappGYvG~~egg~Lte~vr~~P~sVvl~DEiEKAh----------~~v-------  592 (798)
                      .++-...-++.++-..-...-+|+=                  ...+-||||+..|+-+-          ++-       
T Consensus       258 ~L~ydIydLeLt~v~~n~dLr~LL~------------------~t~~kSIivIEDIDcs~~l~~~~~~~~~~~~~~~~~V  319 (457)
T KOG0743         258 YLNYDIYDLELTEVKLDSDLRHLLL------------------ATPNKSILLIEDIDCSFDLRERRKKKKENFEGDLSRV  319 (457)
T ss_pred             HCCCCEEEEEECCCCCCHHHHHHHH------------------HCCCCCEEEEEECCCCCCCCCCCCCCCCCCCCCCCEE
T ss_conf             0587367744002368389999997------------------2899718999612432304434555664546776606


Q ss_pred             -HHHHHHHHHHHHCCCCCCCEECC-CCEEEEEECCCCHHHHHHCCCCCCCCCCHHHHHHHHHHHCCHHHH--CCCCEEEE
Q ss_conf             -99999987775021779977612-542999942421455330368988211148899999872887881--77682896
Q gi|254780163|r  593 -LNILLQIMDYGILTDQSGKKISF-RNVILIMTTNAGALEMSKARIGFGSSRNDDADKEALRNFLSPEFL--NRLDSIIP  668 (798)
Q Consensus       593 -~~~llqild~G~ltd~~Gr~vdf-~n~iii~TsN~G~~~~~~~~~g~~~~~~~~~~~~~l~~~f~pefl--nRid~ii~  668 (798)
                       +.=||.-+|        |---+| ..-|||||+|-             .            ..+-|.++  +|+|.-|.
T Consensus       320 TlSGLLNfiD--------GlwSscg~ERIivFTTNh-------------~------------EkLDPALlRpGRmDmhI~  366 (457)
T KOG0743         320 TLSGLLNFLD--------GLWSSCGDERIIVFTTNH-------------K------------EKLDPALLRPGRMDMHIY  366 (457)
T ss_pred             EHHHHHHHHC--------CCCCCCCCCEEEEEECCC-------------H------------HHCCHHHCCCCCCEEEEE
T ss_conf             6477566413--------430048873499994687-------------1------------006886628875225667


Q ss_pred             CCCCCHHHHHHHHHHHHHH-----HHHHHHHCCCEEEECHH-HHHHHHHCCCCCCCCCHHHHHHHHHH
Q ss_conf             2889999999999999999-----99999866988999889-99999971898101532679999986
Q gi|254780163|r  669 FFPLSSDIIRQVVHKFIMK-----LELQLQEKGISFHFSEE-VINWLVSHGYDVKMGARPLERIIKEH  730 (798)
Q Consensus       669 F~~l~~~~~~~i~~~~l~~-----l~~~l~~~~i~l~~~~~-~~~~l~~~~~~~~~GAR~l~r~i~~~  730 (798)
                      +.--+.+.+..++.++|.-     |...+.+.--..+++|+ +-+.|...--|+.--.+.|.+.+++.
T Consensus       367 mgyCtf~~fK~La~nYL~~~~~h~L~~eie~l~~~~~~tPA~V~e~lm~~~~dad~~lk~Lv~~l~~~  434 (457)
T KOG0743         367 MGYCTFEAFKTLASNYLGIEEDHRLFDEIERLIEETEVTPAQVAEELMKNKNDADVALKGLVEALESK  434 (457)
T ss_pred             CCCCCHHHHHHHHHHHCCCCCCCHHHHHHHHHHHCCCCCHHHHHHHHHHCCCCHHHHHHHHHHHHHHH
T ss_conf             26698799999999833898873067999987633746899999998635653889999999998763


No 286
>COG2607 Predicted ATPase (AAA+ superfamily) [General function prediction only]
Probab=98.06  E-value=0.001  Score=45.84  Aligned_cols=159  Identities=24%  Similarity=0.344  Sum_probs=90.6

