HHsearch alignment for GI: 254780163 and conserved domain: pfam00158

>pfam00158 Sigma54_activat Sigma-54 interaction domain.
Probab=99.26  E-value=2.9e-11  Score=100.14  Aligned_cols=159  Identities=20%  Similarity=0.320  Sum_probs=113.6

Q ss_pred             HHCHHHHHHHHHHHHHHHHCCCCCCCCCCCEEEEECCCCHHHHHHHHHHHHHC---CCCEEEEEHHHHHCCCCCCHHCCC
Q ss_conf             53458999999999877520445657874068861432003889999987304---773377206886124653011047
Q gi|254780163|r  479 VYGQEEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLAFAL---GVQLLRFDMSEYMERHAVSRLIGA  555 (798)
Q Consensus       479 v~GQ~~ai~~v~~~i~~~~~gl~~~~rP~g~flf~GptGvGKTelak~la~~~---~~~lir~dmsey~e~~~vs~LiGa  555 (798)
T Consensus         1 lIG~S~~m~~l~~~i~~~----a~~~~p---VLI~GE~GtGK~~lAr~IH~~S~r~~~pfi~vnc~~~~~~~le~~LFG~   73 (168)
T pfam00158         1 LIGESPAMQEVLELAKRV----APTDAT---VLITGESGTGKELFARAIHQLSPRADGPFVAVNCAAIPEELLESELFGH   73 (168)
T ss_pred             CEECCHHHHHHHHHHHHH----HCCCCC---EEEECCCCCCHHHHHHHHHHHCCCCCCCCCCCCCCCCCHHHHHHHHCCC
T ss_conf             973899999999999999----588998---8998999888899999999852435688312567899877999987587


Q ss_pred             CCH-HCCCC--CCCCCCHHHHHCCCEEEEECCHHHCCHHHHHHHHHHHHHHHCCCCCCCEECCCCEEEEEECCCCHHHHH
Q ss_conf             800-02564--443100355515851777404455028999999998777502177997761254299994242145533
Q gi|254780163|r  556 PPG-YVGFG--QGGILADSVDQNPYSVVLLDEIEKSHPDVLNILLQIMDYGILTDQSGKKISFRNVILIMTTNAGALEMS  632 (798)
Q Consensus       556 ppG-YvG~~--egg~Lte~vr~~P~sVvl~DEiEKAh~~v~~~llqild~G~ltd~~Gr~vdf~n~iii~TsN~G~~~~~  632 (798)
T Consensus        74 ~~g~f~ga~~~~~G~l----e~A~gGTL~LdeI~~L~~~~Q~~Ll~~L~~~~~~~~g~~~~~~~~vRiIast~~~-----  144 (168)
T pfam00158        74 EKGAFTGAVSDRKGLF----ELADGGTLFLDEIGELPLELQAKLLRVLQEGEFERVGGTKPIKVDVRIIAATNRD-----  144 (168)
T ss_pred             CCCCCCCCCCCCCCCE----EECCCCEEECCCHHHCCHHHHHHHHHHHHCCEEEECCCCCEEEEEEEEEEECCCC-----
T ss_conf             6676689875789964----2269987880244139999999999998579699779984588854999965988-----


Q ss_pred             HCCCCCCCCCCHHHHHHH-HHHHCCHHHHCCCCEEEE
Q ss_conf             036898821114889999-987288788177682896
Q gi|254780163|r  633 KARIGFGSSRNDDADKEA-LRNFLSPEFLNRLDSIIP  668 (798)
Q Consensus       633 ~~~~g~~~~~~~~~~~~~-l~~~f~peflnRid~ii~  668 (798)
T Consensus       145 --------------L~~~v~~G~Fr~DLyyrLn-v~~  166 (168)
T pfam00158       145 --------------LEEAVAEGRFREDLYYRLN-VVP  166 (168)
T ss_pred             --------------HHHHHHCCCCHHHHHHHHC-EEE
T ss_conf             --------------9999883996399888865-232