HHsearch alignment for GI: 254780163 and conserved domain: pfam01695

>pfam01695 IstB IstB-like ATP binding protein. This protein contains an ATP/GTP binding P-loop motif. It is found associated with IS21 family insertion sequences. The function of this protein is unknown, but it may perform a transposase function.
Probab=98.32  E-value=3.3e-06  Score=63.77  Aligned_cols=101  Identities=23%  Similarity=0.351  Sum_probs=55.3

Q ss_pred             EEEEECCCCHHHHHHHHHHHH---HCCCCEEEEEHHHHHCCCCCCHHCCCCCHHCCCCCCCCCCHHHH-HCCCEEEEECC
Q ss_conf             688614320038899999873---04773377206886124653011047800025644431003555-15851777404
Q gi|254780163|r  509 CYVFSGPTGVGKTEISKQLAF---ALGVQLLRFDMSEYMERHAVSRLIGAPPGYVGFGQGGILADSVD-QNPYSVVLLDE  584 (798)
Q Consensus       509 ~flf~GptGvGKTelak~la~---~~~~~lir~dmsey~e~~~vs~LiGappGYvG~~egg~Lte~vr-~~P~sVvl~DE  584 (798)
T Consensus        49 Nlll~G~~GtGKThLA~Ai~~~~~~~g~~v~f~~~~~L~~~l~~~~~-----------~~-~~~~~l~~~~~~dlLIiDD  116 (178)
T pfam01695        49 NLLLLGPPGVGKTHLACALGHQACRAGYSVLFTRTPDLVEQLKRARG-----------DG-RLARTLQRLAKADLLILDD  116 (178)
T ss_pred             CEEEECCCCCCHHHHHHHHHHHHHHCCCEEEEEECHHHHHHHHHHHH-----------CC-CHHHHHHHHHCCCEEEEEH
T ss_conf             68998999987899999999999986985999961679999998752-----------67-4999999962589788720


Q ss_pred             HH--HCCHHHHHHHHHHHHHHHCCCCCCCEECCCCEEEEEECCCCHHHHH
Q ss_conf             45--5028999999998777502177997761254299994242145533
Q gi|254780163|r  585 IE--KSHPDVLNILLQIMDYGILTDQSGKKISFRNVILIMTTNAGALEMS  632 (798)
Q Consensus       585 iE--KAh~~v~~~llqild~G~ltd~~Gr~vdf~n~iii~TsN~G~~~~~  632 (798)
T Consensus       117 lG~~~~s~~~~~~lf~li~~Ry-----e~~-----s-tIiTSN~~~~~W~  155 (178)
T pfam01695       117 IGYLPLSQEAAHLLFELISDRY-----ERR-----S-TILTSNLPFGEWH  155 (178)
T ss_pred             HCCCCCCHHHHHHHHHHHHHHH-----CCC-----C-EEEECCCCHHHHH
T ss_conf             0165689899999999999997-----568-----8-6877689978998