Q ss_pred             HHHHHHHHHHHHHCCCCCCEEEECCCCCHHHHHHHHHHHHHHCCCCCHHHHEEEEEEEEHHHHHCCCCCCCHHHHHHHHH
Q ss_conf             78999999998622677874896676411668999999998548988345201445540467530634312378999999
Q gi|254780163|r  209 RHEEINRTIQILCRRSKNNPLYVGDPGVGKTAIAEGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGDFEERIKKI  288 (798)
Q Consensus       209 Rd~EI~riiqIL~RR~KNn~~lvG~~gvGktaive~la~~i~~~~vp~~l~~~~i~~ld~~~l~ag~~~rg~fe~r~~~~  288 (798)
                      |+.=++.+-+-+.-.--||++|.|--|.||+++|-.+-......       +.|+++++-.-|.+           |-.+
T Consensus        69 k~~L~~NT~~F~~G~pANnVLLwGaRGtGKSSLVKA~~~e~~~~-------glrLVEV~k~dl~~-----------Lp~l  130 (287)
T COG2607          69 KEALVRNTEQFAEGLPANNVLLWGARGTGKSSLVKALLNEYADE-------GLRLVEVDKEDLAT-----------LPDL  130 (287)
T ss_pred             HHHHHHHHHHHHCCCCCCCEEEECCCCCCHHHHHHHHHHHHHHC-------CCEEEEECHHHHHH-----------HHHH
T ss_conf             99999989999728865236776377777479999999998741-------77079976888865-----------7999


Q ss_pred             HHHHCCCC-CEEEEECCHHHHHCCCCCCCCCCCHHHHHHHHHCCCC-----EEEEEECCH-----HHHHH----------
Q ss_conf             98720389-8399973616630155444344777888876630266-----038873048-----99999----------
Q gi|254780163|r  289 VKEIESYA-NAILYIDEIHTLVGAGSASGISVDASNLLKPALSSGA-----VRCIGSTTY-----SEYRQ----------  347 (798)
Q Consensus       289 ~~~~~~~~-~~ilfideih~ligag~~~g~~~d~an~lkP~L~rg~-----~~~IgatT~-----~ey~~----------  347 (798)
                      ++.++..+ ..|||+|++       +=+. .-++--.||++|.-|-     =-++-||..     .||..          
T Consensus       131 ~~~Lr~~~~kFIlFcDDL-------SFe~-gd~~yK~LKs~LeG~ve~rP~NVl~YATSNRRHLl~e~~~dn~~~~~eih  202 (287)
T COG2607         131 VELLRARPEKFILFCDDL-------SFEE-GDDAYKALKSALEGGVEGRPANVLFYATSNRRHLLPEDMKDNEGSTGEIH  202 (287)
T ss_pred             HHHHHCCCCEEEEEECCC-------CCCC-CCHHHHHHHHHHCCCCCCCCCEEEEEEECCCCCCCCHHHHHCCCCCCCCC
T ss_conf             999961886089995677-------7777-81389999998538855688707999715875336276642778402358


Q ss_pred             ---HHHCCHHHHHHCEE-EEECCCCHHHHHHHHHHHHHHHHHHCCCEECCHHHH
Q ss_conf             ---85201114320014-430687868999999861276654103512111789
Q gi|254780163|r  348 ---FFEKDKALVRRFQK-IDVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIR  397 (798)
Q Consensus       348 ---~~e~d~al~rrF~~-i~v~ep~~~~~~~iL~~~~~~ye~~h~v~~~~~al~  397 (798)
                         .+|---.|..||-- +.-..++.++-+.|.++    |-+|+++.++++.+.
T Consensus       203 ~~eaveEKlSlSDRFGLwL~F~~~~Q~~YL~~V~~----~a~~~~l~~~~e~l~  252 (287)
T COG2607         203 PSEAVEEKLSLSDRFGLWLSFYPCDQDEYLKIVDH----YAKHFGLDISDEELH  252 (287)
T ss_pred             HHHHHHHHHCHHHHCCEEECCCCCCHHHHHHHHHH----HHHHCCCCCCHHHHH
T ss_conf             06778776254642340450368788999999999----999859998878999


No 287
>TIGR02881 spore_V_K stage V sporulation protein K; InterPro: IPR014232   Proteins in this entry include the stage V sporulation protein K (SpoVK), a close homologue of the Rubisco expression protein CbbX (IPR000470 from INTERPRO), and are members of an ATPase family associated with various cellular activities. These proteins are strictly limited to bacterial endospore-forming species, but are not found universally among members of this group; they are missing from the Clostridium species..
Probab=98.05  E-value=0.00035  Score=49.19  Aligned_cols=207  Identities=20%  Similarity=0.339  Sum_probs=119.5

