HHsearch alignment for GI: 254780163 and conserved domain: pfam00437

>pfam00437 GSPII_E Type II/IV secretion system protein. This family contains both type II and type IV pathway secretion proteins from bacteria. VirB11 ATPase is a subunit of the Agrobacterium tumefaciens transfer DNA (T-DNA) transfer system, a type IV secretion pathway required for delivery of T-DNA and effector proteins to plant cells during infection.
Probab=97.53  E-value=0.00016  Score=51.70  Aligned_cols=91  Identities=24%  Similarity=0.322  Sum_probs=54.6

Q ss_pred             CEEEEECCCCHHHHHHHHHHHHHC---CCCEEEE-EHHHHHCCCCC-CHHCCCCCHHCCCCCCCCCCHHHHHCCCEEEEE
Q ss_conf             068861432003889999987304---7733772-06886124653-011047800025644431003555158517774
Q gi|254780163|r  508 GCYVFSGPTGVGKTEISKQLAFAL---GVQLLRF-DMSEYMERHAV-SRLIGAPPGYVGFGQGGILADSVDQNPYSVVLL  582 (798)
Q Consensus       508 g~flf~GptGvGKTelak~la~~~---~~~lir~-dmsey~e~~~v-s~LiGappGYvG~~egg~Lte~vr~~P~sVvl~  582 (798)
T Consensus       140 ~~ilIsG~TGSGKTT~l~all~~i~~~~~riitiED~~El~l~~~~~v~l~~~-~~~~t~~--~ll~~~LR~~P-D~Iiv  215 (283)
T pfam00437       140 GNILVSGGTGSGKTTLLYALLNEINTDDERIVTIEDPVEIQLEGPNQVQLNTR-LAGVTFA--DLLRAALRQRP-DRIMV  215 (283)
T ss_pred             CEEEEECCCCCCHHHHHHHHHHHCCCCCCCEEEECCCCEECCCCCCEEEEEEC-CCCCCHH--HHHHHHHCCCC-CEEEE
T ss_conf             75999889999889999999984087776278733785231798878999855-8876999--99999638899-98975


Q ss_pred             CCHHHCCHHHHHHHHHHHHHHHC
Q ss_conf             04455028999999998777502
Q gi|254780163|r  583 DEIEKSHPDVLNILLQIMDYGIL  605 (798)
Q Consensus       583 DEiEKAh~~v~~~llqild~G~l  605 (798)
T Consensus       216 GEiR~--~Ea~~~-l~a~~TGH~  235 (283)
T pfam00437       216 GEIRD--GETADI-LRAANTGHP  235 (283)
T ss_pred             CCCCC--HHHHHH-HHHHHCCCC
T ss_conf             78699--899999-999975998