Q ss_pred             HHCHHHHHHHHHHH-------HHHHHCCCCCCCCCCCEEEEECCCCHHHHHHHHHHHH-HC------CCCEE---EEEHH
Q ss_conf             53458999999999-------8775204456578740688614320038899999873-04------77337---72068
Q gi|254780163|r  479 VYGQEEAIKKLSSS-------IKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAF-AL------GVQLL---RFDMS  541 (798)
Q Consensus       479 v~GQ~~ai~~v~~~-------i~~~~~gl~~~~rP~g~flf~GptGvGKTelak~la~-~~------~~~li---r~dms  541 (798)
                      .||=++.-..|-+-       -+|...||+....-+ -++|-|.+|+|||-.|+.||. .-      ..++|   |-|  
T Consensus         8 ~vGL~~vK~~i~EiYA~i~i~~kR~~~GLk~~~~~L-HMiFKGNPGTGKTTVAR~~gklf~emnvL~KGH~iE~ERAD--   84 (261)
T TIGR02881         8 LVGLDEVKELIKEIYAWIQINEKRKEEGLKTSKQVL-HMIFKGNPGTGKTTVARLLGKLFKEMNVLSKGHLIEVERAD--   84 (261)
T ss_pred             CCCHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCEE-EEEEECCCCCCHHHHHHHHHHHHHHCCCCCCCCEEEEEECC--
T ss_conf             048889999999999999998888751011488447-87742786684389999999998533756788678876222--


Q ss_pred             HHHCCCCCCHHCCCCCHHCCCCCCCCCC-HHHHHCCCEEEEECCH-------HHC-CHHHHHHHHHHHHHHHCCCCCCCE
Q ss_conf             8612465301104780002564443100-3555158517774044-------550-289999999987775021779977
Q gi|254780163|r  542 EYMERHAVSRLIGAPPGYVGFGQGGILA-DSVDQNPYSVVLLDEI-------EKS-HPDVLNILLQIMDYGILTDQSGKK  612 (798)
Q Consensus       542 ey~e~~~vs~LiGappGYvG~~egg~Lt-e~vr~~P~sVvl~DEi-------EKA-h~~v~~~llqild~G~ltd~~Gr~  612 (798)
                                |+|=   |+||-.  +=| |.|+|.-=.|++.||-       ||= -.+=.|.|-.-++|-     +   
T Consensus        85 ----------LVGE---YIGHTA--qkTRe~~kkA~GGvLFiDEAYSLaRGGEKDFGKEAIDtLVK~mEd~-----~---  141 (261)
T TIGR02881        85 ----------LVGE---YIGHTA--QKTREVIKKALGGVLFIDEAYSLARGGEKDFGKEAIDTLVKAMEDQ-----R---  141 (261)
T ss_pred             ----------CCCC---CCCCHH--HHHHHHHHHHCCCCHHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHC-----C---
T ss_conf             ----------1223---203004--8999999986388005577777614888876620888999987615-----6---


Q ss_pred             ECCCCEEEEEECCCCHHHHHHCCCCCCCCCCHHHHHHHHHHHCCHHHHCCCCEEEECCCCCHHHHHHHHHHHHHHHHHHH
Q ss_conf             61254299994242145533036898821114889999987288788177682896288999999999999999999999
Q gi|254780163|r  613 ISFRNVILIMTTNAGALEMSKARIGFGSSRNDDADKEALRNFLSPEFLNRLDSIIPFFPLSSDIIRQVVHKFIMKLELQL  692 (798)
Q Consensus       613 vdf~n~iii~TsN~G~~~~~~~~~g~~~~~~~~~~~~~l~~~f~peflnRid~ii~F~~l~~~~~~~i~~~~l~~l~~~l  692 (798)
                         .+-|+|+-             |+.      ..|+-. =.+-|-+-+|+.=.+-|-..+.+++..|+..++++-.-+|
T Consensus       142 ---~~lvlILA-------------GY~------~EM~yF-L~~NPGL~SRFPi~i~FPdY~~eeL~~Ia~~m~~~ReY~L  198 (261)
T TIGR02881       142 ---NELVLILA-------------GYS------DEMDYF-LSLNPGLRSRFPISIDFPDYTVEELMEIAERMVKEREYKL  198 (261)
T ss_pred             ---CCEEEEEE-------------CCH------HHHHHH-HHCCCCCCCCCCCEEECCCCCHHHHHHHHHHHHHHHHHCC
T ss_conf             ---98689970-------------876------899998-6207797776650541889988899999999986464225


Q ss_pred             HHCCCEEEECHHHHHHHHHCCC--C-CCCCCHHHHHHHHHHHHHHHHHHH
Q ss_conf             8669889998899999997189--8-101532679999986235999999
Q gi|254780163|r  693 QEKGISFHFSEEVINWLVSHGY--D-VKMGARPLERIIKEHVKVPLADEI  739 (798)
Q Consensus       693 ~~~~i~l~~~~~~~~~l~~~~~--~-~~~GAR~l~r~i~~~i~~~la~~i  739 (798)
                           +=+....++++|.+...  . .-.-||-+|.+|++-|-..=-+.+
T Consensus       199 -----t~~A~~~lr~~l~~~~~~~~~~~sNaR~vRN~iE~AIR~QAvRlL  243 (261)
T TIGR02881       199 -----TEEAKWKLREHLAKVDQLSSREFSNARYVRNIIEKAIRRQAVRLL  243 (261)
T ss_pred             -----CHHHHHHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHHHHHHHH
T ss_conf             -----788999999997412444210057620124288999999998764


No 288
>KOG0652 consensus
Probab=98.01  E-value=8.8e-05  Score=53.51  Aligned_cols=156  Identities=26%  Similarity=0.351  Sum_probs=97.1

Q ss_pred             HHHHHHHHHHHHHH--HH-----------CCCCCCEEEECCCCCHHHHHHHHHHHHHHCCCCCHHHHEEEEEEEEHHHHH
Q ss_conf             22178999999998--62-----------267787489667641166899999999854898834520144554046753
Q gi|254780163|r  206 LVGRHEEINRTIQI--LC-----------RRSKNNPLYVGDPGVGKTAIAEGFAKQIVDGMVPDILLGARIFSLDMGNLI  272 (798)
Q Consensus       206 VIGRd~EI~riiqI--L~-----------RR~KNn~~lvG~~gvGktaive~la~~i~~~~vp~~l~~~~i~~ld~~~l~  272 (798)
                      +=|-|+.|+.+++-  |.           =|--..+++-|+||.|||-++...|-.-...  --.|.+-.++.       
T Consensus       173 iGGldkQIqELvEAiVLpmth~ekF~~lgi~pPKGvLmYGPPGTGKTlmARAcAaqT~aT--FLKLAgPQLVQ-------  243 (424)
T KOG0652         173 IGGLDKQIQELVEAIVLPMTHKEKFENLGIRPPKGVLMYGPPGTGKTLMARACAAQTNAT--FLKLAGPQLVQ-------  243 (424)
T ss_pred             CCCHHHHHHHHHHHHCCCCCCHHHHHHCCCCCCCCEEEECCCCCCHHHHHHHHHHHCCCH--HHHHCCHHHHH-------
T ss_conf             325789999999886145656878874688899722765799975779999998740106--88732647776-------


Q ss_pred             CCCCCCCHHHHHHHHHHHHHCCCCCEEEEECCHHHHHCCCCC-CCCC---------CCHHHHHHHHHCCCCEEEEEECCH
Q ss_conf             063431237899999998720389839997361663015544-4344---------777888876630266038873048
Q gi|254780163|r  273 AGTRYRGDFEERIKKIVKEIESYANAILYIDEIHTLVGAGSA-SGIS---------VDASNLLKPALSSGAVRCIGSTTY  342 (798)
Q Consensus       273 ag~~~rg~fe~r~~~~~~~~~~~~~~ilfideih~ligag~~-~g~~---------~d~an~lkP~L~rg~~~~IgatT~  342 (798)
                         .|-|+--.-++.-+.-++...+.|+||||+..| |+-.. +.-+         +..-|-|-..-+..++++|+||.-
T Consensus       244 ---MfIGdGAkLVRDAFaLAKEkaP~IIFIDElDAI-GtKRfDSek~GDREVQRTMLELLNQLDGFss~~~vKviAATNR  319 (424)
T KOG0652         244 ---MFIGDGAKLVRDAFALAKEKAPTIIFIDELDAI-GTKRFDSEKAGDREVQRTMLELLNQLDGFSSDDRVKVIAATNR  319 (424)
T ss_pred             ---HHHCCHHHHHHHHHHHHHCCCCEEEEEECHHHH-CCCCCCCCCCCCHHHHHHHHHHHHHCCCCCCCCCEEEEEECCC
T ss_conf             ---653341889999998753349838997300232-3343653123438999999999986048997562678852164


Q ss_pred             HHHHHHHHCCHHHHH--HC-EEEEECCCCHHHHHHHHHHH
Q ss_conf             999998520111432--00-14430687868999999861
Q gi|254780163|r  343 SEYRQFFEKDKALVR--RF-QKIDVSEPSIEDAIEIVKGI  379 (798)
Q Consensus       343 ~ey~~~~e~d~al~r--rF-~~i~v~ep~~~~~~~iL~~~  379 (798)
                      -.     --||||-|  |. .+|..+-|+.+.-.+||+--
T Consensus       320 vD-----iLDPALlRSGRLDRKIEfP~Pne~aRarIlQIH  354 (424)
T KOG0652         320 VD-----ILDPALLRSGRLDRKIEFPHPNEEARARILQIH  354 (424)
T ss_pred             CC-----CCCHHHHHCCCCCCCCCCCCCCHHHHHHHHHHH
T ss_conf             34-----348888644664444348899778988999886


No 289
>smart00763 AAA_PrkA PrkA AAA domain. This is a family of PrkA bacterial and archaeal serine kinases approximately 630 residues long. This is the N-terminal AAA domain.
Probab=98.01  E-value=0.00014  Score=51.97  Aligned_cols=107  Identities=15%  Similarity=0.166  Sum_probs=65.9

Q ss_pred             EEEEECCHHHCCHHHHHHHHHHHHHHHCC-CCCCCEECCCCEEEEEECCCCHHHHHHCCCCCCCCCCHHHHHHHHH-HHC
Q ss_conf             17774044550289999999987775021-7799776125429999424214553303689882111488999998-728
Q gi|254780163|r  578 SVVLLDEIEKSHPDVLNILLQIMDYGILT-DQSGKKISFRNVILIMTTNAGALEMSKARIGFGSSRNDDADKEALR-NFL  655 (798)
Q Consensus       578 sVvl~DEiEKAh~~v~~~llqild~G~lt-d~~Gr~vdf~n~iii~TsN~G~~~~~~~~~g~~~~~~~~~~~~~l~-~~f  655 (798)
                      .++=|-|+=|++.+.+.-||.+-++|... |...-.++|. .+||-+||--                   ...+.+ ...
T Consensus       238 Gi~ef~E~~K~~~~~L~~LL~~tqE~~vk~~~~~~~~~~d-~viia~sNe~-------------------E~~~f~~~~~  297 (361)
T smart00763      238 GILEFVEMFKADIKFLHPLLTATQEGNIKGTGGFAMIPID-GLIIAHSNES-------------------EWQRFKSNKK  297 (361)
T ss_pred             CCEEHHHHHHCCHHHHHHHHCCCCCCEECCCCCCCCCCCC-EEEEECCCHH-------------------HHHHHHCCCC
T ss_conf             6000487751759999998420103604178865653245-1588249859-------------------9987644841


Q ss_pred             CHHHHCCCCEEEECCCCCHHHHHHHHHHHHHHHHHHHHHCCCEEEECHHHHHHHH
Q ss_conf             8788177682896288999999999999999999999866988999889999999
Q gi|254780163|r  656 SPEFLNRLDSIIPFFPLSSDIIRQVVHKFIMKLELQLQEKGISFHFSEEVINWLV  710 (798)
Q Consensus       656 ~peflnRid~ii~F~~l~~~~~~~i~~~~l~~l~~~l~~~~i~l~~~~~~~~~l~  710 (798)
                      -+.|+.|+..|=+=.-|.-.+=.+|.++.+..-      .-....+.|.+++..+
T Consensus       298 ~ea~~dR~~~i~vPY~l~~~~E~kIY~k~l~~~------~~~~~h~aPhtl~~aa  346 (361)
T smart00763      298 NEALLDRIIKVKVPYCLRVSEEAQIYEKLLRNS------DLTEAHIAPHTLEMAA  346 (361)
T ss_pred             CHHHHCCEEEEECCCCCCHHHHHHHHHHHHCCC------CCCCCCCCCCHHHHH